Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL001C6.25ON74572634940.0
SAKL0E01452g6.25ON73769919900.0
Ecym_30306.25ON74770419260.0
KLLA0D01309g6.25ON74471618600.0
Kpol_1037.296.25ON74659617160.0
Kwal_56.224476.25ON73571217010.0
Suva_15.1766.25ON74570216980.0
KAFR0G026606.25ON73571216770.0
ZYRO0C07678g6.25ON74170216730.0
KNAG0M012306.25ON73870616680.0
Smik_15.1706.25ON77351316520.0
NCAS0H008606.25ON75555316410.0
KLTH0C11066g6.25ON73570316360.0
TDEL0G044406.25ON73569716290.0
Skud_15.1626.25ON73452616230.0
TPHA0J003706.25ON74370216240.0
YOR001W (RRP6)6.25ON73355316160.0
TBLA0A071706.25ON77171016200.0
NDAI0D008506.25ON79055716130.0
CAGL0E02585g6.25ON73751515660.0
YOR251C (TUM1)8.691ON304135850.12
Smik_15.4348.691ON304136780.75
KLTH0E01870gna 1ON336111771.2
NDAI0G029903.172ON31976742.2
Suva_8.3008.691ON304148742.4
SAKL0E00704g6.3ON87477734.1
Kpol_457.88.530ON447129716.4
NCAS0C036503.172ON310100698.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL001C
         (745 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...  1350   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   771   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   746   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   721   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   665   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   659   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...   658   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   650   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   649   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   647   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...   640   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   636   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   634   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   632   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...   629   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   630   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...   627   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   628   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   625   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   607   0.0  
YOR251C Chr15 complement(802550..803464) [915 bp, 304 aa] {ON}  ...    37   0.12 
Smik_15.434 Chr15 complement(752241..753155) [915 bp, 304 aa] {O...    35   0.75 
KLTH0E01870g Chr5 complement(175513..176523) [1011 bp, 336 aa] {...    34   1.2  
NDAI0G02990 Chr7 (694187..695146) [960 bp, 319 aa] {ON} Anc_3.172      33   2.2  
Suva_8.300 Chr8 complement(541671..542585) [915 bp, 304 aa] {ON}...    33   2.4  
SAKL0E00704g Chr5 complement(45027..47651) [2625 bp, 874 aa] {ON...    33   4.1  
Kpol_457.8 s457 complement(15156..16499) [1344 bp, 447 aa] {ON} ...    32   6.4  
NCAS0C03650 Chr3 (732603..733535) [933 bp, 310 aa] {ON} Anc_3.172      31   8.4  

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score = 1350 bits (3494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 667/726 (91%), Positives = 667/726 (91%)

Query: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60
           MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV
Sbjct: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60

Query: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120
           DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH
Sbjct: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120

Query: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180
           DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP
Sbjct: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180

Query: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240
           HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE
Sbjct: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240

Query: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300
           HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL
Sbjct: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300

Query: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360
           QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD
Sbjct: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360

Query: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420
           YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE
Sbjct: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420

Query: 421 STEPWRKLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXXET 480
           STEPWRKLMYQYN            YEWRDTVARRDDESVRYVMPNQ           ET
Sbjct: 421 STEPWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSET 480

Query: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSNPAATLSLHM 540
           AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSNPAATLSLHM
Sbjct: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSNPAATLSLHM 540

Query: 541 IQNLDDHFRSLLMEAQKQXXXXXXXXXXXLLFNSDLATGPSAVEYTNGQKHVIGDNVLQT 600
           IQNLDDHFRSLLMEAQKQ           LLFNSDLATGPSAVEYTNGQKHVIGDNVLQT
Sbjct: 541 IQNLDDHFRSLLMEAQKQSGSICSQHSSSLLFNSDLATGPSAVEYTNGQKHVIGDNVLQT 600

Query: 601 RKHALLQKFTSQPVEPVTDIEAPSHQSSSENPQVSEDISPSEPQESQNEVQKDEPDFEKS 660
           RKHALLQKFTSQPVEPVTDIEAPSHQSSSENPQVSEDISPSEPQESQNEVQKDEPDFEKS
Sbjct: 601 RKHALLQKFTSQPVEPVTDIEAPSHQSSSENPQVSEDISPSEPQESQNEVQKDEPDFEKS 660

Query: 661 EIVVLRXXXXXXXXXXXGTSSSPTETVDYSNAKEVLGKGTSSTAXXXXXXXXXXXXXXPY 720
           EIVVLR           GTSSSPTETVDYSNAKEVLGKGTSSTA              PY
Sbjct: 661 EIVVLRKKKKAHAQKPKGTSSSPTETVDYSNAKEVLGKGTSSTAKRGDKDRPRKRKFDPY 720

Query: 721 GQDNNA 726
           GQDNNA
Sbjct: 721 GQDNNA 726

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/699 (54%), Positives = 501/699 (71%), Gaps = 8/699 (1%)

Query: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60
           M+S   D L   +V T+RAA+ALSAQD+DF++SL   + + ++ +S+ +++LINE+LLS+
Sbjct: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSI 60

Query: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120
           DENN+ ++ G+DNF++SWK++ ++MDN+FEKSDHAFD++K  S ++    N+QYL DSS 
Sbjct: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGNS-NVQYLDDSSR 119

Query: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180
            +  PSKRIEKPQL FKTP+DNTE HPFKPLL+ KPHAL+PL E L   PE EN+P+HYP
Sbjct: 120 SNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYP 179

Query: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240
           HPY YEID Q YN+S+L++R+ I  QPWE T+P+WVD  ESL ++L+EL+  KE+AVDLE
Sbjct: 180 HPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLE 239

Query: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300
           HHDYRSYYGIVCLMQIS+R +DWLVDTIALR++LHVLN I  DP+V+KVFHGAFMD+IWL
Sbjct: 240 HHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWL 299

Query: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360
           QRDLG+YVVSLFDTYHASR+LG P+HSLAYLLE FA+FKTSKKYQLADWR+RPL KP+R 
Sbjct: 300 QRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRA 359

Query: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420
           YAR+DTHFLL+IYD LRN+L++  KLA VL+ SRNVAKRRFEYTSFRP+I  ++V+SPIE
Sbjct: 360 YARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIE 419

Query: 421 STEPWRKLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXXET 480
             EPWR LMYQYN            YEWRDT+ARRDDES RYVMPNQ           + 
Sbjct: 420 KDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDP 479

Query: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSNPAATLSLHM 540
           AGVLSVS ++TDYVRSN++ L+NLIK+TLE++K G  S     SS+    + +  LS+  
Sbjct: 480 AGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKDLSQVLSISQ 539

Query: 541 IQNLDDHFRSLLMEAQKQXXXXXXXXXXXLLFNSD-LATGPSAVEYTNGQKHVIGDNVLQ 599
           IQN+   F SL  + +K            +LF+ D + +   AV Y+   K VI +N LQ
Sbjct: 540 IQNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQLQ 599

Query: 600 TRKHALLQKFTSQPVEPVTDIEAPSHQSSSENPQVSEDISPSEPQESQNEVQKDEPDFEK 659
            RK  + +K   +  EP  D     + ++ E  +VS+D+  SE  +     + D  +  K
Sbjct: 600 ERKLEVSEKL-KEVQEP--DFRLHVNVTTKETDEVSKDV--SEKDDVNRASETDPLETNK 654

Query: 660 SEIVVLRXXXXXXXXXXXGT-SSSPTETVDYSNAKEVLG 697
            EI+VL+              +S+  E +DY NA+++LG
Sbjct: 655 DEIIVLKKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLG 693

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/704 (54%), Positives = 482/704 (68%), Gaps = 12/704 (1%)

Query: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60
           M+S ++D L  +I+ T+RAA++L+AQDIDF R L  SVG+ LD+TS  +VSL+NE++LS 
Sbjct: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60

Query: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFD--SIKHGSSSRNEGVNMQYLADS 118
            + NN+L+ G+DN E +WK+LSN++DN+FEKSDH+ D       SSS     NMQYL   
Sbjct: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVD 120

Query: 119 SHDDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAH 178
           S  D   S+RI KPQL FK PVDN+E HPFKPLLK KPHALKPLEE   L  E E VPAH
Sbjct: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180

Query: 179 YPHPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVD 238
           YPHPYEYEID QPY+DSVL ++E I+P  W+  EPIWVDN+ +L+ ML+ LK VKE+AVD
Sbjct: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240

Query: 239 LEHHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMI 298
           LEHHDYRSYYG+VCLMQIS+R  DWLVDTIALR DL VLN I  DP+++KVFHGAFMD+I
Sbjct: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300

Query: 299 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPL 358
           WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFA FKTSKKYQLADWR+RPL KP+
Sbjct: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360

Query: 359 RDYARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSP 418
           + YAR+DTHFLL+IYD LRN+L+K  KL+ VL+ASRNVAKRRFEYTSFRP++    V+SP
Sbjct: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420

Query: 419 IESTEPWRKLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXX 478
           IE  +PWR LM QYN            Y+WRD VAR+DDESVRYVMPNQ           
Sbjct: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480

Query: 479 ETAGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGT---ASVAEFSSSERALSNPAAT 535
           + +G+L+V +Y+ D+VR+NAR L N+I +T+E IK+G+    S+   +++  +  +P  +
Sbjct: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMS 540

Query: 536 LSLHMIQNLDDHFRSLLMEAQKQXXXXXXXXXXXLLFNSDLATGPSAVEYTNGQKHVIGD 595
           +SL  I+ +D HF+ LL E Q             LLF   L   P AV Y +  K ++ D
Sbjct: 541 VSL--IKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVND 598

Query: 596 NVLQTRKHALLQKFTSQPVEPVTDIEAPSH-QSSSENPQVSEDISPSEPQESQNEVQKDE 654
             L  RK  L QKF+   V     I   SH +  S N ++  D + +    S+ E + + 
Sbjct: 599 RELLDRKSDLSQKFSK--VFKAAGIAIGSHIEKLSSNSELPADTTSNVESPSKEESKNNS 656

Query: 655 PDF--EKSEIVVLRXXXXXXXXXXXGTSSSPTETVDYSNAKEVL 696
            D   +K EI+VL+            +     E VDY+N   +L
Sbjct: 657 DDLKEDKHEIIVLKRKRDYGSNTKSTSKQPKKEHVDYNNVNSIL 700

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/716 (51%), Positives = 492/716 (68%), Gaps = 24/716 (3%)

Query: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60
           M+S D+D L   +V T+R+++AL+AQDIDFY+SL  ++   L+DTS  ++SLIN+LLLS+
Sbjct: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSI 60

Query: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120
           D NN+ ++ G+D+F DSWK +SN+MDN+FEKSDHA D+I+ G+     G +++YL D   
Sbjct: 61  DPNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDR 120

Query: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180
            ++ PSKRIEKPQL FKTPVDNTELHPFKPLL+ KPH+L+P E SL + PEEE++P+HYP
Sbjct: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180

Query: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240
           HPYEYEID Q YNDS+L   E I  + W+ TE IWVD VE L++M DEL +  ELA+DLE
Sbjct: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240

Query: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300
           HHDYRSYYGIVCLMQIS R  DW+VDTIALR++L++LN I  DP V KV HGAFMD+IWL
Sbjct: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300

Query: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360
           QRDLGLY+V LFDTYHASR LGFPKHSLAYLLE FA FKTSKKYQLADWR+RPL KP+  
Sbjct: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360

Query: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420
           YAR+DTHFLL+I+D LRN+L++  K+++VL+ SR VAKRRFEY+SFRP++P S V+SPIE
Sbjct: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420

Query: 421 STEPWRKLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXXET 480
             EPW+ +M+QYN            YEWRDT+ARRDDES RYVMPNQ           E 
Sbjct: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480

Query: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVA--EFSSSERALSNPAATLSL 538
             VLSVS+YV++++R+N++ +ANLIKRTLE +K  + S A     S+E   ++ A  ++ 
Sbjct: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540

Query: 539 HMIQNLDDHFRSLLMEAQKQXXXXXXXXXXXLLFN--SDLATGPSAVEYTNGQKHVIGDN 596
             I+++ + F SL  E   Q           +LFN  S+L    +AV YT   + +I  +
Sbjct: 541 SQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVN-TAVRYTPKTRTLIPQH 599

Query: 597 VLQTRKH----ALLQKFTSQPVE----PVTDIEAPSHQSSSENPQVSEDISPSEPQESQN 648
            L  R+H     L Q++T +  +    P  + EAP+  S+ EN     ++  S+P  SQ 
Sbjct: 600 ELLKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDEN---RNEVITSDP--SQE 654

Query: 649 EVQKDEPDFEKSEIVVLRXXXXXXXXXXXGTSSSPT-ETVDYSNAKEVLGKGTSST 703
           E++++     K E++ LR             S   + E +DY+   ++L    ++T
Sbjct: 655 EIEEN-----KDEVITLRKRQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNT 705

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/596 (53%), Positives = 420/596 (70%), Gaps = 5/596 (0%)

Query: 9   LFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSVDENNNELK 68
           L   +VST+RAA++L+AQD+DFYR+L   +   L+++S  + ++IN LLLS++ENN EL+
Sbjct: 9   LLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSINENNEELE 68

Query: 69  PGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSHDDSTPSKR 128
            G++  E  WK+ SNVMDN+FEKSD + D I    +S +     QYL+DS+  DS PSKR
Sbjct: 69  SGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKR 128

Query: 129 IEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYPHPYEYEID 188
           + KPQL F  PVDN+E  PF PLL +KPH++K   +SL++ PE E +P+HY HPYE EID
Sbjct: 129 VTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEID 188

Query: 189 KQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLEHHDYRSYY 248
           KQ YN SVL+V E +  QPW  +E  WVD  E+L  MLD+LKE  E+AVDLEHHDYRSYY
Sbjct: 189 KQEYNASVLQVAEPLKSQPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYY 247

Query: 249 GIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWLQRDLGLYV 308
           GIVCLMQIS+R +D+LVDT+ALRD+LH+LN +  DP ++KV HGAFMD+IWLQRDLGLYV
Sbjct: 248 GIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYV 307

Query: 309 VSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRDYARSDTHF 368
           VSLFDTYHASRALGFP+HSLAYLLE +A FKTSKKYQLADWRVRPL KP+  YAR+DTHF
Sbjct: 308 VSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHF 367

Query: 369 LLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIESTEPWRKL 428
           LL+IYD +RN L++  KLAEVL  SRNVAKRRFEY+ FRP++P   V++PIE  EPWR L
Sbjct: 368 LLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTL 427

Query: 429 MYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXXETAGVLSVST 488
           +YQYN            +EWRD +ARRDDES RY+MPNQ           + AGV+SVS 
Sbjct: 428 VYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSN 487

Query: 489 YVTDYVRSNARTLANLIKRTLETIKAGTA-SVAEFSSSERALSNPAAT--LSLHMIQNLD 545
            +TD+VRSN++ +ANLIK++LE +K+  A ++  F + +  +    A+  L++  IQN+ 
Sbjct: 488 VMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTISQIQNMT 547

Query: 546 DHFRSLLMEAQKQXXXXXXXXXXXLLFNSDLATGPSAVEYTNGQKHVIGDNVLQTR 601
             F+ +                  +LF++   +    V Y + ++HV+ +  L  R
Sbjct: 548 ALFKEIASNPS-IIEKDVSKKIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQLAGR 602

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/712 (49%), Positives = 469/712 (65%), Gaps = 24/712 (3%)

Query: 1   MASTDEDP---LFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELL 57
           MA T ED    +  ++V TIRA++A+SAQD+DFY+SL  ++ + LD+TSA ++SLIN+++
Sbjct: 1   MAKTQEDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVV 60

Query: 58  LSVDENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLAD 117
           +S+D+NN+ ++PGR   E+SW  +  VMD +FEKS+HA  ++K   S+   G N+QYL D
Sbjct: 61  ISIDDNNDLIEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGSNII-GNNLQYLDD 119

Query: 118 SSHDDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPA 177
           S     T   +I KPQ  F  PVDNTE HPFKPLL +KP+AL+PL++ L L  EEE +PA
Sbjct: 120 SQPLTDTTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPA 179

Query: 178 HYPHPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAV 237
           HYPHPYEYEID Q Y++SVLE+R  I  +PWE T+  WVDN+ +L+ M+ EL + KELA+
Sbjct: 180 HYPHPYEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAI 239

Query: 238 DLEHHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDM 297
           DLEHHDYR+YYGI CLMQIS+R  DWLVDTIALRD L VLN I  +P V+KVFHGAFMD+
Sbjct: 240 DLEHHDYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDV 299

Query: 298 IWLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKP 357
           IWLQRDLGLY+VSLFDT+HASR LGFPKHSLAYLLE +A FKTSKKYQLADWR+RPL KP
Sbjct: 300 IWLQRDLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKP 359

Query: 358 LRDYARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYS 417
           L+ YAR+DTHFLL+IYD +RN+L++ GKLA+ L+ SR VAKRRFEYT FRP +  S VYS
Sbjct: 360 LKAYARADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYS 419

Query: 418 PIESTEPWRKLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXX 477
           P+E  +PWR L++ YN            YEWRDT+ARRDDES RYVMPNQ          
Sbjct: 420 PVEREDPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAP 479

Query: 478 XETAGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSN----PA 533
            +T G+LSV+++VT++VRSNA++L+ LIK+TL + +           S +++ +    P 
Sbjct: 480 TDTYGLLSVTSFVTEHVRSNAKSLSQLIKKTLASPQDLFTDQINHMDSNKSMVDSKLSPG 539

Query: 534 ATLSLHMIQNLDDHFRSLLMEAQKQXXXXXXXXXXXLLFNSDLATGPSAVEYTNGQKHVI 593
              + H  QN D + R    ++++             LF        + V Y   Q H I
Sbjct: 540 DVKANH--QNFDQYTR----KSRELVIHGPTVVRGCSLFPGKPLPNEAYVSYQGTQVHHI 593

Query: 594 GDNVLQTRKHALLQKFTSQPVEPVTD-IEAPSHQSSSENPQVSEDISPSEPQE-SQNEVQ 651
              VL  R+  + Q  T+     VT+ ++    ++ +  P+VS+++   E +E S + V 
Sbjct: 594 EPTVLDDRRELVAQNITT--TANVTEKLQVAVEKTPA--PEVSDELDEGEAKELSDDTVS 649

Query: 652 KDEPDFEKSEIVVL--RXXXXXXXXXXXGTSSSPTETVDYSNAKEVLGKGTS 701
           + + D  K EIVVL  R               +P E +D+ N K+++    S
Sbjct: 650 QLKED--KDEIVVLKRRKALPQSSSPPKNAEGNPKEILDFKNNKKIMTATAS 699

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/702 (48%), Positives = 456/702 (64%), Gaps = 24/702 (3%)

Query: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60
           MAS + D L  ++V+ IRAA++L+AQD+DFYR+L     + L   S+ +  ++N ++LS+
Sbjct: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78

Query: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120
           DE+++ L+   +   D WK+  N+MDN+ EKSDH+ D++   S+S N   ++QYL D S 
Sbjct: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138

Query: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180
            DS P+KR+EKPQL FKTP+DN+E HPF PLLKEKP+ALKPL +SL +   EEN P HYP
Sbjct: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198

Query: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240
           HPYEYEID Q YN ++L+++  I  +PW+A+EPIW+++  +L  ML++LK   E+AVDLE
Sbjct: 199 HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258

Query: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300
           HHDYRSYYG+VCLMQ+S+R +D+LVDT+ LR+DLH+LN +  +P++VKVFHGAFMD+IWL
Sbjct: 259 HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318

Query: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360
           QRDLGLYVV LFDTYHAS+A+G P+HSLAYLLE FA FKTSKKYQLADWR+RPL KP+  
Sbjct: 319 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378

Query: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420
           YAR+DTHFLL+IYD LRN L+++ KLA VL  SRNVAKRRFEY+ +RP  P S VYSP E
Sbjct: 379 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438

Query: 421 STEPWRKLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXXET 480
              PWR LMYQYN            YEWRD +ARRDDES R++MPNQ           + 
Sbjct: 439 KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498

Query: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSE-RALSNPAATLSLH 539
            GV+S+S  VTD+VR NA+ LANLIK  L ++K      AE  SS+ ++ S  A T+S  
Sbjct: 499 IGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVSSKFKSASLEAITVS-- 556

Query: 540 MIQNLDDHFRSLLMEAQKQXXXXXXXXXXXLLFNSDLATGPSAVEYTN-GQKHVIGDNVL 598
            I+++ D F S+                  +LF   L      + Y + G  H +    +
Sbjct: 557 QIRDIMDRF-SVFSSNSVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKVEDM 615

Query: 599 QTRKHALLQKFTSQPV--EPVT-DIEAPSHQSSSENPQVSEDISPSEPQESQNEVQKDEP 655
           + R     Q+F S  V  E +  ++E P +   SE   V  + +P  P       + ++P
Sbjct: 616 RDRA----QRFNSALVGLEDIKFEVEKPVNVEKSE--MVKIETTPEPP------TKIEDP 663

Query: 656 DFEKSEIVVLRXXXXXXXXXXXGTSSSPTETVDYSNAKEVLG 697
           D    E+VVL+            +  +  E VDYS    VL 
Sbjct: 664 D----EVVVLKKKRIHKKQVAKRSDVAAEEAVDYSKIPNVLS 701

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/712 (47%), Positives = 456/712 (64%), Gaps = 32/712 (4%)

Query: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60
           M   ++  L   +V+T+RA++ L+AQD+DFYRSL   V   +++ +  +  ++N ++LS+
Sbjct: 1   MLLEEQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSI 60

Query: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120
           DEN   L  G++   +SWK LSN++DN+FEKSD + D +K G+  +      +Y  +++ 
Sbjct: 61  DENYETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEYFENATT 120

Query: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180
            ++ P KRI KPQL F  P+DN+E HPF PLLKEKP+ALK ++ES  L   +ENVP HY 
Sbjct: 121 TENIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYA 180

Query: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240
           HPYEYEID QPYNDS+L+VRE I  + W  TE +WVDNVESL+ ML+++K+  E+A+DLE
Sbjct: 181 HPYEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLE 240

Query: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300
           HHDYR+YYGIVCLMQIS+R  D+LVDTIALR+DL VLN +  DP+VVKV HGAFMD+IWL
Sbjct: 241 HHDYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWL 300

Query: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360
           QRDLGLY+VSLFDT+HASRALGFP+HSLAYLLE FA FKTSKKYQLADWRVRPL K +  
Sbjct: 301 QRDLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTA 360

Query: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420
           YAR+DTHFLL+IYD LRN LV+  KL  VLN SRNVAKRRFEY+ FRPR+P  NVYS +E
Sbjct: 361 YARADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALE 420

Query: 421 STEPWRKLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXXET 480
             +PWR LM+QYN            +EWRD +ARRDDES RY+MPNQ           + 
Sbjct: 421 KEDPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDP 480

Query: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTAS---VAEFSSSERALSNPAATLS 537
           AGV+S S  VTDYVRSN++ +ANLIK  L   K        VA+  + E   S    T+S
Sbjct: 481 AGVISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVS 540

Query: 538 LHMIQNLDDHFRSLLMEAQKQXXXXXXXXXXXLLFNSD----LATGPSAVEYTNGQKHVI 593
                 + +     +  A+K                S+    L+     +EY NG+KH +
Sbjct: 541 -----QIKETASVFIQIAEKLGTCNNDQQQSKSFARSNYFGSLSKKLDIIEYKNGEKHSV 595

Query: 594 GDNVLQTRKHALLQKFTSQPVEPVTDI--EAPSHQSSSENPQVSEDISPSEPQESQNEVQ 651
               L +R       +T Q V  +T++  E P H+   E PQ+ +D    + +E +  + 
Sbjct: 596 KQQQLVSR----FNTYTKQ-VNELTNVRYELPVHK---EPPQLQKD----DVEEVKKTII 643

Query: 652 KD----EPDFEKSEIVVLRXXXXXXXXXXXGTSSSPTETVDYSNAKEVLGKG 699
            D    +P+ +  E+VVL+              +   + +DYS ++++L KG
Sbjct: 644 ADSIPAKPEIDLDEVVVLKKVNRQPNKTKL-EENEKIDFIDYSKSEKIL-KG 693

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/702 (48%), Positives = 453/702 (64%), Gaps = 12/702 (1%)

Query: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60
           MA    + L  ++V T+RAAAAL+AQD+DFYRSL   V + LD TS  +VS+IN  LL +
Sbjct: 1   MAEESNEQLLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60

Query: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120
           D+N+  L+ G++  EDS K+ SN+MDN+FEKSD + D I  G +   +G  + YL D++ 
Sbjct: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLD-ILRGRAPDRKGAALMYLDDAAR 119

Query: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180
            D  P+KRI KPQ+ F+ P+DNTE HPFKPLL+ KPHAL+PL + + L   +E++P HYP
Sbjct: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYP 179

Query: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240
            PYEYEI+ Q YN+S+L++ E I  +PW+ +EP+WVDN ESL  ML +LK+  E+AVDLE
Sbjct: 180 QPYEYEIENQEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239

Query: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300
           HHDYRSYYGIVCLMQ+S+R  D+LVDT+ALRDDL VLN +  +P +VKVFHGAFMD+IWL
Sbjct: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299

Query: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360
           QRDLGLY+VSLFDTYHASRALGFP+HSLAYLLETFA FKTSKKYQLADWRVRPL K +  
Sbjct: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359

Query: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420
           YAR+DTHFLL+IYD LRN L+   KLA VL  SRNVAKR F+Y+ +RP++P+S+VYSP++
Sbjct: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419

Query: 421 STEPWRKLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXXET 480
             + W+ LM QYN            YEWRDT+ARRDDES RYVMPNQ           + 
Sbjct: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479

Query: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSNPAATLSLHM 540
            GV+SVS  VTD+VR+NA+ LANLI ++L+ I    + +   S   +   + +  L++  
Sbjct: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHDLSQVLTVGQ 539

Query: 541 IQNLDDHFRSLLMEAQKQXXXXXXXXXXXLLFNSDLATGPSA-VEYTNGQKHVIGDNVLQ 599
           I++    F  L    +              +   ++   P   V Y    K  + D  ++
Sbjct: 540 IESQVSQFHDLSKAFKGLSQGTNSSNSSSSIIFGNILHAPCGFVGYGRSLKKPVTDKQIE 599

Query: 600 TRKHALLQKFTSQPVEPVTDIEAPSHQSS-----SENPQVSEDISPSEPQESQNEVQKDE 654
            RK  L +       E  T I+     S      +++ +VSE+    + +  + E ++D 
Sbjct: 600 KRKLELSEALEFIDAETATTIQEEDRGSELTHEPADDKKVSENDESKKEEAKETEPEED- 658

Query: 655 PDFEKSEIVVLRXXXXXXXXXXXGTSSSPTETVDYSNAKEVL 696
               K+EI+ L+              S P E +DY  +K++L
Sbjct: 659 ----KNEIITLKKVKDRGKKSKRSNESEPEEPIDYKKSKKIL 696

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/706 (46%), Positives = 444/706 (62%), Gaps = 25/706 (3%)

Query: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60
           M S ++  L  + V T+RA+++L  QD+ F+ +L  +V   + +    V+ +IN++L S+
Sbjct: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60

Query: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNE-GVNMQYLADSS 119
           DEN+       +   +SW++ +N+ DN+FEKSD + D I  G+    + G  +QYL D  
Sbjct: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120

Query: 120 HDDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHY 179
            +DS+  KRI KPQL F  PVDN+E  PFKPLL EKP+ALKPL+ESL + P  EN+P+HY
Sbjct: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180

Query: 180 PHPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDL 239
           P+PY+YEI  Q YN+ +LE R  I   PW  +EP+WVD+ E L  +L +LK+ KELA+DL
Sbjct: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240

Query: 240 EHHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIW 299
           EHHDYRSYYGIVCLMQIS+R  D+LVDTIALRD+LH+LN +  DP V KVFHGAFMD+IW
Sbjct: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300

Query: 300 LQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLR 359
           LQRDLGLY+VSLFDT+HAS+ALGFPKHSLAYLLET A FKTSKKYQLADWR+RPL KP+ 
Sbjct: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360

Query: 360 DYARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPI 419
            YAR+DTHFLL+I+D +RN L+K  KLA VL  SR VAKRRFEY+ FRP++   +V++PI
Sbjct: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420

Query: 420 ESTEPWRKLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXXE 479
           E   PWR LM+QYN            YEWRDT+ARRDDES RY+MPNQ           +
Sbjct: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480

Query: 480 TAGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSNPAATLSLH 539
              ++SV++YVTD VRSN++ LANLIK  +E+ K G  S   ++ +    S P   L+L 
Sbjct: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFVESSKLGPQS--SYTPNTENTSTPFV-LTLS 537

Query: 540 MIQNLDDHFRSLLMEAQKQXXXXXXXXXXXLLFNSDLATGPSAVEYTNGQKHVIGDNVLQ 599
            I+++   F  L    Q               F  DL+ G   V Y + +   +  +VL+
Sbjct: 538 QIKDIGMRFTKLTENFQSSSCQKISPLQRSSFFG-DLSKGKVTVSYNDAKTTPVSQSVLE 596

Query: 600 TRKHAL---LQKFTS------QPVEPVTDIEAPSHQSSSENPQVSEDISPSEPQESQNEV 650
           +R       ++ F          VEPV D+  PS  +S+E+   ++  +  +P ++  E 
Sbjct: 597 SRSKQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTES---ADSKTVEKPPKNIKE- 652

Query: 651 QKDEPDFEKSEIVVLRXXXXXXXXXXXGTSSSPTETVDYSNAKEVL 696
                  +  EIVVL+               +  E VDYS   +VL
Sbjct: 653 -------DMDEIVVLKKVKRELPKPKGNDEDAEREIVDYSKEDKVL 691

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/513 (57%), Positives = 379/513 (73%)

Query: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60
           MAS + D L  ++V+ IRAA++L+ QD+DFY++L    G+ L   S  +  + NE++LS+
Sbjct: 41  MASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSI 100

Query: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120
           DE++   +   ++    W +  N+MDN+ E SDH+ D +    +S+  G ++QYL D S 
Sbjct: 101 DEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQYLGDFSE 160

Query: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180
            + +P+KR+EKPQL FKTP+DN+E HPF PLLKEKP+ALKPL +SL L  E++N P+HYP
Sbjct: 161 KNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYP 220

Query: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240
           HPYEYEID Q Y  ++L++R+ I  + W  +EPIW+D +  L  ML+ELK V+E+AVDLE
Sbjct: 221 HPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLE 280

Query: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300
           HHDYRSYYGIVCLMQIS+R KD+LVDT+ LR+ LH+LN +  DP++VKVFHGAFMD+IWL
Sbjct: 281 HHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWL 340

Query: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360
           QRDLGLYVV LFDTYHAS+A+G P+HSLAYLLE FA FKTSKKYQLADWR+RPL KP+  
Sbjct: 341 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIA 400

Query: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420
           YAR+DTHFLL+IYD LRN L+++ KLA VL  SRNVAKRRFEY+ +RPRIP S VYSPIE
Sbjct: 401 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIE 460

Query: 421 STEPWRKLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXXET 480
              PWR LMYQYN            Y+WRD +ARRDDES R+VMPNQ           + 
Sbjct: 461 KEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDV 520

Query: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIK 513
            GV+S++  +T++VR NA+ L NLIK +L  IK
Sbjct: 521 IGVISLTNGITEHVRQNAKVLVNLIKNSLRHIK 553

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/553 (54%), Positives = 389/553 (70%), Gaps = 7/553 (1%)

Query: 6   EDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSVDENNN 65
           E  L  ++V+T+RAA+AL+AQD+DFYRS+   +   L+ +S  +  +IN +LLS+DEN+ 
Sbjct: 9   EKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVLLSIDENSE 68

Query: 66  ELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSHDDSTP 125
           ++   ++N ED WK+  N+MDN+FEKSD + D I  G    N    MQY+ + S  D TP
Sbjct: 69  QVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDEFSGRDLTP 128

Query: 126 SKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYPHPYEY 185
            K+I KPQL F TP+DNTE HPF PLLKEKP ALKPLEES+ + PE+E  P HYP PYEY
Sbjct: 129 GKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPMHYPQPYEY 188

Query: 186 EIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLEHHDYR 245
           EID Q YND +L+ ++ I    W   EPIWVD V  L  ++ +L+   E+AVDLEHHDYR
Sbjct: 189 EIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAVDLEHHDYR 248

Query: 246 SYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWLQRDLG 305
           +YYGI CLMQIS+R  D+L+DT+ALR+DL +LN +  +P + KVFHGAFMD+IWLQRDLG
Sbjct: 249 TYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDIIWLQRDLG 308

Query: 306 LYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRDYARSD 365
           LYVV LFDT+HASRA+G PKHSLAYLLE FA+FKTSKKYQLADWR+RPL K +  YAR+D
Sbjct: 309 LYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKAMHAYARAD 368

Query: 366 THFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSN--VYSPIESTE 423
           THFLL+I+D +RN+L++  KLA VL  SRNVAKRRFEY+SFRP++  +N  VYSPIE  +
Sbjct: 369 THFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLVYSPIEKDD 428

Query: 424 PWRKLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXXETAGV 483
           PW+ +M+QYN            Y+WRD +ARRDDES R+VMPNQ           +  GV
Sbjct: 429 PWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAYTPIDAPGV 488

Query: 484 LSVSTYVTDYVRSNARTLANLIKRTLETIKAGT---ASVAE--FSSSERALSNPAATLSL 538
           +SVS  VTDYVRSN++ LANLIK  L  +K       +VAE   S       + +  L++
Sbjct: 489 VSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGHDLSQKLTI 548

Query: 539 HMIQNLDDHFRSL 551
           H +QNL   F+ L
Sbjct: 549 HQLQNLKSKFQLL 561

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/703 (47%), Positives = 459/703 (65%), Gaps = 24/703 (3%)

Query: 3   STDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSVDE 62
            +++  +  ++++TIRA++A++AQD+ FY++L PS+   +++ SA ++ LIN++LLSVDE
Sbjct: 6   GSEDGSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDE 65

Query: 63  NNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEG---VNMQYLADS- 118
           NN+ ++ G +  E +W  +  VMD +FEKS+HA          R+ G     +QYL DS 
Sbjct: 66  NNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHAL----AAGEKRDNGELSKTVQYLDDSP 121

Query: 119 SHDDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAH 178
           S  D  P K+I KPQLLFK P+DN+E HPFKPLLK+KPHAL+ L+ESL L  E+E+VPAH
Sbjct: 122 SLHDGAP-KKILKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAH 180

Query: 179 YPHPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVD 238
           YP PYEYEID Q YN+SVL++ E +   PW+ TE  WVDN ++L  ML+EL    E+A+D
Sbjct: 181 YPQPYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAID 240

Query: 239 LEHHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMI 298
           LEHHDYR+YYGI CLMQIS+R KDWL+DTIALRDDL +LN +  DP + KV HGAFMD+I
Sbjct: 241 LEHHDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDII 300

Query: 299 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPL 358
           WLQRDLGLY+VSLFDTYHASR LG PKHSLAYLLE +A FKTSKKYQL+DWRVRPLPK L
Sbjct: 301 WLQRDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKAL 360

Query: 359 RDYARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSP 418
           + YAR+DTHFLL+IYD++RN+L++  KL++VL+ SRNVAKRRFE+T+FRP+I  S+V+SP
Sbjct: 361 KAYARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSP 420

Query: 419 IESTEPWRKLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXX 478
           IE  +PWR LM+QYN            YEWRD VARRDDES RYV+PNQ           
Sbjct: 421 IEREDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPT 480

Query: 479 ETAGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSNPAAT-LS 537
             A +++ ST+VT+++R NA++LA LIK++LE+    +    +  +S   + N + T +S
Sbjct: 481 TPALIMATSTFVTEHIRQNAKSLALLIKKSLES---SSNEFGQLLNSANTVQNSSPTKMS 537

Query: 538 LHMIQNLDDHFRSLLMEAQKQXXXXXXXXXXXLLFNSDLATGPSAVEYTNGQKHVIGDNV 597
              I+     F   L +   +            LF          V Y   +  ++  N 
Sbjct: 538 SEDIEKNSRMFEKFLEDFSYEKAADCGISLGSSLFQKKFVPCEEYVSYQESRASLVDHNS 597

Query: 598 LQTRKHALLQKFTSQP--VEPVTDIEAPSHQSSSENPQVSEDISPSEPQESQNEVQKDEP 655
           L+ R+H + +K+ ++     P   I A S  +  +    +ED   +E  E +N+ +K+E 
Sbjct: 598 LENRRHQVSKKYEAERDIARPQVHIRAASSHAVCDKEAGAED---NESAEEENKARKEEM 654

Query: 656 DFEKSEIVVL--RXXXXXXXXXXXGTSSSPTETVDYSNAKEVL 696
           D    E++VL  R             ++   E +D  +A+++L
Sbjct: 655 D----EVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKIL 693

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/697 (47%), Positives = 437/697 (62%), Gaps = 8/697 (1%)

Query: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60
           M   +ED L +++V TIRA++AL+AQD+DF+RSL   +G+ LD+TS  +VSLIN LL S+
Sbjct: 1   MPPAEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSI 60

Query: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120
           D+N+  L  G++   + WK+ SN+MDN+FE SD + D +     SR +G  +++L +SS 
Sbjct: 61  DQNSEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSS 120

Query: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180
           +DS PSKRI KPQL FK PV+NTE+ PF PLLKEKP AL+PL   ++  P  + VP HY 
Sbjct: 121 NDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISDIV--PGNDAVPEHYA 178

Query: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240
            PYEYEI+ Q Y +SV+   E I  +PWE TE +WVDN+E L  M+ +LK V E+AVDLE
Sbjct: 179 QPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLE 238

Query: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300
           HHDYRSYYGIVCLMQIS+R +D+L+DTIALRDDL +LN +  +P ++KVFHGAFMD+IWL
Sbjct: 239 HHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWL 298

Query: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360
           QRDLGLYVVSLFDT+HASRA+G P+HSLAYLLE FA FKTSKKYQLADWR+RPL K +  
Sbjct: 299 QRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNA 358

Query: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420
           YAR+DTHFLL+IYD LRN L++  KLA VL  SRNVAKRRFEY+ FRP  P   VY PI+
Sbjct: 359 YARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPID 418

Query: 421 STEPWRKLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXXET 480
             +PW+ LM+QY+            Y+WRDT+ARRDDES RYVMPNQ           E 
Sbjct: 419 KPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEP 478

Query: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSNPAATLSLHM 540
             V+SV++ VTD+VRSN+  LA+LIK TL +     +    F +   + ++ A+ L++  
Sbjct: 479 INVISVNSIVTDHVRSNSLVLAHLIKNTLAS-SDKESDKGTFEADNNS-TDAASLLTVPQ 536

Query: 541 IQNLDDHFRSLLMEAQKQXXXXXXXXXXXLLFNSDLATGPSAVEYTNGQKHVIGDNVLQT 600
           IQ L   F   +  A               +F   L +   AV Y       I    L  
Sbjct: 537 IQKLAACFAG-VSRAFTILQNEYKDGRSSSIFTDILTSEDDAVNYVGNNMDHITKKELGK 595

Query: 601 RKHALLQKFTSQPVEPVTDIEAPSHQSSSENPQVSEDISPSEPQESQNEVQKDEPDFEKS 660
           R    LQ    +  +  T    P  + + E+    E+I P  P+E +      + D ++ 
Sbjct: 596 RAAKALQSM--EQFDEATSYYMPIPEIAKES-NTMEEIRPPAPEEVKESPSPPKEDMDEI 652

Query: 661 EIVVLRXXXXXXXXXXXGTSSSPTETVDYSNAKEVLG 697
             +              G S      VDY+  K+VL 
Sbjct: 653 ITLKKIKKQKSQSPKELGISEREIPAVDYTKTKKVLA 689

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/526 (56%), Positives = 371/526 (70%)

Query: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60
           M S + D LF +IV  +RAA++L++QD+DFY++L       L   S  +  ++NE++LS+
Sbjct: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60

Query: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120
           DE++   +   D     WK+  N+MDN+ E SDH+ D + H ++S+  G  +QYL D S 
Sbjct: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120

Query: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180
            DS  +KR+EKPQL FK  +DN+E HPF PLLKEKP+ALKPL ESL LA  EEN P+HY 
Sbjct: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYL 180

Query: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240
           HPY YEID Q Y+  VL++++ I  + W+ +EPIW+D    L  ML++LK   E+AVDLE
Sbjct: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240

Query: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300
           HHDYRSYYGIVCLMQ+S+R +D+LVDTI LRD LH+LN +  DP +VKVFHGAFMD+IWL
Sbjct: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300

Query: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360
           QRDLGLYVV LFDTYHAS+A+G P+HSLAYLLE FA FKTSKKYQLADWR RPL KP+  
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360

Query: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420
           YAR+DTHFLL+IYD LRN L+++ KLA VL  SRNVAKRRFEY+  RPR P S VYSPIE
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420

Query: 421 STEPWRKLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXXET 480
              PWR LMYQYN            Y WRD +ARRDDES R+VMPNQ           + 
Sbjct: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480

Query: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSE 526
            GV+S++  VT++VR NA+ LANLI+  L  IK         +SSE
Sbjct: 481 IGVVSLTNGVTEHVRQNAKVLANLIENALGNIKDTNKKTTSITSSE 526

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/702 (46%), Positives = 444/702 (63%), Gaps = 15/702 (2%)

Query: 7   DPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSVDENNNE 66
           D L   +VS++RAA+AL+AQD+DFYRSL   +   L +TS  V  +IN ++ SVDEN+  
Sbjct: 4   DELLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEG 63

Query: 67  LKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSHDDSTPS 126
           L  G++N ++SWK++ N++D++FE +DH+ D++   S   +    M+YL DS + +S   
Sbjct: 64  LVEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNV 123

Query: 127 KRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYPHPYEYE 186
            R+ KPQL F  PVDN+E HPF+PLL +KP+A+ PL+E L +    E+ P HYP PYE E
Sbjct: 124 TRLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETE 183

Query: 187 IDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLEHHDYRS 246
           IDKQ YN+ VL+  + I  + WE TE IWVDN ESL+ ML+ELK   ELAVDLEHHD+RS
Sbjct: 184 IDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRS 243

Query: 247 YYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWLQRDLGL 306
           YYGI CLMQIS+R+ D+LVDTIALRD L VLNV+  DP + K+ HGAFMD+IWLQRDLGL
Sbjct: 244 YYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGL 303

Query: 307 YVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRDYARSDT 366
           Y+VSLFDTYHASRALGFP+HSLAYLLE FA FKTSK+YQLADWR RPL K +  YAR+DT
Sbjct: 304 YIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADT 363

Query: 367 HFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIESTEPWR 426
           HFLL+I+D LRN L++  KLA +L+ SR VAKRRFEY+ ++P +P S V+SP ES  PWR
Sbjct: 364 HFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWR 423

Query: 427 KLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXXETAGVLSV 486
            ++YQYN            +EWRDT+ARRDDES RY+MPNQ             AGV+SV
Sbjct: 424 SMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISV 483

Query: 487 STYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSNPAATLSLHMIQNLDD 546
           +  +TD VRSNA+ +ANLIK TLE +K    S    S++ +     +  LS   I+ +  
Sbjct: 484 NRMMTDPVRSNAKAIANLIKSTLEDMKNNNISTTVVSTTAKDKETSSNDLSTSQIKFIVS 543

Query: 547 HFRSLLMEAQKQXXX----XXXXXXXXLLFNSDLATGPSAVEYTNGQKHVIGDNVLQTRK 602
            F ++L +                   L+F+    +    + Y  G KH+I +  L  R+
Sbjct: 544 QFENILEKYSSNNSNLNDVTSKEGKDSLVFSKIFNSRDDIITYDKGTKHLITEQQLSDRQ 603

Query: 603 HALLQKFTSQPVEPVTDIEAP-SHQSSSEN--PQVSEDISPSEPQESQNEVQKDEPDFEK 659
              +     Q  E    +E   +H+ S +   P+  E IS S     +++ ++++ D   
Sbjct: 604 KE-VDAAMKQAEEIAFSMEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQEDLD--- 659

Query: 660 SEIVVLRXXXXXXXXXXXG---TSSSPTETVDYSNAKEVLGK 698
            EI+VL+           G   ++ S    +DYS   ++L +
Sbjct: 660 -EIIVLKDTKDRRNRQHRGRGRSADSDHTVIDYSKGDKILSQ 700

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/553 (53%), Positives = 393/553 (71%), Gaps = 1/553 (0%)

Query: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60
           M S + D L  R+++ +RAA++L++QD+DFY++L     ++L   +  +  + NE++LS+
Sbjct: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSI 60

Query: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120
           DE++   +   ++  D W    N+MDN+ E SDH+ D +    +S++ G ++QYL + S 
Sbjct: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120

Query: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180
            + +P+KR+EKPQL FK+P+DN+E HPF PLLKEKP+ALKPL ESL L  ++EN P+HYP
Sbjct: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180

Query: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240
           HPYEYEID Q Y+  +L++RE I  + W+ + PIWVD    L  ML++LK  KE+AVDLE
Sbjct: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240

Query: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300
           HHDYRSYYGIVCLMQIS+R +D+LVDT+ LR++LH+LN +  +P++VKVFHGAFMD+IWL
Sbjct: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300

Query: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360
           QRDLGLYVV LFDTYHAS+A+G P+HSLAYLLE FA FKTSKKYQLADWR+RPL KP+  
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360

Query: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420
           YAR+DTHFLL+IYD LRN L+++ KLA VL  SRNVAKRRFEY+ +RP  P S VYSPIE
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420

Query: 421 STEPWRKLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXXET 480
              PW+ LMYQYN            Y+WRD +ARRDDES R+VMPNQ           + 
Sbjct: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480

Query: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSE-RALSNPAATLSLH 539
            GV+S++  VT++VR NA+ LANLI+  L  IK          SSE +A      T+S+ 
Sbjct: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALRNIKNTNEEATPIPSSETKADGILLETISVP 540

Query: 540 MIQNLDDHFRSLL 552
            I+++ + F  L 
Sbjct: 541 QIRDVMERFSVLC 553

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/710 (47%), Positives = 446/710 (62%), Gaps = 23/710 (3%)

Query: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60
           M+  + + L + IV  +RA+ AL+AQD+DFY+SL   V   L+ T+   + + N LLLS+
Sbjct: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85

Query: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120
           DEN + L+ G+D   D W   SN+MDN+ EKSDH  D++   ++   +     +L ++S 
Sbjct: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145

Query: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180
            +S PSKRIEKPQLLF  PVDNT+  PFKPLL EKP+ALKPL++SL+L PE   VP HY 
Sbjct: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205

Query: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240
            PYEYEID Q YN+ V+E+R+    +PWE T  IW+D  ESL+ +L +L++  E+AVDLE
Sbjct: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265

Query: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300
           HHD RSYYGI CLMQIS+R +D++VDTI+LRDDL VLN I  +P + KVFHGA MD+IWL
Sbjct: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325

Query: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360
           QRDLGLY+VSLFDT+HAS+ALG  +HSLAYLLE +A FKTSKKYQLADWR RPL   +  
Sbjct: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385

Query: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420
           YARSDTHFLL+I+D LRN L+K  KLA VL+ SRNVAKRRFEY  FRP +P  N+Y+ IE
Sbjct: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445

Query: 421 STEPWRKLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXXET 480
              PW+ L+ QYN            +EWRD +ARRDDES RY+MP Q           ++
Sbjct: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505

Query: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKA---GTASVAEFSSSERALSNPAATLS 537
           +GV+SVS  VT++VRSN+ TLANLIK+ LE+ K+    + S + F+ S R  +N A+ +S
Sbjct: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALESTKSIPNSSDSSSTFNMS-RTDTNVASLIS 564

Query: 538 LHMIQNLDDHFRSLLMEAQKQXXXXXXXXXXXLLFNSDLATGPSAVEYTNGQKHVIGDNV 597
           +  I N+   F SL                  LLF++ + + P   +Y+  +        
Sbjct: 565 ITEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKTTSFKSED 624

Query: 598 LQTRKHALLQ---------KFTSQPVEPVTDIEAPSHQSSSENPQVSEDISPSEPQESQN 648
           +  R   L +          F  QP  PV DI+  S + ++ENP     I   EP+ +Q 
Sbjct: 625 MIARHIRLSEGLKGLSANNSFIYQP--PVEDIK--SIEITTENP-----IPTLEPKSTQK 675

Query: 649 EVQKDEPDFEKSEIVVLRXXXXXXXXXXXGTSSSPTETVDYSNAKEVLGK 698
           +  K E + +  EI+VL+                 T  VDYS AK++  K
Sbjct: 676 KTTK-EINEDNEEIIVLKKVNRKYQKGKKDADKDSTVVVDYSKAKKIFQK 724

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/557 (55%), Positives = 383/557 (68%), Gaps = 11/557 (1%)

Query: 6   EDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSVDENNN 65
           +D L  ++V T+RA+ AL+AQD+DFYRS+  +  + L +T++ +  +IN +LL+VDEN+ 
Sbjct: 25  KDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSE 84

Query: 66  ELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSHDDSTP 125
            L   ++N ED+WK+ SN+MDN+ EKSD + D +    ++     NMQYL + S  D T 
Sbjct: 85  TLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTS 144

Query: 126 SKR--IEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYPHPY 183
           SKR  I KPQL F  PVDNTE HPF PLLK KP+ALK L+ES+ L P +ENVP HY  PY
Sbjct: 145 SKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPY 204

Query: 184 EYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLEHHD 243
           EYEID QPYND +L++ + I  QPW  T  IWVD  ESL  M+ +L    E AVDLEHHD
Sbjct: 205 EYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHD 264

Query: 244 YRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWLQRD 303
           YR+YYGIVCLMQIS+R++D++VDT+ LR  L  LN    +P + KV HGAFMD+IWLQRD
Sbjct: 265 YRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRD 324

Query: 304 LGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRDYAR 363
           LGLY+VSLFDT+HASRALGFPK+SLAYLLE F+ FKTSKKYQ+ADWR+RPL K +  YAR
Sbjct: 325 LGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYAR 384

Query: 364 SDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIESTE 423
           SDTHFLL+I+D +RN LV+ GKLA VL  SRNVAKRRFEY  +RP I  S VYSPIE  +
Sbjct: 385 SDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKID 444

Query: 424 PWRKLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXXETAGV 483
           PW+ LMYQYN            Y+WRD +ARRDDES RY+MPNQ           E AGV
Sbjct: 445 PWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGV 504

Query: 484 LSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSNPAAT-------- 535
           +SVS  VTD+VRSN++ LANLIK  L  IK  T + +     E+     + T        
Sbjct: 505 VSVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSE 564

Query: 536 -LSLHMIQNLDDHFRSL 551
            LS+H +  L   F SL
Sbjct: 565 QLSIHQLNTLKSQFLSL 581

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/515 (56%), Positives = 378/515 (73%)

Query: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60
           M+S   D + K+++ T+RA+ AL++QD++F++S+  SV   L+ +  ++ S++N +LLS+
Sbjct: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60

Query: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120
           D NN +L    +N E+  KE SNVMD +FEK+D + D +   SS+ +   NMQ+L D + 
Sbjct: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120

Query: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180
            ++ PS+RI KPQL FKTPVDN+E HPFKPLL EKP+ALK +EES  L    E++P H+ 
Sbjct: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180

Query: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240
            PYEYEI  Q YN+ +LE +E I    W  T  IWVDN+ SL  M+ ELK+  E+AVDLE
Sbjct: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240

Query: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300
           HHD+RSYYG+VCLMQIS+R++D++VDTIALRDDL +LN +  +P + KVFHGAFMD+IWL
Sbjct: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300

Query: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360
           QRDLGLY+VSLFDT+HAS+ALG PKHSLAYLLE +A FKTSKKYQLADWR RPL K +  
Sbjct: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360

Query: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420
           YAR+DTHFLL+I+D +RN L+ +GKLA VL  SRNVA RRFEY+ ++P+IP +N+++P+E
Sbjct: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420

Query: 421 STEPWRKLMYQYNXXXXXXXXXXXXYEWRDTVARRDDESVRYVMPNQXXXXXXXXXXXET 480
              PWR LMYQYN            YEWRD +ARRDDES RYVMPNQ           + 
Sbjct: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480

Query: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAG 515
             V+SVS+ VTD+VR N++TLANLIK+ LE IK G
Sbjct: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLG 515

>YOR251C Chr15 complement(802550..803464) [915 bp, 304 aa] {ON}
           TUM1Rhodanese domain sulfur transferase, accepts
           persulfite from Nfs1p and transfers it to Uba4p in the
           pathway for 2-thiolation of the wobble uridine base of
           tRNAs; also stimulates sulfur transfer by Nfs1p; may be
           mitochondrially localized
          Length = 304

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 62/135 (45%), Gaps = 9/135 (6%)

Query: 288 KVFHGAFMDMIWLQRDLGLYV---VSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKY 344
           KVF  A M  + +Q+D  L V   V  F +   +  LG   H   YLL  F +++  K Y
Sbjct: 76  KVFDDA-MSNLGVQKDDILVVYDRVGNFSSPRCAWTLGVMGHPKVYLLNNFNQYREFK-Y 133

Query: 345 QLADWRVRPL-PKPLRDYARSDTHFLLSIYD-DLRNALVKAGKLAEVLNASRNVAKRRFE 402
            L   +V    P P   Y  S++     I D +    LVK+G+LA+  NA    +  RFE
Sbjct: 134 PLDSSKVAAFSPYPKSHYESSESFQDKEIVDYEEMFQLVKSGELAKKFNAFDARSLGRFE 193

Query: 403 YTSFRPR--IPDSNV 415
            T   PR  IP  ++
Sbjct: 194 GTEPEPRSDIPSGHI 208

>Smik_15.434 Chr15 complement(752241..753155) [915 bp, 304 aa] {ON}
           YOR251C (REAL)
          Length = 304

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 63/136 (46%), Gaps = 11/136 (8%)

Query: 288 KVFHGAFMDMIWLQRDLGLYVVSLFDTYHASRA---LGFPKHSLAYLLETFAKFKTSKKY 344
           +VF+ A M  + +++D  L V      + A R    LG   H   YLL  F K++ + KY
Sbjct: 76  QVFNNA-MSNLGVRKDDILVVYDRVGNFSAPRCAWTLGVMGHPKVYLLNNFNKYQ-ALKY 133

Query: 345 QLADWRV---RPLPKPLRDYARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRF 401
            L    V    P PK   + ++S     +  Y ++   LVK+G+L+   NA    +  RF
Sbjct: 134 PLDSTEVTEFSPYPKSHYESSKSFQDSEIVDYKEMFE-LVKSGELSMKFNAFDARSLGRF 192

Query: 402 EYTSFRPR--IPDSNV 415
           E T   PR  IP  ++
Sbjct: 193 EGTEPEPRPDIPSGHI 208

>KLTH0E01870g Chr5 complement(175513..176523) [1011 bp, 336 aa] {ON}
           conserved hypothetical protein
          Length = 336

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 47/111 (42%), Gaps = 7/111 (6%)

Query: 132 PQLLFKTPVDNTELHPFKPLLKEKPHAL-KPLEESLMLAPEEENVPAHYPHPYEYEIDKQ 190
           P+LL   P +  +      LL   P A  + L    M   E   + AH+PH    ++ + 
Sbjct: 95  PELLLYGPGEGAQAEAGSTLLGRYPSARDRDLGSLAMFVSERSALMAHWPHSSVRDVTQD 154

Query: 191 PYN--DSV----LEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKEL 235
           P+   D++    L V   +   PW     + + N E  + +LD+L E  EL
Sbjct: 155 PHAQLDALRSEPLRVSVLVFVTPWMERRSLQLFNGEQSTCILDQLAETPEL 205

>NDAI0G02990 Chr7 (694187..695146) [960 bp, 319 aa] {ON} Anc_3.172
          Length = 319

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 9/76 (11%)

Query: 40  QELDDTSATVVSLINE----LLLSVDENNNELKPGRDNFEDSWKELSNVMDNIFEK--SD 93
           QE+DD  ++      E    L   ++E+NNE  P  ++  D  K L   +DN+  K   D
Sbjct: 181 QEIDDKGSSTGYEFKEPNRHLKYGLEESNNEPLPCGESLCDVGKRLGPFLDNVVLKIAKD 240

Query: 94  HAFDS---IKHGSSSR 106
           H  DS   + HGS+ R
Sbjct: 241 HHLDSSLIVGHGSTVR 256

>Suva_8.300 Chr8 complement(541671..542585) [915 bp, 304 aa] {ON}
           YOR251C (REAL)
          Length = 304

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 65/148 (43%), Gaps = 9/148 (6%)

Query: 288 KVFHGAFMDMIWLQRDLGLYVVSLFDTYHASRA---LGFPKHSLAYLLETFAKFKTSKKY 344
           +VF  A M  + +Q+D  L V      + A R    L    H   YLL  F K++    Y
Sbjct: 76  QVFDDA-MSNLGVQKDDILVVYDRVGNFSAPRCAWTLAAMGHPQVYLLNNFQKYQ-ELNY 133

Query: 345 QLADWRV---RPLPKPLRDYARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRF 401
            L   +V    P PK   +  +      +  YD++   LVK+G+LA+  N     A  RF
Sbjct: 134 PLDSTKVTAFSPYPKSRYESTKDLRDEEIVNYDEMLR-LVKSGELAKKFNFFDARALGRF 192

Query: 402 EYTSFRPRIPDSNVYSPIESTEPWRKLM 429
           E T+  PR   S+ + P     P+ +L+
Sbjct: 193 EGTAPEPRPDISSGHIPGAQPLPYAELL 220

>SAKL0E00704g Chr5 complement(45027..47651) [2625 bp, 874 aa] {ON}
           some similarities with uniprot|P32383 Saccharomyces
           cerevisiae YPL268W PLC1 Phosphoinositide-specific
           phospholipase C hydrolyzes phosphatidylinositol 4 5-
           biphosphate (PIP2) to generate inositol 1 4
           5-triphosphate (IP3) and 1 2-diacylglycerol (DAG)
           involved in kinetochore function and pseudohyphal
           differentiation
          Length = 874

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 228 ELKEVKELAVDLEHHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVV 287
           EL  +K++       +YR  Y I      SS S++W+     + + L  L+VI  +    
Sbjct: 166 ELDMIKDIRAGEMARNYREEYKIS-----SSYSENWITIVYNVSNKLKALHVIASNHEDF 220

Query: 288 KVFHGAFMDMIWLQRDL 304
           K+FH   ++++  +R+L
Sbjct: 221 KIFHSCVLNLVSSRREL 237

>Kpol_457.8 s457 complement(15156..16499) [1344 bp, 447 aa] {ON}
           complement(15156..16499) [1344 nt, 448 aa]
          Length = 447

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 53/129 (41%), Gaps = 21/129 (16%)

Query: 129 IEKPQLLFKTPVDNTELHPFK-------PLLKEKPHALKPLEESLMLAPEEENVPAHYPH 181
           +++P  LFK P DN      K        LL+ K + L P +    +    +    ++  
Sbjct: 286 MQEPAFLFKVPHDNPNHSDLKMNQSLDTKLLQNKTNGLIPFQYHTSITTSGQLYTINHAL 345

Query: 182 PYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLEH 241
             +++I     N    E+R  +D  PW  T+      ++ + Q++D+ +E  + A     
Sbjct: 346 DIKFKIS----NGRDFEIRYPVDVSPWPRTQ------IKYIEQVIDQERETAKFATQF-- 393

Query: 242 HDYRSYYGI 250
             Y  Y GI
Sbjct: 394 --YEGYGGI 400

>NCAS0C03650 Chr3 (732603..733535) [933 bp, 310 aa] {ON} Anc_3.172
          Length = 310

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 46/100 (46%), Gaps = 14/100 (14%)

Query: 40  QELDDTSATVVSLINE----LLLSVDENNNELKPGRDNFEDSWKELSNVMDNIFEK--SD 93
           QE+D+  ++      E    L   V+E N E  P  ++ ED  K +  + DNI  K   D
Sbjct: 172 QEVDEKGSSTGYEFKEPNRHLKYGVEEANGETLPSGESLEDVVKRMVPLFDNIVLKLAKD 231

Query: 94  HAFDS---IKHGSSSRN-----EGVNMQYLADSSHDDSTP 125
            + DS   + HGSS R+     EG++ + + D    +  P
Sbjct: 232 FSLDSSLIVGHGSSVRSILKILEGISDEAIKDVDIPNGIP 271

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,523,408
Number of extensions: 3229004
Number of successful extensions: 11020
Number of sequences better than 10.0: 71
Number of HSP's gapped: 11529
Number of HSP's successfully gapped: 71
Length of query: 745
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 628
Effective length of database: 40,065,477
Effective search space: 25161119556
Effective search space used: 25161119556
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)