Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ABR132Cna 1ON26826813250.0
Ecym_8203na 1ON2542687361e-97
NCAS0I021103.156ON84455675.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABR132C
         (268 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABR132C Chr2 complement(643692..644498) [807 bp, 268 aa] {ON} NO...   514   0.0  
Ecym_8203 Chr8 (418855..419619) [765 bp, 254 aa] {ON} similar to...   288   1e-97
NCAS0I02110 Chr9 (396834..399368) [2535 bp, 844 aa] {ON} Anc_3.1...    30   5.4  

>ABR132C Chr2 complement(643692..644498) [807 bp, 268 aa] {ON}
           NOHBY215; No homolog in Saccharomyces cerevisiae
          Length = 268

 Score =  514 bits (1325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/268 (93%), Positives = 251/268 (93%)

Query: 1   LQSEQRKRNADTKLKFMTNIDESDEDRKLGTTEPAPLIIXXXXXXXXXXXXXXXXXAFPD 60
           LQSEQRKRNADTKLKFMTNIDESDEDRKLGTTEPAPLII                 AFPD
Sbjct: 1   LQSEQRKRNADTKLKFMTNIDESDEDRKLGTTEPAPLIISEVESDDDNSSLNSDHDAFPD 60

Query: 61  WQKLVYERLAARDQTTMNAIMLNFEKTGIVDLSTIDAQFLDNFRGAFVSAQQHLRRKGCV 120
           WQKLVYERLAARDQTTMNAIMLNFEKTGIVDLSTIDAQFLDNFRGAFVSAQQHLRRKGCV
Sbjct: 61  WQKLVYERLAARDQTTMNAIMLNFEKTGIVDLSTIDAQFLDNFRGAFVSAQQHLRRKGCV 120

Query: 121 DEEQVNEQFGITSMMRILSGRTLYEEPVCSMSLLDQLKVTGAAPKGALQTNGDALPLRNA 180
           DEEQVNEQFGITSMMRILSGRTLYEEPVCSMSLLDQLKVTGAAPKGALQTNGDALPLRNA
Sbjct: 121 DEEQVNEQFGITSMMRILSGRTLYEEPVCSMSLLDQLKVTGAAPKGALQTNGDALPLRNA 180

Query: 181 DDTPQVMAKPPYASQVPLADRISMYGLDGCESGASSDYEEGDAADELPFLVDDFDLPYSG 240
           DDTPQVMAKPPYASQVPLADRISMYGLDGCESGASSDYEEGDAADELPFLVDDFDLPYSG
Sbjct: 181 DDTPQVMAKPPYASQVPLADRISMYGLDGCESGASSDYEEGDAADELPFLVDDFDLPYSG 240

Query: 241 LQSPAKKRNVDNNEQDQSNSSKRPRVGY 268
           LQSPAKKRNVDNNEQDQSNSSKRPRVGY
Sbjct: 241 LQSPAKKRNVDNNEQDQSNSSKRPRVGY 268

>Ecym_8203 Chr8 (418855..419619) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ABR132C
          Length = 254

 Score =  288 bits (736), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 142/268 (52%), Positives = 191/268 (71%), Gaps = 16/268 (5%)

Query: 1   LQSEQRKRNADTKLKFMTNIDESDEDRKLGTTEPAPLIIXXXXXXXXXXXXXXXXXAFPD 60
           LQ+  R RNAD + K M+NI+ES++++KL TTEPAPLI+                 +FPD
Sbjct: 2   LQTRSR-RNADNQFKMMSNIEESEDEKKLETTEPAPLILSEVESDDDSLSINSDHDSFPD 60

Query: 61  WQKLVYERLAARDQTTMNAIMLNFEKTGIVDLSTIDAQFLDNFRGAFVSAQQHLRRKGCV 120
           WQKLVYERL ARDQTTM AI++NFEKTGIVDLS ID+ FL++FR AF+SAQ +L++KGC+
Sbjct: 61  WQKLVYERLGARDQTTMKAIIINFEKTGIVDLSNIDSNFLESFRTAFLSAQVYLQQKGCI 120

Query: 121 DEEQVNEQFGITSMMRILSGRTLYEEPVCSMSLLDQLKVTGAAPKGALQTNGDALPLRNA 180
           D+  V E FGIT+++RILSGRTLYEEP+CS+ LLDQLK   + P  +             
Sbjct: 121 DKSNVKEHFGITNIVRILSGRTLYEEPICSIELLDQLK-QPSTPHHSY------------ 167

Query: 181 DDTPQVMAKPPYASQVPLADRISMYGLDGCESGA-SSDYEEGDAADELPFLVDDFDLPYS 239
            +  Q + KPPY SQ+PLA+RI++ GL+ C SG  S++++  +  + LPFLVDDF++PYS
Sbjct: 168 -NLSQAIQKPPYESQIPLAERITLSGLEDCGSGGDSTEHDSNNTREGLPFLVDDFEVPYS 226

Query: 240 GLQSPAKKRNVDNNEQDQSNSSKRPRVG 267
            LQSP K+RN  +NE++ S++ KRPRV 
Sbjct: 227 ELQSPVKRRNNTDNEKEDSSNIKRPRVA 254

>NCAS0I02110 Chr9 (396834..399368) [2535 bp, 844 aa] {ON} Anc_3.156
           YDL035C
          Length = 844

 Score = 30.4 bits (67), Expect = 5.4,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 211 ESGASSDYEEGDAADELPF--LVDDFDLPYSGLQSPAKKRNVDNNEQDQSNSSKR 263
           E    S  E  DA + LP   + DD D+P  GLQ    K N + +   +  +S+R
Sbjct: 342 EPHGRSSGERADAKEHLPLADVEDDSDIPEGGLQILRYKSNNNKHRPSRRGTSRR 396

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,013,916
Number of extensions: 1084707
Number of successful extensions: 2216
Number of sequences better than 10.0: 7
Number of HSP's gapped: 2264
Number of HSP's successfully gapped: 7
Length of query: 268
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 160
Effective length of database: 41,097,471
Effective search space: 6575595360
Effective search space used: 6575595360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)