Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ABR131W2.152ON59459428970.0
Ecym_82042.152ON59759622860.0
SAKL0E10956g2.152ON60060020330.0
KLTH0B05170g2.152ON59359320040.0
Kwal_33.147672.152ON59452419760.0
ZYRO0G06512g2.152ON60460418510.0
TDEL0B051402.152ON59952418430.0
Kpol_1048.212.152ON59752418150.0
KLLA0F24046g2.152ON60452517990.0
Smik_14.2072.152ON61754417710.0
YNL121C (TOM70)2.152ON61754417650.0
TPHA0I015102.152ON60352417590.0
Suva_14.2192.152ON61754417540.0
TBLA0C055302.152ON61052317490.0
Skud_14.2112.152ON61754417470.0
NCAS0G024802.152ON59652116800.0
NDAI0F028102.152ON60952216470.0
KAFR0F007202.152ON60852616160.0
KNAG0H035302.152ON61453415980.0
CAGL0L12936g2.152ON60053115940.0
NCAS0B070102.152ON62552915620.0
CAGL0L04048g2.152ON58751815020.0
YHR117W (TOM71)2.152ON63953814120.0
Skud_8.1782.152ON63853914110.0
Suva_15.3142.152ON64453914060.0
Smik_8.1952.152ON63553314020.0
NDAI0B043402.152ON66453514020.0
ACR005W6.21ON3271081516e-10
CAGL0H08195g5.617ON583851502e-09
AEL224W5.617ON580851492e-09
NDAI0I022406.21ON3501061472e-09
Suva_8.805.617ON586851483e-09
Kwal_55.199355.617ON593861483e-09
NCAS0G008105.617ON584861465e-09
TBLA0E033005.617ON5821141458e-09
YOR027W (STI1)5.617ON589851441e-08
Ecym_30256.21ON318861402e-08
Skud_15.1925.617ON589881412e-08
TPHA0D028805.617ON585851403e-08
TPHA0J003406.21ON338961373e-08
KNAG0B032005.617ON579851394e-08
Kpol_1037.266.21ON342891374e-08
TDEL0A048405.617ON576851376e-08
SAKL0E01210g6.21ON323861356e-08
Kpol_1032.86.21ON343951356e-08
SAKL0G07084g5.617ON585851376e-08
Kpol_1018.695.617ON590851351e-07
CAGL0D05060g3.481ON510951341e-07
Smik_15.2055.617ON589851341e-07
NDAI0B057903.481ON5231071332e-07
Ecym_55825.617ON584851322e-07
KLTH0F14542g3.481ON5131071304e-07
KLLA0A07062g5.617ON581861295e-07
TBLA0A072706.21ON373991268e-07
NDAI0F009105.617ON583851261e-06
KAFR0C058905.617ON575911252e-06
KLTH0E02178g5.617ON593861252e-06
ZYRO0A05676g5.617ON572761242e-06
KNAG0A079003.481ON512981242e-06
NCAS0F034903.481ON512971233e-06
Kwal_56.224336.21ON322891213e-06
KAFR0B066103.481ON5111531224e-06
KLLA0D01155g6.21ON335761204e-06
NDAI0D008106.21ON349891205e-06
Kpol_505.413.481ON513971215e-06
KNAG0B022407.412ON7392251207e-06
TBLA0C039503.481ON512951207e-06
TBLA0G010506.21ON350831189e-06
KAFR0L018707.412ON7122401191e-05
Kwal_27.118908.506ON334821171e-05
TDEL0A074306.328ON124611082e-05
TDEL0D055003.481ON5121071152e-05
TDEL0G044806.21ON343891143e-05
TPHA0D032203.481ON513951153e-05
Kpol_513.28.506ON374991134e-05
Ecym_44133.481ON510951135e-05
CAGL0C01903g7.412ON7691131135e-05
Kwal_55.211753.481ON511951135e-05
KNAG0M011706.21ON339781099e-05
AAR083C3.481ON5381451101e-04
YBL084C (CDC27)7.412ON7581641101e-04
KAFR0L004106.21ON331961081e-04
KLTH0C11220g6.21ON327891081e-04
Smik_2.2958.506ON3851131082e-04
YBR155W (CNS1)8.506ON385821082e-04
Skud_15.1686.21ON348711072e-04
NCAS0A00490singletonON620761072e-04
Skud_2.2828.506ON385821063e-04
YOR007C (SGT2)6.21ON346711053e-04
KAFR0E029808.506ON380991054e-04
ZYRO0C07788g6.21ON334741035e-04
NCAS0B024008.506ON380991045e-04
TPHA0E007407.412ON7462091056e-04
Smik_2.367.412ON7511641046e-04
Suva_15.1826.21ON3461011027e-04
TDEL0B013108.506ON380791028e-04
Suva_2.347.412ON7631641020.001
Ecym_71427.412ON6752231010.002
Smik_15.1766.21ON345861000.002
CAGL0H07425g8.506ON38093990.002
Skud_2.247.412ON7691641000.002
SAKL0H10934g8.506ON38099980.002
NCAS0H008306.21ON33889980.002
TBLA0H033808.506ON37592980.003
TBLA0D004607.412ON835217990.003
TPHA0M002706.21ON37795980.003
Suva_4.4058.506ON38586970.003
KLTH0E11748g8.506ON37892970.003
CAGL0E02739g6.21ON34374960.004
Suva_7.4083.481ON51395970.004
Kpol_1018.1067.412ON753218980.004
KLLA0B10912g3.481ON51295960.004
KNAG0I025206.328ON11790890.005
NCAS0D026706.21ON35194950.005
YGR123C (PPT1)3.481ON513107950.006
AGL268C8.506ON37979940.007
Skud_7.4323.481ON513107940.008
NDAI0C052908.506ON37992930.010
KNAG0A039508.506ON38699920.012
ZYRO0B04224g3.481ON51395910.018
Smik_6.2153.481ON51395910.020
KAFR0J025706.328ON12160850.020
ZYRO0B03828g7.412ON727210900.027
Ecym_20906.328ON17253860.031
Kpol_1028.516.328ON11763830.038
TPHA0D038606.328ON12071830.038
TBLA0I023106.328ON11661820.040
NCAS0A112003.367ON907124890.042
YCR060W (TAH1)6.328ON11159820.048
KLLA0B09966g8.506ON370100870.050
ACR168W2.665ON70795880.057
Suva_3.956.328ON11170810.058
KNAG0H006103.367ON973124880.060
TPHA0L014208.506ON37499860.069
Ecym_56372.665ON71795870.076
Ecym_25598.506ON370106860.077
KLLA0E20857g7.412ON710235860.079
ZYRO0F08624g8.506ON379123850.081
NCAS0E024907.412ON809210860.10
KNAG0F040107.546ON141880860.11
CAGL0G10087g7.546ON141147850.12
SAKL0A01672g6.328ON12861790.14
TPHA0M016303.367ON1043124840.18
SAKL0F12936g7.412ON632144820.25
Smik_3.1596.328ON11567760.32
ZYRO0C16522g3.367ON974126810.33
CAGL0D01364g3.367ON1148124800.47
TDEL0D055703.489ON649126790.55
NDAI0E040407.412ON783198790.58
Kpol_1006.43.367ON732228790.61
NDAI0A051003.367ON1007124790.66
Skud_3.1356.328ON11859730.66
Kwal_27.107407.412ON628258780.68
NCAS0A153007.546ON1398130790.73
AGR398W3.5ON105789780.76
Ecym_32754.244ON78767780.78
NCAS0H035402.665ON76078780.81
NDAI0F004005.689ON76449780.89
NCAS0D045006.328ON12158730.90
KAFR0H008703.367ON887124770.96
TPHA0C009008.310ON70159771.1
Kpol_1057.142.665ON72478761.2
KLLA0E08009g2.665ON721106761.3
NDAI0I004406.328ON12867711.5
AGL294W7.412ON656133761.5
Skud_12.4554.218ON176105731.6
TDEL0C027207.412ON700223751.6
Kpol_172.23.367ON41877751.6
Suva_4.3613.367ON963124751.8
KAFR0E012603.265ON86991751.8
Smik_2.2543.367ON102080751.9
CAGL0I02288g5.72ON639355742.1
SAKL0F03102g3.481ON51352742.3
YBR112C (CYC8)3.367ON96694742.3
Skud_2.2403.367ON98480742.6
NDAI0J001307.546ON1403104742.6
Suva_16.5217.546ON142473733.2
TBLA0H015203.367ON68980733.4
KLLA0B09262g3.367ON94180724.1
KLTH0C06204g7.412ON627204724.2
CAGL0L09823g2.665ON74381724.4
NDAI0C043205.352ON706115724.5
AAR054C6.328ON13361684.8
ZYRO0D00572g2.665ON78577715.8
Kwal_23.54087.546ON141069716.0
YLR370C (ARC18)4.218ON178105686.4
TBLA0F012303.367ON1189121706.6
ZYRO0A03036g3.265ON867124706.7
Ecym_34593.367ON1115124706.9
Skud_11.5na 1ON128661707.0
SAKL0D05390g1.265ON663143707.9
TDEL0E027505.352ON564120698.1
KLTH0H14872g5.352ON623155698.2
Smik_4.5315.291ON41477689.4
YDR141C (DOP1)8.313ON1698165699.4
KAFR0B002507.546ON1420118699.5
SAKL0H03168g4.244ON79349699.8
SAKL0B07986g3.367ON880124699.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABR131W
         (594 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...  1120   0.0  
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...   885   0.0  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...   787   0.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...   776   0.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...   765   0.0  
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...   717   0.0  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...   714   0.0  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...   703   0.0  
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...   697   0.0  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...   686   0.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...   684   0.0  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...   682   0.0  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...   680   0.0  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...   678   0.0  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...   677   0.0  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...   651   0.0  
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...   639   0.0  
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...   627   0.0  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...   620   0.0  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...   618   0.0  
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...   606   0.0  
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...   583   0.0  
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...   548   0.0  
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...   548   0.0  
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...   546   0.0  
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...   544   0.0  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...   544   0.0  
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    63   6e-10
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    62   2e-09
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    62   2e-09
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    61   2e-09
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    62   3e-09
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    62   3e-09
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    61   5e-09
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    60   8e-09
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    60   1e-08
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    59   2e-08
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    59   2e-08
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    59   3e-08
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    57   3e-08
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    58   4e-08
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    57   4e-08
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    57   6e-08
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    57   6e-08
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    57   6e-08
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    57   6e-08
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    57   1e-07
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    56   1e-07
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    56   1e-07
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    56   2e-07
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    55   2e-07
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    55   4e-07
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    54   5e-07
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    53   8e-07
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     53   1e-06
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    53   2e-06
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    53   2e-06
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    52   2e-06
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    52   2e-06
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    52   3e-06
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    51   3e-06
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    52   4e-06
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    51   4e-06
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    51   5e-06
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    51   5e-06
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    51   7e-06
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    51   7e-06
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    50   9e-06
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    50   1e-05
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    50   1e-05
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    46   2e-05
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    49   2e-05
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    49   3e-05
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    49   3e-05
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    48   4e-05
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    48   5e-05
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    48   5e-05
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    48   5e-05
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    47   9e-05
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    47   1e-04
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    47   1e-04
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...    46   1e-04
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    46   1e-04
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    46   2e-04
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    46   2e-04
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    46   2e-04
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       46   2e-04
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    45   3e-04
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    45   3e-04
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    45   4e-04
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    44   5e-04
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    45   5e-04
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    45   6e-04
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    45   6e-04
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    44   7e-04
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    44   8e-04
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    44   0.001
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    44   0.002
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    43   0.002
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    43   0.002
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    43   0.002
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    42   0.002
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    42   0.002
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    42   0.003
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    43   0.003
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    42   0.003
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    42   0.003
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    42   0.003
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    42   0.004
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    42   0.004
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    42   0.004
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    42   0.004
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    39   0.005
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...    41   0.005
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    41   0.006
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    41   0.007
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    41   0.008
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    40   0.010
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    40   0.012
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    40   0.018
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    40   0.020
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    37   0.020
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    39   0.027
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    38   0.031
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    37   0.038
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    37   0.038
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    36   0.040
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    39   0.042
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    36   0.048
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    38   0.050
ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic ho...    39   0.057
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    36   0.058
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    39   0.060
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    38   0.069
Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar...    38   0.076
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    38   0.077
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    38   0.079
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    37   0.081
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    38   0.10 
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    38   0.11 
CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} simil...    37   0.12 
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    35   0.14 
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    37   0.18 
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    36   0.25 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    34   0.32 
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    36   0.33 
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    35   0.47 
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...    35   0.55 
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    35   0.58 
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    35   0.61 
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    35   0.66 
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    33   0.66 
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    35   0.68 
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            35   0.73 
AGR398W Chr7 (1459591..1462764) [3174 bp, 1057 aa] {ON} Syntenic...    35   0.76 
Ecym_3275 Chr3 (519806..522169) [2364 bp, 787 aa] {ON} similar t...    35   0.78 
NCAS0H03540 Chr8 (672730..675012) [2283 bp, 760 aa] {ON} Anc_2.6...    35   0.81 
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    35   0.89 
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    33   0.90 
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    34   0.96 
TPHA0C00900 Chr3 (188665..190770) [2106 bp, 701 aa] {ON} Anc_8.3...    34   1.1  
Kpol_1057.14 s1057 (25908..28082) [2175 bp, 724 aa] {ON} (25908....    34   1.2  
KLLA0E08009g Chr5 (720700..722865) [2166 bp, 721 aa] {ON} simila...    34   1.3  
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    32   1.5  
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    34   1.5  
Skud_12.455 Chr12 complement(801256..801786) [531 bp, 176 aa] {O...    33   1.6  
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    33   1.6  
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    33   1.6  
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    33   1.8  
KAFR0E01260 Chr5 complement(252045..254654) [2610 bp, 869 aa] {O...    33   1.8  
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    33   1.9  
CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {...    33   2.1  
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    33   2.3  
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    33   2.3  
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    33   2.6  
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    33   2.6  
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    33   3.2  
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    33   3.4  
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    32   4.1  
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    32   4.2  
CAGL0L09823g Chr12 (1052444..1054675) [2232 bp, 743 aa] {ON} som...    32   4.4  
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    32   4.5  
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    31   4.8  
ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp...    32   5.8  
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    32   6.0  
YLR370C Chr12 complement(861718..862254) [537 bp, 178 aa] {ON}  ...    31   6.4  
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    32   6.6  
ZYRO0A03036g Chr1 (245136..247739) [2604 bp, 867 aa] {ON} simila...    32   6.7  
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    32   6.9  
Skud_11.5 Chr11 complement(10283..14143) [3861 bp, 1286 aa] {ON}...    32   7.0  
SAKL0D05390g Chr4 complement(423990..425981) [1992 bp, 663 aa] {...    32   7.9  
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    31   8.1  
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...    31   8.2  
Smik_4.531 Chr4 complement(955033..956277) [1245 bp, 414 aa] {ON...    31   9.4  
YDR141C Chr4 complement(734901..739997) [5097 bp, 1698 aa] {ON} ...    31   9.4  
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    31   9.5  
SAKL0H03168g Chr8 (296695..299076) [2382 bp, 793 aa] {ON} simila...    31   9.8  
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    31   9.9  

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 1120 bits (2897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/594 (93%), Positives = 555/594 (93%)

Query: 1   MSSENSFAGFVSRNRXXXXXXXXXXXXXXXXXXXXXXXXXXSSGEVSKDATGSTDVXXXX 60
           MSSENSFAGFVSRNR                          SSGEVSKDATGSTDV    
Sbjct: 1   MSSENSFAGFVSRNRTAIIATAAAGASAVGAYYYYQQLQRQSSGEVSKDATGSTDVKSKK 60

Query: 61  XXXXXXXXXYPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDC 120
                    YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDC
Sbjct: 61  KKKRNNKKKYPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDC 120

Query: 121 ALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYAD 180
           ALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYAD
Sbjct: 121 ALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYAD 180

Query: 181 AMLDLSAVSLYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPSNTSLASFFRIF 240
           AMLDLSAVSLYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPSNTSLASFFRIF
Sbjct: 181 AMLDLSAVSLYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPSNTSLASFFRIF 240

Query: 241 PSETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAA 300
           PSETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAA
Sbjct: 241 PSETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAA 300

Query: 301 LKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQ 360
           LKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQ
Sbjct: 301 LKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQ 360

Query: 361 NFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYRE 420
           NFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYRE
Sbjct: 361 NFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYRE 420

Query: 421 KKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVG 480
           KKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVG
Sbjct: 421 KKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVG 480

Query: 481 VAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKL 540
           VAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKL
Sbjct: 481 VAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKL 540

Query: 541 FEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMVV 594
           FEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMVV
Sbjct: 541 FEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMVV 594

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/596 (72%), Positives = 494/596 (82%), Gaps = 3/596 (0%)

Query: 1   MSSENSFAGFVSRNRXXXXXXXXXXXXXXXXXXXXXXXX--XXSSGEVSKDATGSTDVX- 57
           MSS+NSFAGF+SRN+                            S G+V    + S +   
Sbjct: 1   MSSDNSFAGFISRNKTAIIATAAAGASAVGAYYYYQQLQQQVESQGKVGGVNSPSGETRY 60

Query: 58  XXXXXXXXXXXXYPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKF 117
                       YPVD NGEPDLSG+ +FTEEQKE+Y+MA+KDKGNECFK+++YEEAIK+
Sbjct: 61  GKKKKKRANKKKYPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKY 120

Query: 118 YDCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGN 177
           Y CAL+LK+DPVFYSNRSAC+VPLNKLEKVVEDTTAAL+LKPDYSKCLLRRATANESLGN
Sbjct: 121 YSCALRLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGN 180

Query: 178 YADAMLDLSAVSLYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPSNTSLASFF 237
           +ADAMLDLSAVSLYGGY+SQ+IEPVLERNMNKQAMQVLK+KL+ G KH+LPSNTSLASFF
Sbjct: 181 FADAMLDLSAVSLYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQLPSNTSLASFF 240

Query: 238 RIFPSETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPD 297
            IFPSETS  NYDE SEAD  LLKGL  L  R+ GSYE++DE F  A +  + +H+A+ +
Sbjct: 241 GIFPSETSFANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSE 300

Query: 298 NAALKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADE 357
           + AL+ KLAIALEHVGI KFLKNEPLEA+ LLQKA+DL PRPNSYIYM LIMADKGQ DE
Sbjct: 301 DPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDE 360

Query: 358 YAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLA 417
           Y Q F+KALEL P SSA YYHR QM FV QQF+++GKDFDKAKEC+P  ++PYIQLACLA
Sbjct: 361 YLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLA 420

Query: 418 YREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGI 477
           YRE KF+DCETLFSEARR+FPTAPEVPNFYAEILSDKGD E+ALKEY+FARKLEDAQEGI
Sbjct: 421 YRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGI 480

Query: 478 HVGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEA 537
           HVGVAPLVGKA +LARQ  + +FAEAT LFE AC+KDPRSEQAKIGLAQLKLQQE+VDEA
Sbjct: 481 HVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEA 540

Query: 538 IKLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593
           I+LFE A DL+RAFEEKLQATTFAEAAKIQKRIRADP+MSAKIQETL+AYR QG+V
Sbjct: 541 IQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/600 (65%), Positives = 460/600 (76%), Gaps = 7/600 (1%)

Query: 1   MSSENSFAGFVSRNRXXXXXXXXXXXXXXXXXXXXX-------XXXXXSSGEVSKDATGS 53
           MSS+NS A FVSRN+                                 S GE        
Sbjct: 1   MSSDNSLANFVSRNKTAIIATAAAGVSAAGAYYYYKQLQQQRLSSDDASDGEAKPLKKKK 60

Query: 54  TDVXXXXXXXXXXXXXYPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEE 113
                           YPVD+NGEP L  +   T+EQKEKYAM LKDKGNE FK++++++
Sbjct: 61  KSKKKKPTSGSPTASAYPVDENGEPKLDDIDQLTDEQKEKYAMGLKDKGNEFFKEKKFDD 120

Query: 114 AIKFYDCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANE 173
           AIK+Y+ AL+LK+DPVFYSNRSACYV + +LEKVVEDTTAALKLK DYSKCLLRRA+ANE
Sbjct: 121 AIKYYNLALELKKDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANE 180

Query: 174 SLGNYADAMLDLSAVSLYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPSNTSL 233
           SLGNYADAM DLSA+SLYG ++  +IEP+LERNMNKQAM VLK+KL   + H LPSNTSL
Sbjct: 181 SLGNYADAMFDLSALSLYGDFNGASIEPMLERNMNKQAMLVLKEKLEEKKDHRLPSNTSL 240

Query: 234 ASFFRIFPSETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHE 293
           ASFF IF  ETS ENYDE+ EADR+LL+GL  L+ R +  Y+ ADE+FT A   +    E
Sbjct: 241 ASFFGIFEPETSFENYDESVEADRLLLQGLTNLYKRTSEGYDTADESFTKAAAAYKTLLE 300

Query: 294 ANPDNAALKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKG 353
            +P+N  LKQK AIALEHVGI KFLKN+PL AH+ L++A++  PR NSYIY+ LIMADKG
Sbjct: 301 ESPENEILKQKAAIALEHVGIFKFLKNDPLSAHDDLKQALEYHPRVNSYIYLALIMADKG 360

Query: 354 QADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQL 413
           QA EY +NF+KALELDP  +A YYHR QM F+ QQ++ AGKDFDKAKEC+ + ++PYIQL
Sbjct: 361 QATEYFENFDKALELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQL 420

Query: 414 ACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDA 473
           ACLAYRE KF+DCETLFSEARR+FPTAPEVPNFYAEILSDKGD  NA K+Y+ ARKLEDA
Sbjct: 421 ACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLANAKKQYEIARKLEDA 480

Query: 474 QEGIHVGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEE 533
            +GIHVG+APLVGKA LLAR+P+  NF EAT+ FE ACEKDPRSEQAKIGLAQLKLQQEE
Sbjct: 481 LDGIHVGIAPLVGKATLLAREPTVENFVEATQNFEEACEKDPRSEQAKIGLAQLKLQQEE 540

Query: 534 VDEAIKLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593
           VDEAI LFE AADL+R+F+EKLQATTFAEA KIQK+IRADP++SAKI+ETL AYRAQGM+
Sbjct: 541 VDEAITLFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIISAKIEETLAAYRAQGMI 600

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/593 (64%), Positives = 458/593 (77%)

Query: 1   MSSENSFAGFVSRNRXXXXXXXXXXXXXXXXXXXXXXXXXXSSGEVSKDATGSTDVXXXX 60
           MSS+NSF  FV+RN+                           + +   ++   +      
Sbjct: 1   MSSDNSFGQFVARNKTAIVASVAAGATAVGAYYYYQQLQRQPANKKEPESESKSSKKKKK 60

Query: 61  XXXXXXXXXYPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDC 120
                    YPV++ GEPDLS +A  ++EQK+KYAM LKDKGNE FK+++Y+EAI++Y  
Sbjct: 61  TKKKAPGPSYPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSW 120

Query: 121 ALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYAD 180
           A+++KEDPVFYSNRSACYV L + EKVVEDTTAALKLKPDYSKCLLRRA+ANESLGN+AD
Sbjct: 121 AIEVKEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFAD 180

Query: 181 AMLDLSAVSLYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPSNTSLASFFRIF 240
           AM DLSAVSLYG +S  +IEP+LERNMNKQ+M VLK+KL   ++++LPSNTSLASFF IF
Sbjct: 181 AMFDLSAVSLYGDFSGASIEPLLERNMNKQSMLVLKEKLEKQQEYKLPSNTSLASFFGIF 240

Query: 241 PSETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAA 300
             ET+ ENYD+ SEAD+ LL+GL  L+ R A  YE AD +F  A + F    E NP++A 
Sbjct: 241 QPETTFENYDDNSEADKYLLEGLTNLYKRTADGYETADLSFAKARDAFKVLLEQNPEDAD 300

Query: 301 LKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQ 360
           LK+K AIALEHVGI KFLKN+P+ AH  L+KA++ FPRPN+YIYM LIMADKGQA EY  
Sbjct: 301 LKRKAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFD 360

Query: 361 NFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYRE 420
           NFEKAL+LDP  +A YYHR QM F+ QQF+QAGKDF+KAKE   S ++PYIQLACL YRE
Sbjct: 361 NFEKALKLDPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYRE 420

Query: 421 KKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVG 480
            KFDD ETLFSEARR+FPTAPEVPNFYAE LSDKGD   A K+YD A KLEDA +GIHVG
Sbjct: 421 GKFDDSETLFSEARRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIAAKLEDALDGIHVG 480

Query: 481 VAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKL 540
           V+PL+GKA LL+R+PS  NF EAT+LFE AC+ DPRSEQAKIGLAQLKLQQE++DEAI L
Sbjct: 481 VSPLIGKATLLSREPSVENFVEATQLFEKACQNDPRSEQAKIGLAQLKLQQEDIDEAIAL 540

Query: 541 FEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593
           FE AADL+R+F+EKLQATTFAEA KIQK+IRADPV+SAKI+ETL AYRAQGM+
Sbjct: 541 FEEAADLARSFDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAAYRAQGMI 593

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/524 (70%), Positives = 438/524 (83%)

Query: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129
           +PVD+ GEPDL  +   + E+K+K+AM LKDKGNE FK++++E+A+K+Y  A+++KEDPV
Sbjct: 71  FPVDEKGEPDLGKVDELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEVKEDPV 130

Query: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189
           FYSNRSACYV L + EKVVEDTTAALKLKPDYSKCLLRRA+ANESLG +ADAM DLSAVS
Sbjct: 131 FYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAMFDLSAVS 190

Query: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPSNTSLASFFRIFPSETSLENY 249
           LYG ++  +IEP+LERNMNKQAM VLK+KL   ++++LPSNTSLASFF IF  ETS ENY
Sbjct: 191 LYGDFNGSSIEPLLERNMNKQAMLVLKEKLEKQQEYKLPSNTSLASFFGIFQPETSFENY 250

Query: 250 DETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAIAL 309
           DE SEAD+ LL GL  L+ R +G YE AD AF+ A +++    E N ++A+LKQK AIAL
Sbjct: 251 DENSEADKALLDGLTNLYKRTSGGYEAADAAFSKARDEYKTLLEHNSEDASLKQKAAIAL 310

Query: 310 EHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALELD 369
           EHVGI KFLKN+P+ AH  L+KA++ FPRPN+YIYM LIMADKGQA EY  NFEKALELD
Sbjct: 311 EHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFEKALELD 370

Query: 370 PKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETL 429
           P  +A YYHR QM+F+ QQF+QAGKDF+KAKE + S ++PYIQLACL YRE KF D ETL
Sbjct: 371 PNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACLTYREGKFSDSETL 430

Query: 430 FSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAA 489
           FSEARR+FPT+PEVPNFYAE LSDKGD   A KEYD A KLE A +GIHVGV+PL+GKA 
Sbjct: 431 FSEARRKFPTSPEVPNFYAETLSDKGDIAGAKKEYDIAAKLESALDGIHVGVSPLIGKAT 490

Query: 490 LLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLSR 549
           LL+R+PS  NF EAT+LFE ACE DPRSEQAKIGLAQLKLQQE++DEAI LFE AADL+R
Sbjct: 491 LLSREPSVENFIEATRLFEQACENDPRSEQAKIGLAQLKLQQEDIDEAIALFEEAADLAR 550

Query: 550 AFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593
           +F+EKLQATTFAEA KIQK+IRADP++SAKI+ETL AYRAQGM+
Sbjct: 551 SFDEKLQATTFAEATKIQKKIRADPIVSAKIEETLAAYRAQGMI 594

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/604 (59%), Positives = 446/604 (73%), Gaps = 11/604 (1%)

Query: 1   MSSENSFAGFVSRNRXXXXXXXXXXXXXXXXXXXXXXXXXXSSGEVSK----DATGSTDV 56
           MSS+NS AGF+SRN+                          +  +  K    D T ++  
Sbjct: 1   MSSDNSVAGFISRNKTAIITTAAAGTAAVGAYLYYRQLQDAAGSDDKKGESPDGTAASKK 60

Query: 57  XXXXXXXXX-------XXXXYPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQ 109
                               YPVD+ GEP L  +A  +EEQKE ++ ALKDKGNE FK +
Sbjct: 61  KRKNKKKKQGSSPSPSAAVSYPVDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQK 120

Query: 110 RYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRA 169
            Y+ A+K+YD AL LK+DPVFYSN SACYV +N+L+KVVE++T AL+LKPDYSK LLRRA
Sbjct: 121 DYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRA 180

Query: 170 TANESLGNYADAMLDLSAVSLYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPS 229
           +ANESL NY DAM DLS +SL G +   +IEP+LERN+NKQAM VLK KL   +   LPS
Sbjct: 181 SANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQAMTVLKDKLGQQKNQLLPS 240

Query: 230 NTSLASFFRIFPSETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFT 289
           +T+LASFF IF  ET   NYDETSEAD+ L  GL  L+ R +  Y+ ADE F+ AV+ + 
Sbjct: 241 DTALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYA 300

Query: 290 AAHEANPDNAALKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIM 349
              E N D+AALK+K AIALEH GI +FLKN+PL AH  +QKAIDL PR NSYIYM LIM
Sbjct: 301 KLREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIM 360

Query: 350 ADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYP 409
           ADKG+A+EY + F+KA++LDPK++A YYHR QM F+  Q+++AG+DFDKAK+ +   ++P
Sbjct: 361 ADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFP 420

Query: 410 YIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARK 469
           YIQLACLAYRE KFDDCETLFSEA+R+F TAPEVPNF+AEIL+DKGD E ALK+YD A++
Sbjct: 421 YIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKR 480

Query: 470 LEDAQEGIHVGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKL 529
           LE+A +GIHVG++PLVGKA LLARQPS  NF EATKL E AC KDPRSEQ K+GLAQLKL
Sbjct: 481 LEEAVDGIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKL 540

Query: 530 QQEEVDEAIKLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRA 589
           QQE++D+AIKLFE AA L+R  +EKLQATTFAEAAK+QKRIRADP++SAKI+ETL AY+A
Sbjct: 541 QQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKA 600

Query: 590 QGMV 593
           QG++
Sbjct: 601 QGVI 604

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/524 (66%), Positives = 419/524 (79%)

Query: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129
           YPV QNGEP L  +   ++E +E YA ALKD+GNE FK + Y+ A+K+Y+ AL +K+DPV
Sbjct: 76  YPVGQNGEPLLENIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYALVVKKDPV 135

Query: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189
           FYSN SACYV L +L+KVVE++T AL+LKPDYSK LLRRA+ANESL NYADAM DLS +S
Sbjct: 136 FYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLRRASANESLENYADAMFDLSVLS 195

Query: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPSNTSLASFFRIFPSETSLENY 249
           L G ++  +IEP+LERN+NKQAM VLK KL      +LPSNT+LASFF IFP ET+  NY
Sbjct: 196 LNGDFNGSSIEPMLERNLNKQAMFVLKDKLGNNVSQQLPSNTALASFFGIFPPETTFANY 255

Query: 250 DETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAIAL 309
           +E  EAD  L  GL  L+ R +  Y++ADEAF  +   FT      PD+A LK+K AIAL
Sbjct: 256 NENDEADVGLKNGLEDLYKRSSEGYKLADEAFVKSASFFTNKLSEFPDDAVLKEKTAIAL 315

Query: 310 EHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALELD 369
           EH GI KFLKN+PLEAH+ ++KAI L PR NSYIYM LIMADKGQA+EY Q F+KA+ LD
Sbjct: 316 EHNGIFKFLKNDPLEAHDDIEKAIQLHPRLNSYIYMALIMADKGQAEEYYQYFDKAIALD 375

Query: 370 PKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETL 429
           P    AYYHR QM ++  Q+++AGKDFDKAKECD + ++PYIQLACLAYRE KFDDCETL
Sbjct: 376 PNYGPAYYHRGQMYYITGQYEKAGKDFDKAKECDENNIFPYIQLACLAYREDKFDDCETL 435

Query: 430 FSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAA 489
           FSEA+R+FPTAPEVPNFYAEIL DKGD E ALK+Y+ A++LE+A +GIHVGVAPLVGKA 
Sbjct: 436 FSEAKRKFPTAPEVPNFYAEILGDKGDLEAALKQYEIAKRLEEALDGIHVGVAPLVGKAT 495

Query: 490 LLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLSR 549
           LLARQPS  NF EAT L E AC +DP SEQAK+GLAQLKLQQEEVDEAI LFE AA+L+R
Sbjct: 496 LLARQPSVENFREATLLLEEACRRDPTSEQAKVGLAQLKLQQEEVDEAINLFEEAANLAR 555

Query: 550 AFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593
             +EKLQATTFAEAAK+QKRI+ADPV+SAKI+ETL AYRAQGM+
Sbjct: 556 TVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETLAAYRAQGMM 599

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/524 (64%), Positives = 423/524 (80%)

Query: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129
           YP+D NGEPDL   A FTEEQKE Y++ALKDKGN+ FK+Q+YE+A+K+Y+ AL LK+DPV
Sbjct: 74  YPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPV 133

Query: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189
           FYSN SACYV L  LEKVVE +T AL+LKPDYSK LLRRA+ANE+L N+A+AM DLS +S
Sbjct: 134 FYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLS 193

Query: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPSNTSLASFFRIFPSETSLENY 249
           L G ++  +IEP+LERN+NKQAM+VLK K+S   K +LPSNT LASFF IF  ET+L+N+
Sbjct: 194 LNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQLPSNTFLASFFGIFTPETTLKNF 253

Query: 250 DETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAIAL 309
           DE++EAD  LL  L  L+ R++ SY IADE+F+ A E +    EANPD+  LK+K A AL
Sbjct: 254 DESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTATAL 313

Query: 310 EHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALELD 369
           E+ GI KFLKN+PL +H  +Q++I+L PR N+YIY  LIMADKG++  Y   F+KAL++D
Sbjct: 314 EYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALDVD 373

Query: 370 PKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETL 429
           P S+  YYHR QM+F+ QQ+++A  DF+KAKE D S ++PYIQLACL Y E KFDDCETL
Sbjct: 374 PNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEGKFDDCETL 433

Query: 430 FSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAA 489
           FSEA+R+FPTAPEVPNFYAE+L+DKGDF+ A K+YD A++LE++ + IHVGV+PLVGKA 
Sbjct: 434 FSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGKAT 493

Query: 490 LLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLSR 549
           LLARQP+  N  E+T L E AC+ D RSEQAKIGLAQLKLQQEE+DEAI LFE A+DL+R
Sbjct: 494 LLARQPTVENLLESTTLLEEACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASDLAR 553

Query: 550 AFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593
             EEKLQATTFAEA+K+QK+IRADPV++AKIQ TL AYR QG++
Sbjct: 554 NMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/525 (64%), Positives = 418/525 (79%), Gaps = 2/525 (0%)

Query: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129
           YPVD NG+PDLS    FT EQ +KYA+ALKDKGNE FK + +E+AI++Y  A+ LKEDPV
Sbjct: 79  YPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPV 138

Query: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189
           FYSNRSA YV +N  EKVVEDTTAALKLKPDYSKC LRRA+A E+LG ++DAM DLSAVS
Sbjct: 139 FYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVS 198

Query: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKL--SGGEKHELPSNTSLASFFRIFPSETSLE 247
           L G YS Q++E +LERNMNKQA +VL +KL  + G++  LPSNTSLASFF IF  ETS +
Sbjct: 199 LLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSFD 258

Query: 248 NYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAI 307
           +YD  +EAD  L KGL  L+  Q G YE+ADE FT A E +    E++PDN +LK+K AI
Sbjct: 259 DYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAI 318

Query: 308 ALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALE 367
           A EHVGI KF KN+P+ AH  L++++ L PRP++YIYM LIMADKG+A++Y + F+KALE
Sbjct: 319 AFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKALE 378

Query: 368 LDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCE 427
           LDP  SA YYHR QM+FV++ F +AG DFDKAKE +P  ++ YIQ ACLA+R+ +FDDCE
Sbjct: 379 LDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCE 438

Query: 428 TLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGK 487
           TLFSEARR+FPTAPEVPNFYAEIL+ K   + A+K+YD A KLEDA  GIHVG+AP++GK
Sbjct: 439 TLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGK 498

Query: 488 AALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADL 547
           A  L R P+  NF EA++LFE AC+ DPRSEQAKIGLAQLKLQQEE+D+AI+LFE AADL
Sbjct: 499 ATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558

Query: 548 SRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGM 592
           SR+F+EKLQATTFAEA K+QK+IRADP +  KI E + AYRAQG+
Sbjct: 559 SRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/544 (61%), Positives = 416/544 (76%), Gaps = 20/544 (3%)

Query: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129
           YPV  NG+PD S  A FT E+K++YA+ALKDKGN+ F++++Y++AIK+Y+ AL+LK+DPV
Sbjct: 74  YPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDDPV 133

Query: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189
           FYSN SACYV +  L+KVVE +T AL+LKPDYSK LLRRA+ANE LGN+ADAM DLS +S
Sbjct: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLS 193

Query: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSG--------------------GEKHELPS 229
           L G ++  +IEP+LERN+NKQAM  LK+K                        +   LPS
Sbjct: 194 LNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTENLPS 253

Query: 230 NTSLASFFRIFPSETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFT 289
            TS+ASFF IF  E +  NYDE++EAD+ L+ GL  L+ R   SY+ ADE+FT AV+ F 
Sbjct: 254 ITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDKADESFTKAVKLFD 313

Query: 290 AAHEANPDNAALKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIM 349
              + N ++   K+KLAI+LEH GI KFLKN+PL AH  ++KAI+LFPR NSYIYM LIM
Sbjct: 314 EQLDKNNEDEKSKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIM 373

Query: 350 ADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYP 409
           AD+  + EY   F+KAL+LD  +S+ YYHR QMNF++Q +DQAGKDFDKAKE DP  ++P
Sbjct: 374 ADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433

Query: 410 YIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARK 469
           YIQLACLAYRE KFDDCETLFSEA+R+FP APEVPNF+AEIL+DK DFE ALK+YD A +
Sbjct: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIE 493

Query: 470 LEDAQEGIHVGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKL 529
           LE+  +GI+VG+APLVGKA LL R P+  NF EAT L E A + DPRSEQAKIGLAQ+KL
Sbjct: 494 LENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQMKL 553

Query: 530 QQEEVDEAIKLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRA 589
           QQE++DEAI LFE +ADL+R  EEKLQA TFAEAAK+QKRIR+DP+++AKIQETL   R 
Sbjct: 554 QQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKIQETLAKLRE 613

Query: 590 QGMV 593
           QG++
Sbjct: 614 QGLM 617

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/544 (61%), Positives = 414/544 (76%), Gaps = 20/544 (3%)

Query: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129
           YPV  NGEPD S  A FT E+K+KYA+ALKDKGN+ F++++Y++AIK+Y+ AL+LKEDPV
Sbjct: 74  YPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKEDPV 133

Query: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189
           FYSN SACYV +  L+KVVE +T AL+LKPDYSK LLRRA+ANE LG +ADAM DLS +S
Sbjct: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVLS 193

Query: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSG--------------------GEKHELPS 229
           L G ++  +IEP+LERN+NKQAM  LK+K                        ++  LPS
Sbjct: 194 LNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQPAKERKDKQENLPS 253

Query: 230 NTSLASFFRIFPSETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFT 289
            TS+ASFF IF  E +  NYDE++EAD+ L+ GL  L+ R   SY+ ADE+FT A   F 
Sbjct: 254 VTSMASFFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDKADESFTKAARLFE 313

Query: 290 AAHEANPDNAALKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIM 349
              + N ++  LK+KLAI+LEH GI KFLKN+PL AH  ++KAI+LFPR NSYIYM LIM
Sbjct: 314 EQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIM 373

Query: 350 ADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYP 409
           AD+  + EY   F+KAL+LD  +S+ YYHR QMNF++Q +DQAGKDFDKAKE DP  ++P
Sbjct: 374 ADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433

Query: 410 YIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARK 469
           YIQLACLAYRE KFDDCETLFSEA+R+FP APEVPNF+AEIL+DK DF+ ALK+YD A +
Sbjct: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493

Query: 470 LEDAQEGIHVGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKL 529
           LE+  +GI+VG+APLVGKA LL R P+  NF EAT L E A + DPRSEQAKIGLAQ+KL
Sbjct: 494 LENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKL 553

Query: 530 QQEEVDEAIKLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRA 589
           QQE++DEAI LFE +ADL+R  EEKLQA TFAEAAK+Q+RIR+DPV++ KIQETL   R 
Sbjct: 554 QQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAKKIQETLAKLRE 613

Query: 590 QGMV 593
           QG++
Sbjct: 614 QGLM 617

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/524 (63%), Positives = 421/524 (80%)

Query: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129
           YPV  NGEPDLSG  +F++E KEKYAMALKDKGN+ FK Q +E A+K+Y+ AL LK+DPV
Sbjct: 80  YPVASNGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDFENALKYYNYALTLKQDPV 139

Query: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189
           FYSN SACYV L +LEKVVE +T ALKLK DYSK LLRRA+A ESL NY DAM+DLS +S
Sbjct: 140 FYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRASAYESLANYVDAMVDLSVLS 199

Query: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPSNTSLASFFRIFPSETSLENY 249
           L G ++  +IEP+LERN+NKQAMQVLK+K++  +   LPSNTSLASFF +F  E SL N+
Sbjct: 200 LNGDFNGASIEPMLERNLNKQAMQVLKEKIAENKPQLLPSNTSLASFFGVFKPEVSLNNF 259

Query: 250 DETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAIAL 309
           +E SE+++ LL GL  L++R    Y +ADE+F  AV+     +E N +N  +K+K AIAL
Sbjct: 260 NENSESEKELLNGLTNLYSRTNDGYLVADESFQKAVKLLEKEYEENKENNDIKEKYAIAL 319

Query: 310 EHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALELD 369
           E+ GILKFLKN+PL+AHN +QKAI +FPR NSYIY  LI+ADKG+ +E  +NF+ A+ LD
Sbjct: 320 EYNGILKFLKNDPLDAHNDIQKAIFIFPRVNSYIYNSLILADKGETEESIKNFDAAINLD 379

Query: 370 PKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETL 429
             ++A YYHR Q+ F+ QQ+++AG DFDKAKE D S + PYIQLACLAY+E KF+DCETL
Sbjct: 380 ATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPYIQLACLAYKENKFNDCETL 439

Query: 430 FSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAA 489
           FSEARR+FPTAPEVPNFYA++L ++ +F+ ALK+YD ++KLE+A EGIHVG+AP++GKA 
Sbjct: 440 FSEARRKFPTAPEVPNFYADVLLERNEFDKALKQYDISKKLEEAVEGIHVGIAPMIGKAT 499

Query: 490 LLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLSR 549
           LLAR P   N  E+T+LFE AC+ DPRSEQAKIGLAQLKLQQEEVDEAI LFE AA L+R
Sbjct: 500 LLARNPIVENLLESTELFEEACKLDPRSEQAKIGLAQLKLQQEEVDEAIALFEEAAFLAR 559

Query: 550 AFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593
             +EKLQATTFAEA+K+QK++R+DPV++ KIQETL AY+ QG++
Sbjct: 560 NMDEKLQATTFAEASKVQKKVRSDPVINQKIQETLAAYQQQGLM 603

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/544 (61%), Positives = 415/544 (76%), Gaps = 20/544 (3%)

Query: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129
           YPV  NGEPD S  A FT E+K+KYA+ALKDKGN+ F++++Y++AIK+Y+ AL+LKEDPV
Sbjct: 74  YPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV 133

Query: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189
           FYSN SACYV +  L+KVVE +T AL+LKPDYSK LLRRA+ANE LGN+ADAM DLS +S
Sbjct: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLS 193

Query: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSG--------------------GEKHELPS 229
           L G ++  +IEP+LERN+NKQAM  LK+K                        ++  LPS
Sbjct: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLPS 253

Query: 230 NTSLASFFRIFPSETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFT 289
            TS+ASFF IF  E +  N DE++EAD+ L+ GL  L+ R   SY+ ADE+FT AV+ F 
Sbjct: 254 VTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKLFE 313

Query: 290 AAHEANPDNAALKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIM 349
              + + ++  +K+KLAI+LEH GI KFLKN+PL AH  + KAIDLFPR NSYIYM LIM
Sbjct: 314 DQLDKDNEDEKVKEKLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALIM 373

Query: 350 ADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYP 409
           AD+  + EY   F+KAL+LD  +S+ YYHR QMNF++Q +DQAGKDFDKAKE DP  ++P
Sbjct: 374 ADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433

Query: 410 YIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARK 469
           YIQLACLAYRE KFDDCETLFSEA+R+FP APEVPNF+AEIL+DK DF+ ALK+YD A +
Sbjct: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493

Query: 470 LEDAQEGIHVGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKL 529
           LE+  EGI+VG+APLVGKA LL R P+  NF EAT L E A + DPRSEQAKIGLAQ+KL
Sbjct: 494 LENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKL 553

Query: 530 QQEEVDEAIKLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRA 589
           QQE++DEAI LFE +ADL+R  EEKLQA TFAEAAK+Q+RIR+DPV++ KIQETL   R 
Sbjct: 554 QQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKLRE 613

Query: 590 QGMV 593
           QG++
Sbjct: 614 QGLM 617

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/523 (63%), Positives = 410/523 (78%), Gaps = 1/523 (0%)

Query: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129
           YPV  NGEP+L     FTEE+KEKY++ALKDKGN  FK  ++EEAIK+Y+ A++LKE+P+
Sbjct: 86  YPVRDNGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWAIELKENPI 145

Query: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189
           FYSN SACYV LNKLE++++    AL+LKPDYSK LLRRA ANE L NYADAM DLS +S
Sbjct: 146 FYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYADAMFDLSVLS 205

Query: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPSNTSLASFFRIFPSETSLENY 249
           L G Y+  +IEP+LERN+NKQAM VLK KL   +  +LPS+TSL++FF IF  E S ENY
Sbjct: 206 LNGDYNGASIEPILERNLNKQAMSVLKDKLKNSKDDQLPSDTSLSAFFGIFKPELSFENY 265

Query: 250 DETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAIAL 309
           DET++AD+ LL GL  L  RQ+ SY IAD++F +A+E +    E  PD+  LK K +IA 
Sbjct: 266 DETNDADKELLNGLTHLFKRQSESYLIADKSFMNALELYIKQLEETPDDTDLKVKASIAY 325

Query: 310 EHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALELD 369
           E+ GI  FLKN+   A   + K+I L PR NSYIY  LI+ADKG++ +Y   F+KAL+LD
Sbjct: 326 EYAGIFNFLKNDLSGATENIDKSIKLNPRINSYIYRALIIADKGESQDYLDYFDKALKLD 385

Query: 370 PKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETL 429
            KS A YYHRAQ+NFV Q F +A  DF+KAKECDP+ ++PYIQLACL YRE KFDDCETL
Sbjct: 386 DKSCAVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNIFPYIQLACLTYRENKFDDCETL 445

Query: 430 FSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDA-QEGIHVGVAPLVGKA 488
           FSEA+R+FPT PEVPNFYAE+L+DKGDF+NA+K Y+ AR+LE+A ++GIHVGVAPL+GKA
Sbjct: 446 FSEAKRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETARRLEEASKDGIHVGVAPLIGKA 505

Query: 489 ALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLS 548
            LLAR+P+  N A A KL E A   DPRSEQAKIGLAQLKLQ+EE+DE+I+LFE +ADL+
Sbjct: 506 TLLAREPTLENLAAADKLLEEANRIDPRSEQAKIGLAQLKLQKEEIDESIRLFEESADLA 565

Query: 549 RAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQG 591
           R  EEKLQATTFAEAAK+QK IRADP++S KI+ETL AYRAQ 
Sbjct: 566 RTMEEKLQATTFAEAAKVQKMIRADPIISKKIEETLAAYRAQN 608

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/544 (60%), Positives = 416/544 (76%), Gaps = 20/544 (3%)

Query: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129
           YPV  NGEPD S  A FT E+K+KYA+ALKDKGN+ F++++Y++AIK+Y+ AL+LKEDPV
Sbjct: 74  YPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV 133

Query: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189
           FYSN SACYV +  L+KVVE +T AL++KPDYSK LLRRA+ANE LGN+ADAM DLS +S
Sbjct: 134 FYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVLS 193

Query: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSG--------------------GEKHELPS 229
           L G ++  +IEP+LERN+NKQAM  LK+K                        ++  LPS
Sbjct: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENLPS 253

Query: 230 NTSLASFFRIFPSETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFT 289
            TS+ASFF IF  E +  NYDE ++AD+ L+ GL  L+ R   SY+ ADE+FT A + F 
Sbjct: 254 ITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKLFE 313

Query: 290 AAHEANPDNAALKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIM 349
              + + ++  LK+KLAI+LEH GI KFLKN+PL AH  ++KAI+LFPR NSYIYM LIM
Sbjct: 314 EQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIM 373

Query: 350 ADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYP 409
           AD+  + EY   F+KAL+L+P +S+ YYHR QMNF++Q +DQAGKDFDKAKE DP  ++P
Sbjct: 374 ADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433

Query: 410 YIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARK 469
           YIQLACLAYRE KFDDCETLFSEA+R+FP APEVPNF+AEIL+DK DF+ ALK+YD A +
Sbjct: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493

Query: 470 LEDAQEGIHVGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKL 529
           LE+  + I+VG+APLVGKA LL R P+  NF EAT L E A + DPRSEQAKIGLAQ+KL
Sbjct: 494 LENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQMKL 553

Query: 530 QQEEVDEAIKLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRA 589
           QQE++DEAI LFE +ADL+R  EEKLQA TFAEAAK+Q++IR+DP+++AKIQETL   R 
Sbjct: 554 QQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAKLRE 613

Query: 590 QGMV 593
           QG++
Sbjct: 614 QGLM 617

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/521 (62%), Positives = 391/521 (75%), Gaps = 1/521 (0%)

Query: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129
           YP+D NGEP L  +    ++ KE++A ALK+KGN  FK + +E AIK+Y  AL LKEDPV
Sbjct: 70  YPIDANGEPVLGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSLKEDPV 129

Query: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189
           +YSN SACY  L   EKV+E  T AL L+PDYSK L+RRA A E LGN+ DAM DLS  S
Sbjct: 130 YYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAMFDLSVCS 189

Query: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLS-GGEKHELPSNTSLASFFRIFPSETSLEN 248
           L    S  +IEP+LERN+N+QAM VL  KL    +K +LPSNT+L SFF IF  E S  N
Sbjct: 190 LNTDMSDASIEPILERNLNQQAMFVLNTKLGVTDKKSQLPSNTALTSFFGIFKPELSFAN 249

Query: 249 YDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAIA 308
           YD+T E D+ LL GL  L+   A  YE AD +FT A E F       PD+  +K+K AIA
Sbjct: 250 YDDTCEGDKELLNGLKNLYRCTAEGYETADLSFTKATEYFLKQLSETPDDETVKEKTAIA 309

Query: 309 LEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALEL 368
           LEH GI KFLKN PLEAH  ++KA++L PR NSYIYM LI+ADKG  D Y  N+EKA++L
Sbjct: 310 LEHQGIFKFLKNNPLEAHEDIKKALELHPRINSYIYMALILADKGDTDNYFANYEKAMKL 369

Query: 369 DPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCET 428
           D K++A YYHR QM F+ QQ+++AG+DFDKAKE DP  ++PYIQLACL+YRE KFDDCET
Sbjct: 370 DDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYRENKFDDCET 429

Query: 429 LFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGKA 488
           LFSEARR+FP + EVPNFYAEIL+DKGDF+ ALKEY+ A +LE  Q+ +HVG+APLVGKA
Sbjct: 430 LFSEARRKFPNSSEVPNFYAEILADKGDFDAALKEYERAIELEKKQDAVHVGIAPLVGKA 489

Query: 489 ALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLS 548
            LL R P+  NF EAT L E A ++DPRSEQAKI L QLKLQQE++DEAI+LFE+AA L+
Sbjct: 490 TLLVRTPTVENFVEATSLLEEAVKEDPRSEQAKISLGQLKLQQEDIDEAIELFESAATLA 549

Query: 549 RAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRA 589
           R FEEKLQATTFAEAAKIQKRIRADP MSAKIQET+ A RA
Sbjct: 550 RTFEEKLQATTFAEAAKIQKRIRADPKMSAKIQETIAALRA 590

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/522 (59%), Positives = 402/522 (77%), Gaps = 1/522 (0%)

Query: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129
           Y VD NGEP+LS + + TEE K ++AMALKDKGNE FK  ++E+AIK+Y  ALKLK+DP+
Sbjct: 85  YLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPI 144

Query: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189
           +YSN SACY  L + EKV+E  T ALKL+P +SK L+RRA A E++GN+ DAM D+SA S
Sbjct: 145 YYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACS 204

Query: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPSNTSLASFFRIFPSETSLENY 249
           L G  +  +IEP+LER +NKQA  VLK+K+S  ++  LPS+T LASFFR+F  ETS  NY
Sbjct: 205 LNGDMNDASIEPILERILNKQAEFVLKEKISANKEQNLPSSTPLASFFRVFKPETSFANY 264

Query: 250 DETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAIAL 309
           +E++EADR L+ GL  L+      ++IAD++F  A E F      N DN A+K+K AIAL
Sbjct: 265 EESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTAIAL 324

Query: 310 EHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALELD 369
           E+ GIL ++KNE L+AH+ ++ AI+L PR NSYIY  LI +D     EY QNF+KALEL+
Sbjct: 325 EYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKALELE 384

Query: 370 PKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETL 429
           P + A YYHR Q  F+ QQ+++AGKDFDK KE D + ++ YIQLACLAYRE KFDDCETL
Sbjct: 385 PNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETL 444

Query: 430 FSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLE-DAQEGIHVGVAPLVGKA 488
           FSEARR+FPTAPEVPNF+AE+L+D+G+ E A+KE+D A +LE    E IHVG+APL+GKA
Sbjct: 445 FSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIGKA 504

Query: 489 ALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLS 548
            LL  +P+  NF E  +L + AC+KDPRSEQA++GLAQLKLQQE++DEAI+LFE AA+L+
Sbjct: 505 TLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAELA 564

Query: 549 RAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQ 590
           +++EEKLQATTFAEAAKIQKRIRADP M AKI++T++  R+Q
Sbjct: 565 KSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/526 (57%), Positives = 396/526 (75%), Gaps = 2/526 (0%)

Query: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129
           +P  +NGEPD +G+   T +QK+K+A+ LKDKGNE FK++ YE A+KFYD AL LK+DPV
Sbjct: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142

Query: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189
           FYSN SACYV LN+L+KV+E +T AL+LKPDYSK LLRRATANE L NY+DAM DLS +S
Sbjct: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202

Query: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHE--LPSNTSLASFFRIFPSETSLE 247
           L   ++  TIEP+LERN+NKQA++VL QK     K+E  LPSNTS+ASFF IF  E S +
Sbjct: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFD 262

Query: 248 NYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAI 307
           +YDE S+AD+ LL GL  L++ + G YEIA+ +F  ++E +    E+  D   + +K AI
Sbjct: 263 SYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAI 322

Query: 308 ALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALE 367
           ALE+VGI  FL+N+ + A +L  ++I   PR NSYIY+ LI ADK + DE  + F++AL+
Sbjct: 323 ALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALK 382

Query: 368 LDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCE 427
           LDP  S  YYHR Q+NFV Q +  A  DF KAKE D + ++PYIQLACL+YRE  F+DC+
Sbjct: 383 LDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQ 442

Query: 428 TLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGK 487
             F  AR++FP APE+P F  EIL+DKGD + A K+Y+F  +LE+ Q+ IHVG+APL+GK
Sbjct: 443 NQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGK 502

Query: 488 AALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADL 547
           A  LARQP+  NF+EA+KL + A EKDPRSEQA +GLAQLKLQ+E+VD AI+LFE A+D 
Sbjct: 503 ATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDY 562

Query: 548 SRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593
           SR+ +EKLQATTFAEAAK+QKRIRADPV+ AK++ETL  Y AQG +
Sbjct: 563 SRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/534 (58%), Positives = 392/534 (73%), Gaps = 10/534 (1%)

Query: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129
           YP+  +GEPDLS + ++T EQ+E YA+ALKDKGNE FK++  EEAIK+Y  AL+ K+DPV
Sbjct: 81  YPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPV 140

Query: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189
           FY+N SACYV LN  EKV+E+   AL+LKPDYSK LLRRA   E++ N+ADAM DLS +S
Sbjct: 141 FYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVLS 200

Query: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGE---KHELPSNTSLASFFRIFPSETSL 246
           L   +S  +IEP+LERN+NKQAM++LK++L   +   +  LPS+TS+ASFF IF  ET  
Sbjct: 201 LNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPETEF 260

Query: 247 ENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAV----EKFTAAHEANPDNAALK 302
           + YDET EADR L  GL  L A     +  AD  F +AV    E F+ A +       L 
Sbjct: 261 KGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQNLN 320

Query: 303 QKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNF 362
           +K AIALE+ GI KFLKN+ + A   + +AI LFPR NSYIY+ L  AD G++ EY  NF
Sbjct: 321 EKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVTNF 380

Query: 363 EKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKK 422
           +KALEL+P SSA YYHR Q+ F+ Q + +A  DF KAKE D   ++ YIQLACL YRE  
Sbjct: 381 DKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGD 440

Query: 423 FDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLED---AQEGIHV 479
            D+C+ LF EAR +FP APEVP FYAEIL+DKGDF +A K+YD A++LE+   A+ GI V
Sbjct: 441 MDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRV 500

Query: 480 GVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIK 539
           GVAPLVGKA +LARQPS  NFAEAT LFE AC++DPRSEQAK+GLAQL LQQE+VD AIK
Sbjct: 501 GVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIK 560

Query: 540 LFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593
           +FE AADL+R  +EKLQA TFAEAAK+QK+IRADP++ AK++E L  YRAQGM+
Sbjct: 561 MFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI 614

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/531 (57%), Positives = 401/531 (75%), Gaps = 14/531 (2%)

Query: 75  NGE---PDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPVFY 131
           NG+   PD++ M   +E+QK+ YA ALKDKGN  FK++R+E+AI+FY+ A+KL EDPVF+
Sbjct: 70  NGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFH 129

Query: 132 SNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVSLY 191
           SN SACYV L  L+KVVE +T AL+LKPDYSK LLRRA+A E++G Y DAM D+S +SL 
Sbjct: 130 SNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLN 189

Query: 192 GGYSSQTIEPVLERNMNKQAMQVLKQKLS----------GGEKHELPSNTSLASFFRIFP 241
           G ++  +IEP+LERN+NKQA++VLK+ +             E+ ELPSNTSL+SFF IF 
Sbjct: 190 GDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFK 249

Query: 242 SETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAAL 301
            ET +  YDE++EAD  L++GL AL+   +  Y++ADE F  A  K      AN ++AA 
Sbjct: 250 PETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAA-KLYREQLANNNDAAF 308

Query: 302 KQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQN 361
           K+K A ALE++GI  FLKN+   +   L++A+ L PR N+YIY+ L MAD+GQ+++Y   
Sbjct: 309 KEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSY 368

Query: 362 FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREK 421
           FEKA+ LDP ++A YYHR QM F+ Q +++AG+DF K+KE DP  ++PYIQLACLAYRE 
Sbjct: 369 FEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYREN 428

Query: 422 KFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGV 481
           K  +CE LF EAR+ FPTAPEVPNFYAEIL+DKGD + A+K+Y+ A +LE  Q+ IHVG+
Sbjct: 429 KMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGI 488

Query: 482 APLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLF 541
           APLVGKA +LARQP+  NFA  ++L E AC+ DPRSEQAK+GLAQL+LQQE+VDEAI+LF
Sbjct: 489 APLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELF 548

Query: 542 EAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGM 592
           E AA ++R  +EKLQA TFAEA K+QKRIRADPV+S K++ETL AY+AQ M
Sbjct: 549 EEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNM 599

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/529 (56%), Positives = 386/529 (72%), Gaps = 5/529 (0%)

Query: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129
           YP + + +PD+  + +   E+++K +M LKDKGN+ FK + Y  AIK+Y+ AL L +DP+
Sbjct: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI 156

Query: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189
           FYSN SACYV L +L+KV+E +T AL+L P+YSK LLRRA+ANESL NY+DA+ DLS +S
Sbjct: 157 FYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLS 216

Query: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKL-----SGGEKHELPSNTSLASFFRIFPSET 244
           L G YS  +IEP+LERN+NKQA++VL +++     S  E+  LPS TSL SFF IF  E 
Sbjct: 217 LNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPEL 276

Query: 245 SLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQK 304
           + +NY+E  +AD  LL GL  L  R    Y  AD+ F  A   F      NP +  L +K
Sbjct: 277 TFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEK 336

Query: 305 LAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEK 364
            AIALE+ GI +FLKN+ L A   ++KAI  FPR NSY+Y+ LI ADK  + EY++ F+K
Sbjct: 337 TAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDK 396

Query: 365 ALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFD 424
           ALEL+P S + YYHR Q+ F+ Q + +A  +F+KAKE D + ++PYIQLACLAYRE  FD
Sbjct: 397 ALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFD 456

Query: 425 DCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPL 484
            C+ LF E R++FPT PEVP FYAEIL+DKGDF  A+K+YD A +LE AQ+ IHVG+APL
Sbjct: 457 RCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPL 516

Query: 485 VGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAA 544
           VGKA +LARQP+  N  EAT+L E ACE DPRSEQA +GLAQLKLQ EEVD AI+LFE A
Sbjct: 517 VGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKA 576

Query: 545 ADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593
           ADLSR  +EK+QA TFAEAAKIQKRIRADPV+SAK+ E L +YR+QG++
Sbjct: 577 ADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/518 (55%), Positives = 371/518 (71%), Gaps = 1/518 (0%)

Query: 75  NGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNR 134
           N EPD+  M      +K +YA  LK +GN  FK + YE AI +Y  AL+LK DPVFYSN 
Sbjct: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNM 125

Query: 135 SACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVSLYGGY 194
           +ACY+ L   ++ +E  + AL+L PDYSK LL+RA   E++G +ADA+LDL+AVSL G Y
Sbjct: 126 AACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDY 185

Query: 195 SSQTIEPVLERNMNKQAMQVLKQKLSGGEKHE-LPSNTSLASFFRIFPSETSLENYDETS 253
           +  TI+P++ER +NKQAM  LK  L   EK++ LPS TS+A+FF +F +ET +  +D T 
Sbjct: 186 NDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATE 245

Query: 254 EADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAIALEHVG 313
           E+D+IL   L  L+++    Y+  D  FT A E + A  E +  N+   +K AIA EH  
Sbjct: 246 ESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTA 305

Query: 314 ILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALELDPKSS 373
           IL FLKN+PL A  L+ +AI L PRP SYIY+GL+MADKG  +EY  NF+KA++LDP  +
Sbjct: 306 ILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMA 365

Query: 374 AAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEA 433
           A YYHR QMNF+IQ++++AG+DFDKAKECDP+ ++PYIQLAC++YRE  FDDCETLFSEA
Sbjct: 366 AIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEA 425

Query: 434 RRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAALLAR 493
           RR+FP APEVPNF+AEILSDKG+ E A  EYD A +LE   E IHVG+APLVGKA  L +
Sbjct: 426 RRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLK 485

Query: 494 QPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLSRAFEE 553
            P+  NF EA  LFE A  +DPRSE+AK+GLAQ KLQQE++D+AI+LFE AA L R  +E
Sbjct: 486 YPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLDE 545

Query: 554 KLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQG 591
           KLQATTFAEA K+Q R+RAD  + AK  + LD  R  G
Sbjct: 546 KLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/538 (51%), Positives = 376/538 (69%), Gaps = 14/538 (2%)

Query: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLK-EDP 128
           YP   NGEPD++ +   +  Q++ YA+ LK++GN  F  + + EAIK+Y  A++L   +P
Sbjct: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161

Query: 129 VFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
           VFYSN SACY+    LEKV+E TT AL++KPD+SK LLRRA+ANESLGN+ DAM DLS +
Sbjct: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221

Query: 189 SLYGGYSSQTIEPVLERNMNKQAMQVLKQKLS---GGEKHELPSNTSLASFFRIFPSETS 245
           SL G +   +IEP+LERN+NKQAM+VL + LS   G     LPSNTSLASFF IF S   
Sbjct: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLE 281

Query: 246 LENYDETSEADR---ILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALK 302
           + + + +S  D    +L   L  L++     Y +A++  T + + + +   AN  +  L+
Sbjct: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341

Query: 303 QKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNF 362
           +  A+AL + GI  FLKN  L+A  LLQ++I+L P PNSYI++ L +ADK  + E+ + F
Sbjct: 342 ENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFF 401

Query: 363 EKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKK 422
           +KA++L+P+    YYHR QM F++Q +  A +DF KA+  +P  VYPYIQLACL Y++ K
Sbjct: 402 QKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461

Query: 423 FDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVA 482
           F + E  F+E + +FPT PEVP F+AEIL+D+GDF+ A+K+YD A++LE+ QE IHVG+ 
Sbjct: 462 FTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521

Query: 483 PLVGKAALLARQPSAS-------NFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVD 535
           PL+GKA +LARQ S          F  A KL   ACE DPRSEQAKIGLAQLKLQ E++D
Sbjct: 522 PLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKID 581

Query: 536 EAIKLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593
           EAI+LFE +A L+R  +EKLQATTFAEAAKIQKR+RADP++SAK++ TL  YRA+GM+
Sbjct: 582 EAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/539 (50%), Positives = 378/539 (70%), Gaps = 15/539 (2%)

Query: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLK-EDP 128
           YP+  +GEPD++ +      Q+++YA+ LKDKGN  F  + +++AIK+Y  A++L   DP
Sbjct: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159

Query: 129 VFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
           VFYSN SACY+    L KVVE TT AL++KPD+SK LLRRA+ANESLGN+ DAM DLS +
Sbjct: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219

Query: 189 SLYGGYSSQTIEPVLERNMNKQAMQVLKQKLS--GGEKHE--LPSNTSLASFFRIFPSET 244
           SL G +   +IEP+LERN+NKQAM+VL   LS   G++    LPSNTSLASFF IF  + 
Sbjct: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279

Query: 245 SLENYDETSEADR---ILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAAL 301
            +      S  D    +LL+ L  L++  +  Y IA+  FT A + + +   A+  + A+
Sbjct: 280 EISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAI 339

Query: 302 KQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQN 361
           +   A+A  + GI +FLKN+ L+A  LLQ++I+L P PNSYI+M L +ADK  + E+   
Sbjct: 340 RGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSF 399

Query: 362 FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREK 421
           F+KA++LDP+ S  YYHR QM F++Q +  A  DF KA+  +P  +YPYIQLACL Y++ 
Sbjct: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459

Query: 422 KFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGV 481
           KF + E LF+E + +FPT PEVP F+AEIL+DKGD+  A+K+YD A++L++ Q  IHVG+
Sbjct: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGI 519

Query: 482 APLVGKAALLARQPSAS-------NFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEV 534
            PL+GKA +LARQ +          F  A +L   AC+ DPRSEQAKIGLAQLKLQ E++
Sbjct: 520 GPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKI 579

Query: 535 DEAIKLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593
           D+AI+LF+ +A L+R  +EKLQATTFAEAAKIQKR+RADP++SAK+++TL +YRA GM+
Sbjct: 580 DDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/539 (51%), Positives = 379/539 (70%), Gaps = 15/539 (2%)

Query: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLK-EDP 128
           YP+  +GEPD+  +   +  Q++ +A+ LKDKGN  F  + + +AIK+Y  A++L   DP
Sbjct: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165

Query: 129 VFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
           VFYSN SACY+    L+KVVE TT AL++KPD+SK LLRRA+ANESLGN+ DAM DLS +
Sbjct: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225

Query: 189 SLYGGYSSQTIEPVLERNMNKQAMQVLKQKL--SGGEKHE--LPSNTSLASFFRIFPSET 244
           SL G +   +IEP+LERN+NKQAM+VL + L  +G +K    LPSNTSLASFF IF  + 
Sbjct: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDL 285

Query: 245 SLENYDETS---EADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAAL 301
                +  S    A   L + L +L++  +  Y IAD+  T A +++ +   AN ++  +
Sbjct: 286 ETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVI 345

Query: 302 KQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQN 361
           ++  A+A  + GI +FLKN+ L+A  LLQ++I+L P PNSY++M L +ADK  + E+ + 
Sbjct: 346 RENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKF 405

Query: 362 FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREK 421
           F+ A++LDP+    YYHR QM F++Q +  A  DF KA+  +P  VYPYIQLACL Y++ 
Sbjct: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465

Query: 422 KFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGV 481
           KF + E+LF+EA+ +FP  PEVP FYAEIL+DKGDF  A+K+YD A++LE+ Q+ IHVG+
Sbjct: 466 KFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGI 525

Query: 482 APLVGKAALLARQPSAS-------NFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEV 534
            PL+GKA +LARQ S          F  A +L   ACE DPRSEQAKIGLAQL+LQ E++
Sbjct: 526 GPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKI 585

Query: 535 DEAIKLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593
           D AIKLF+ +A L+R  +EKLQATTFAEAAKIQKR+RADP++SAK+++TL  YRAQGM+
Sbjct: 586 DVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/533 (51%), Positives = 367/533 (68%), Gaps = 15/533 (2%)

Query: 75  NGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSN 133
           NGEPD+S +   T  QK+ YA+ LK+KGN  F  + + EAIK+Y CA++L   DPVFYSN
Sbjct: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163

Query: 134 RSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVSLYGG 193
            SACY+    L KV+E TT AL++KPD+SK LLRRA+ANESLGN+ DAM DLS +SL G 
Sbjct: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223

Query: 194 YSSQTIEPVLERNMNKQAMQVLKQKLSGGE---KHELPSNTSLASFFRIFPSETSLENYD 250
           +   +IEP+LERN+NKQAM+VL + LS G+      LPSNTSL SFF IF  +  +   +
Sbjct: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVN 283

Query: 251 ETSEADR---ILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAI 307
            +S  D    +L   L  L++     Y  AD+ FT A + + +   +  D   LK+  A+
Sbjct: 284 NSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVD-GPLKENAAL 342

Query: 308 ALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALE 367
           A  + GI  FLKN  L A  LLQ++I+L P PNSYI++ L +ADK  + E+ + F+KA++
Sbjct: 343 AFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAID 402

Query: 368 LDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCE 427
           LD +    YYHR QM F++Q +  A  DF KA+   P  +YPYIQLACL Y++ KF + E
Sbjct: 403 LDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESE 462

Query: 428 TLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGK 487
            LF+E + +FPT PEVP F+AEIL+DKGDF  A+K+YD A++LE+ QE IHVG+ PL+GK
Sbjct: 463 ALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGK 522

Query: 488 AALLARQPSAS-------NFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKL 540
           A +LARQ S          F  A  L   ACE DPRSEQAKIGLAQLKLQ E++D+AI+L
Sbjct: 523 ATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIEL 582

Query: 541 FEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593
           F+ +A L+R  +EKLQATTFAEAAKIQKR+RADP++SAK++ TL +YRA+GM+
Sbjct: 583 FQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/535 (52%), Positives = 374/535 (69%), Gaps = 11/535 (2%)

Query: 70  YPVDQNGEPD---LSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKE 126
           YP+D   +PD   ++ +    E  K K+A  LK+KGN+ FK +  E AIK+Y+ AL+L +
Sbjct: 130 YPLDSQNDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRLDQ 189

Query: 127 DPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLS 186
           DPVFYSN SACY  +N+L+KV+E +  AL+LKPDYSK LLRRA A E+LGN  +A+ D S
Sbjct: 190 DPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYDFS 249

Query: 187 AVSLYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHE--LPSNTSLASFFRIFPSET 244
            +SL+G YS Q +EP+L R ++K +  VL+ KL   +     L S+++L SFF IFP ET
Sbjct: 250 ILSLFGEYSGQYLEPLLNRILDKVSTDVLRAKLDNKKTDNFILLSDSALVSFFGIFPPET 309

Query: 245 SLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFT---AAHEANPDNAAL 301
           ++ NY+   EAD+ L++GL AL  + +  +  AD+ F  A E F     + E N +N+ L
Sbjct: 310 TITNYNPDDEADKELVQGLEALAKKTSEGFLDADKHFIKANELFMEKLLSSEDNDENSGL 369

Query: 302 KQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQAD---EY 358
            +K+AIALE+ G+ KFLK + L +   LQKAIDL+PRPNSYIYM +++ADK       +Y
Sbjct: 370 LEKVAIALEYSGVFKFLKFDLLGSETDLQKAIDLYPRPNSYIYMAMLVADKNNDKNDLDY 429

Query: 359 AQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAY 418
            + F+KA  L+P  +  YYHR Q+  V Q+FD+A   F KAKE D S VYPYIQLAC+AY
Sbjct: 430 FKYFDKATTLNPNFAPTYYHRGQLLLVNQKFDEAETFFLKAKELDDSNVYPYIQLACVAY 489

Query: 419 REKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIH 478
               F  C+ LF EAR +FPT PEVP FYAEIL+DKG+ E A+K+YD A +LE A + IH
Sbjct: 490 YNSTFKKCQELFDEARTKFPTLPEVPTFYAEILADKGELEAAMKQYDIAYRLETAYKYIH 549

Query: 479 VGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAI 538
           VG+APL+GKAA LAR P+  NF   T+L E ACE DPRSEQAKI LAQLKLQ E++D AI
Sbjct: 550 VGIAPLIGKAAALARIPTQENFDTMTELLEKACELDPRSEQAKISLAQLKLQTEDIDTAI 609

Query: 539 KLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593
            LFE  ADL+R +++KLQATTFAEAAKIQKRI+ +P+ +AKI+ETL  YRA G++
Sbjct: 610 ALFEETADLARTYQDKLQATTFAEAAKIQKRIKENPIYAAKIEETLATYRADGII 664

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 59/108 (54%), Gaps = 7/108 (6%)

Query: 76  GEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNR 134
           GEP ++       E+ +K A ALK +GN     + YE AI+ Y  A++ L  D V+Y+NR
Sbjct: 77  GEPKVAA------EELKKEAEALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANR 130

Query: 135 SACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAM 182
           +A Y  L + EK VED   A K+   YSK   R   A  +LG + +A+
Sbjct: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEAL 178

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTTAALK 156
           K +GN  F  + YE+AI  +  A+++ E P  VFYSNRSACY  L K  + + D    +K
Sbjct: 8   KQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVK 67

Query: 157 LKPDYSKCLLRRATANESLGNYADA 181
           + P +SK   R   A+  LG+  +A
Sbjct: 68  INPTWSKGYNRLGAAHLGLGDLDEA 92

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 1/87 (1%)

Query: 102 GNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160
           G + F    +  A+K Y   +K   ED   YSNR+A    L    + +ED   A++  P+
Sbjct: 397 GKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDPN 456

Query: 161 YSKCLLRRATANESLGNYADAMLDLSA 187
           + +  +R+ATA  ++  +A A+  L A
Sbjct: 457 FIRAYIRKATAQIAVKEFAAAIETLDA 483

 Score = 37.7 bits (86), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 24/36 (66%)

Query: 102 GNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSAC 137
           GN+ +K ++++EAI  YD A  L +D  + +NRSA 
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWNLHQDITYLNNRSAA 298

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 50/85 (58%), Gaps = 2/85 (2%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTTAALK 156
           K +GN  F  + +E+AI+ +  A+++ E P  V YSNRSACY  + K  + + D    ++
Sbjct: 8   KKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVR 67

Query: 157 LKPDYSKCLLRRATANESLGNYADA 181
           +KPD+SK   R   A+  LG+  +A
Sbjct: 68  IKPDWSKGHNRLGAAHYGLGDLDEA 92

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 57/116 (49%), Gaps = 10/116 (8%)

Query: 80  LSGMATFTEEQKEKYAMALKD---------KGNECFKDQRYEEAIKFYDCALK-LKEDPV 129
           L+ + +  +EQK++ A A  D         +G E F +  +  A+K Y   +K   ED  
Sbjct: 364 LNKLRSLEKEQKKREAEAYIDPEKAEEARLQGKEYFTNADWPNAVKAYTEMIKRAPEDAR 423

Query: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDL 185
            YSNR+A    L      ++D   A++  P++ +  +R+ATA  ++  YA A+  L
Sbjct: 424 GYSNRAAALAKLMSFPDAIKDCDMAIQKDPNFVRAYIRKATAQIAVQEYAAAIETL 479

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 47/94 (50%), Gaps = 13/94 (13%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSACYV-------PLNKLEKVVEDT 151
           K KGNE +K ++++EAI  Y+ A  L +D  + +NR+A           +  LEK VE+ 
Sbjct: 258 KAKGNELYKKRQFDEAIANYEKAWDLHKDITYLNNRAAAEYEKGDYESAIKTLEKAVEE- 316

Query: 152 TAALKLKPDY---SKCLLRRATANESLGNYADAM 182
               +L+ DY   +K   R   A+  L +   A+
Sbjct: 317 --GRELRADYKVIAKSFARLGNAHYKLADLKKAI 348

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 1/106 (0%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAA 154
           A ALK +GNE   + +YEEAIK Y  A++  ++  +YSNRS  Y  L + E  V D T A
Sbjct: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141

Query: 155 LKLKPDYSKCLLRRATANESLGNYADAMLDLS-AVSLYGGYSSQTI 199
           + + P +SK   R   A        D M     A+ L G  +S+T+
Sbjct: 142 INIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNASKTL 187

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTTAALK 156
           K +GN  F  + Y +AI  +  A+++ E P  V YSNRSACY  L K    + D T  +K
Sbjct: 9   KQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVK 68

Query: 157 LKPDYSKCLLRRATANESLGNYADA 181
           + P +SK   R   A+  LG+  DA
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDDA 93

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 1/88 (1%)

Query: 102 GNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160
           G E F    +  A+K Y   +K   ED   YSNR+A    L    + + D   A++  P+
Sbjct: 400 GKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 459

Query: 161 YSKCLLRRATANESLGNYADAMLDLSAV 188
           + +  +R+ATA  ++  +A A+  L A 
Sbjct: 460 FVRAYIRKATAQIAVQEFAGALETLDAA 487

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 7/86 (8%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAAL--- 155
           K +GN+ +K +++EEAI+ Y+ A +L  D  + +NR+A        E  +   T A+   
Sbjct: 263 KAEGNKFYKARQFEEAIEHYNKAWELHRDITYLNNRAAAEYEKGDYETAIATLTDAVEQG 322

Query: 156 -KLKPDY---SKCLLRRATANESLGN 177
            +++ DY   SK   R   A   LG+
Sbjct: 323 REMRADYKVISKSFARIGNAYHKLGD 348

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (54%), Gaps = 2/86 (2%)

Query: 98  LKDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTTAAL 155
            K +GN  F  + +E+A + +  A++  E P  V YSNRSACY  L K ++ +ED    +
Sbjct: 6   FKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECV 65

Query: 156 KLKPDYSKCLLRRATANESLGNYADA 181
           K+ P +SK   R   A   LGN  DA
Sbjct: 66  KINPTWSKGYNRVGAAQYGLGNLDDA 91

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 1/89 (1%)

Query: 101 KGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKP 159
           +G E F    +  A+  Y   +K   ED   YSNR+A    L      ++D   A+   P
Sbjct: 407 QGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDP 466

Query: 160 DYSKCLLRRATANESLGNYADAMLDLSAV 188
           ++ +  +R+A+A  ++  +A AM  L A 
Sbjct: 467 NFVRAYIRKASAQIAVREFAPAMETLDAA 495

 Score = 37.7 bits (86), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 54/102 (52%), Gaps = 9/102 (8%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAA 154
           A A K +GN+ +K ++++EAI+ Y+ A  L  D  + +NRSA        E+ ++  T A
Sbjct: 267 ADAEKAEGNKYYKARKFDEAIEHYNKAWDLHRDVTYLNNRSAAEYEKGDYEQAIKTLTEA 326

Query: 155 L----KLKPDYSKCLLRRATANESLGNYADAMLDL-SAVSLY 191
           +    +++ DY   L+ ++ A   +GN    M DL  A+  Y
Sbjct: 327 VDQGREMRADYK--LISKSFAR--IGNAYLKMDDLKKAIEFY 364

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (54%), Gaps = 2/86 (2%)

Query: 98  LKDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTTAAL 155
           LK KGN  F  + +  AI+++  A+     P  V YSNRSACY  L + ++ + D    +
Sbjct: 7   LKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCV 66

Query: 156 KLKPDYSKCLLRRATANESLGNYADA 181
           K+ PD+SK   R   A+  LG+  DA
Sbjct: 67  KINPDWSKGYNRMGAAHLGLGDLDDA 92

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 1/85 (1%)

Query: 102 GNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160
           G E F    +  A+K Y   +K   ED   YSNR+A    L    + ++D   A++  P+
Sbjct: 397 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPN 456

Query: 161 YSKCLLRRATANESLGNYADAMLDL 185
           + +  LR+ATA  ++ ++  A+  L
Sbjct: 457 FVRAYLRKATAQIAIKDFVKALETL 481

 Score = 34.3 bits (77), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 54/121 (44%), Gaps = 16/121 (13%)

Query: 269 RQAGSYEIADEAFTDAVEKFTAAHEAN--PDNAALKQKLAIALEHVGILKFLKNEPLEAH 326
           +Q G+   A + FT A+E FT A  A+  P++     + A    +  + +F      EA 
Sbjct: 8   KQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSAC---YTSLKQFQ-----EAL 59

Query: 327 NLLQKAIDLFP-RPNSYIYMGLIMADKGQADEYAQNFEKALELDPKSSAA-----YYHRA 380
           N  Q+ + + P     Y  MG      G  D+   N++KALELD  + AA       HR 
Sbjct: 60  NDAQQCVKINPDWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSNNKAASEGLEQVHRV 119

Query: 381 Q 381
           Q
Sbjct: 120 Q 120

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 10/67 (14%)

Query: 102 GNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSAC-------YVPLNKLEKVVEDTTAA 154
           GN+ +K  +++EAI  Y+ A  L +D  + +NRSA           +N L + VE     
Sbjct: 263 GNKLYKSHKFDEAIAEYNKAWDLHKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQ---G 319

Query: 155 LKLKPDY 161
            +L+ DY
Sbjct: 320 RELRADY 326

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 60.5 bits (145), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 59/114 (51%), Gaps = 10/114 (8%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTT 152
           A   KD+GN  F  + Y+EAI+ +  A+++ E P  V YSNRSACY    +  K +ED  
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDAN 64

Query: 153 AALKLKPDYSKCLLRRATANESLGN-------YADAM-LDLSAVSLYGGYSSQT 198
             +K+ P +SK   R   A+  +G+       Y  A+ LD S  + + G S  T
Sbjct: 65  ECVKINPTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDSSNKAAHDGLSQVT 118

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 49/105 (46%), Gaps = 6/105 (5%)

Query: 102 GNECFKDQRYEEAIKFY-DCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160
           G E F    +  A+K Y +   +   D   YSNR+A    L    + + D   A++  P+
Sbjct: 396 GKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKDPN 455

Query: 161 YSKCLLRRATANESLGNYADAMLDLSA-----VSLYGGYSSQTIE 200
           + +  +R+ATA  ++ ++  A+  L A       L  G +S+ I+
Sbjct: 456 FIRAYIRKATAQIAIKDFVPAIETLDAARTKDAELNNGANSREID 500

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 36/60 (60%)

Query: 78  PDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSAC 137
           P+    A+  E++ +  A A K +GN+ +K  +++EAI+ Y+ A +L  D  + +NRSA 
Sbjct: 238 PEPKEEASTPEDESKIAADAEKAEGNKLYKAHKFDEAIEHYNKAWELHNDITYLNNRSAA 297

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTTAALK 156
           K +GN  F  + Y++AI+ +  A+++ E P  V YSNRSACY  L K    + D    +K
Sbjct: 9   KQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVK 68

Query: 157 LKPDYSKCLLRRATANESLGNYADA 181
           + P +SK   R   A+  LG+  +A
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 60/136 (44%), Gaps = 14/136 (10%)

Query: 102 GNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160
           G E F    +  A+K Y   +K   ED   YSNR+A    L    + + D   A++  P+
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 161 YSKCLLRRATANESLGNYADAMLDLSA-----VSLYGGYSSQTIEPVLERNMNKQAMQVL 215
           + +  +R+ATA  ++  YA A+  L A       +  G S++ I+ +          +  
Sbjct: 463 FVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLY--------YKAS 514

Query: 216 KQKLSGGEKHELPSNT 231
           +Q+   G  +E P  T
Sbjct: 515 QQRFQPGTSNETPEET 530

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 7/86 (8%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAAL--- 155
           K +GN+ +K ++++EAI+ Y+ A +L +D  + +NR+A      + E  +     A+   
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQG 325

Query: 156 -KLKPDY---SKCLLRRATANESLGN 177
            +++ DY   SK   R   A   LG+
Sbjct: 326 REMRADYKVISKSFARIGNAYHKLGD 351

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (56%), Gaps = 1/86 (1%)

Query: 98  LKDKGNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPLNKLEKVVEDTTAALK 156
           LK +GN+ F  + +E A+K Y  A++L   + VFY NR+A Y    K E+ V D  +A++
Sbjct: 99  LKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVR 158

Query: 157 LKPDYSKCLLRRATANESLGNYADAM 182
           + P YS+   R   A  +LG   +AM
Sbjct: 159 INPSYSRGYSRLGLAKYALGKPEEAM 184

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 47/88 (53%), Gaps = 2/88 (2%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTTAALK 156
           K +GN  F  + Y+ AI+ +  A+++ E P  V +SNRSACY  L K    + D    +K
Sbjct: 9   KQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVK 68

Query: 157 LKPDYSKCLLRRATANESLGNYADAMLD 184
           + P +SK   R   A+  LG+  +A  D
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEAESD 96

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 7/86 (8%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAALK-- 156
           K +GN+ +K  +++EAI+ Y+ A +L +D  + +NR+A        E V+     A++  
Sbjct: 266 KAEGNKFYKAHQFDEAIEHYNRAWELHKDITYLNNRAAAEYEKGDYETVIATLNDAVEKG 325

Query: 157 --LKPDY---SKCLLRRATANESLGN 177
             ++ DY   SK   R   A   LG+
Sbjct: 326 RDMRADYKVISKSFARIGNAYHKLGD 351

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 1/85 (1%)

Query: 102 GNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160
           G E F    +  A+K Y   +K   ED   YSNR+A    L    + + D   A++  P+
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 161 YSKCLLRRATANESLGNYADAMLDL 185
           + +  +R A A  ++  +A A+  L
Sbjct: 463 FVRAYIRMAAAQIAVKEFAAALETL 487

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTTAALK 156
           K +GN  F  + YE+A+  +  A+++  +P  V YSNRSACY  L K    + D     K
Sbjct: 9   KQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTK 68

Query: 157 LKPDYSKCLLRRATANESLGNYADA 181
           + P +SK   R   A+  LG+  +A
Sbjct: 69  INPTWSKGYNRVGAAHYGLGDLDEA 93

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 49/94 (52%), Gaps = 7/94 (7%)

Query: 91  KEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKLEKVVED 150
           ++K A A KD+GN+ +K  +++EAI+ YD A +L  D  + +N++A        E  ++ 
Sbjct: 254 QKKLADAEKDEGNKLYKAHKFDEAIEHYDKAWELHNDITYLNNKAAAQYEKGDYETTIKT 313

Query: 151 TTAAL----KLKPDY---SKCLLRRATANESLGN 177
              A+    +L+ DY   +K   R   A E L +
Sbjct: 314 LEDAIEKGRELRADYKIIAKAFTRMGNAYEKLND 347

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 48/89 (53%), Gaps = 3/89 (3%)

Query: 101 KGNECFKDQRYEEAIKFY-DCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKP 159
           +G + F   ++ +A+K Y +   +  +D   YSNR+A    L    + + D   AL+  P
Sbjct: 398 QGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDP 457

Query: 160 DYSKCLLRRATANESLGNYADAM--LDLS 186
           ++ K  +R+ATA  ++  Y+ A+  LD++
Sbjct: 458 NFVKAYIRKATAQIAIKEYSSALETLDIA 486

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 54/96 (56%), Gaps = 1/96 (1%)

Query: 88  EEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEK 146
           +E+++  A  LK +GN+    + YE AIK Y  A++ L  + V+Y+NR+A Y  L K + 
Sbjct: 86  DEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDD 145

Query: 147 VVEDTTAALKLKPDYSKCLLRRATANESLGNYADAM 182
            V D  +A+K+ P YSK   R   A  + G   DA+
Sbjct: 146 AVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDAL 181

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTTAALK 156
           K +GN  F  ++Y+EA+  +  A+++ E P  V YSNRSA Y    K  + ++D     K
Sbjct: 9   KQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTK 68

Query: 157 LKPDYSKCLLRRATANESLGNYADA 181
           + P ++K   R   A+  +GN  DA
Sbjct: 69  INPSWAKGYTREGAAHFGMGNLDDA 93

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 60/136 (44%), Gaps = 14/136 (10%)

Query: 102 GNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160
           G E F    +  A+K Y   +K   ED   YSNR+A    L      + D   A++  P+
Sbjct: 392 GKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDPN 451

Query: 161 YSKCLLRRATANESLGNYADAMLDLSA-----VSLYGGYSSQTIEPVLERNMNKQAMQVL 215
           + +  +R+ATA  ++ +++ A+  L A       + GG +++ I+ +         M+  
Sbjct: 452 FVRAYIRKATAQIAVKDFSYAIETLDAARTKDAEVNGGANAREIDQLY--------MKAA 503

Query: 216 KQKLSGGEKHELPSNT 231
           +Q+       E P  T
Sbjct: 504 QQRFQPATGDETPEQT 519

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 54/117 (46%), Gaps = 14/117 (11%)

Query: 76  GEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRS 135
            EP+   M    +E K   A   K +GN+ +K + ++EAI  Y+ A +L  +  + +NRS
Sbjct: 233 AEPEAESMDVDQDESKVA-AEEAKVEGNKAYKARNFDEAIACYNKAWELDNNITYLNNRS 291

Query: 136 ACY-------VPLNKLEKVVEDTTAALKLKPDY---SKCLLRRATANESLGNYADAM 182
           A           +N L + +E      +++ DY   +K   R   A   +GN  +A+
Sbjct: 292 AAEFEKGEYDTAINTLNEAIE---KGREMRADYKIIAKSFARIGNAYVKMGNLKEAI 345

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCAL-KLKEDPVFYSNRSACYVPLNKLEKVVEDTTA 153
           A ALK +GN+    + YE AIK Y  A+  L  + V+++NR+A Y  L K ++ VED  +
Sbjct: 100 AEALKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANS 159

Query: 154 ALKLKPDYSKCLLRRATANESLGNYADAM 182
           A+K+ P YSK   R   A  + G   DA+
Sbjct: 160 AIKINPTYSKGYSRLGFAKFAQGKAEDAL 188

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTTAALK 156
           K +GN  F  + YE+A + +  A+ + E P  V YSNRSACY  L K  + ++D    +K
Sbjct: 8   KQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVK 67

Query: 157 LKPDYSKCLLRRATANESLGNYADA 181
           + P +SK   R   A   L N  DA
Sbjct: 68  INPGWSKGYNRVGAAQFGLNNLEDA 92

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 56/119 (47%), Gaps = 20/119 (16%)

Query: 71  PVDQNGEP-----DLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLK 125
           P+ +N EP     D  G     EE+K +        GN+ +K ++++EAI+ Y+ A +L 
Sbjct: 227 PLKENNEPEPMEVDEKGPQVAAEEEKAE--------GNKFYKARKFDEAIEHYNKAWELH 278

Query: 126 EDPVFYSNRSACYVPLNKLEKVVEDTTAAL----KLKPDY---SKCLLRRATANESLGN 177
           +D  + +NR+A        E  +   T A+    +++ DY   +K   R   A   LG+
Sbjct: 279 KDITYLNNRAAAEYEKGDYETAIATLTNAVDEGREMRADYKVIAKSFARIGNAYHKLGD 337

 Score = 37.7 bits (86), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 1/88 (1%)

Query: 102 GNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160
           G E F    +  A+K Y   +K   +D   YSNR+A    L    + + D   A++  P+
Sbjct: 389 GKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPN 448

Query: 161 YSKCLLRRATANESLGNYADAMLDLSAV 188
           + +  +R+A+A  ++  +A A+  L  V
Sbjct: 449 FIRAYIRKASAQIAVKEFAAAVETLDTV 476

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 51/86 (59%), Gaps = 1/86 (1%)

Query: 98  LKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALK 156
           LK +GN+    + +E AIK Y  A++ L  + V+Y+NR+A Y  L K E+ V+D  +A+K
Sbjct: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIK 159

Query: 157 LKPDYSKCLLRRATANESLGNYADAM 182
           + P YSK   R   A  +LG   +A+
Sbjct: 160 VNPSYSKGYSRLGFAKYALGKPEEAL 185

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 89  EQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPLNKLEKV 147
           E K+K A ALK +GN+    + Y+ AI  Y  A+++   +P +YSNR+A Y  +      
Sbjct: 92  EDKKKEAEALKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNA 151

Query: 148 VEDTTAALKLKPDYSKCLLRRATANESLGNYADAM 182
           V D   A+KL P YSK   R   A  + GN  DA+
Sbjct: 152 VLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAV 186

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTTAALK 156
           K +GN  F  + +E+AI+ +  A+++ E P  V YSNRSACY    +  K +ED    + 
Sbjct: 7   KQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVN 66

Query: 157 LKPDYSKCLLRRATANESLGNYADA 181
           + P +SK   R   A+  LG+  +A
Sbjct: 67  INPAWSKGYNRVGAAHFGLGDLDEA 91

 Score = 38.1 bits (87), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 101 KGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKP 159
           +G E F    +  A+K Y   +K   ED   YSNR+A    L    + ++D   A+   P
Sbjct: 399 QGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDP 458

Query: 160 DYSKCLLRRATA 171
           ++ +  +R+ATA
Sbjct: 459 NFIRAYIRKATA 470

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 41/71 (57%), Gaps = 4/71 (5%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAA 154
           A A K +GN+ +K ++++EAI+ Y  A +L +D  + +NR+A      + E  ++  T A
Sbjct: 259 ADAEKAEGNKFYKARKFDEAIEHYSKAWELHKDITYLNNRAAAEYEKGEYETAIKTLTEA 318

Query: 155 L----KLKPDY 161
           +    +L+ DY
Sbjct: 319 VEQGRELRADY 329

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTTAALK 156
           K +GN  F  + Y++AI  +  A+ + E P  V YSNRSACY  L K    ++D    +K
Sbjct: 9   KQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVK 68

Query: 157 LKPDYSKCLLRRATANESLGNYADA 181
           + P +SK   R   A+  +G+  +A
Sbjct: 69  INPSWSKGYNRVGAAHFGMGDLDEA 93

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 1/87 (1%)

Query: 102 GNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160
           G + F    +  A+K Y   +K   ED   YSNR+A    L    + ++D   A++  P+
Sbjct: 404 GKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPN 463

Query: 161 YSKCLLRRATANESLGNYADAMLDLSA 187
           + +  +R+ATA  ++  ++ A+  L A
Sbjct: 464 FVRAYIRKATAQIAVREFSSALETLDA 490

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 39/67 (58%)

Query: 71  PVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPVF 130
           PV Q  EP+   + +  +E  +K A A K +GN+ +K ++++EA+  Y+ A +   D  +
Sbjct: 239 PVVQADEPEQMDVDSNEDENAKKRAEAAKAEGNKLYKARQFDEAVAKYNEAWEAHNDITY 298

Query: 131 YSNRSAC 137
            +NRSA 
Sbjct: 299 LNNRSAA 305

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKE-DPVFYSNRSACYVPLNKLEKVVEDTTA 153
           A+  K++GN C K Q Y +AI+ YD A++L +   V++SNR+ C++ L+  +   +D   
Sbjct: 9   ALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDK 68

Query: 154 ALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
           AL L P   K   RR  A   L  +  A  DL+ V
Sbjct: 69  ALALDPKNVKAYHRRGLACVGLLEFKKARADLTVV 103

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 360 QNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQ--LACLA 417
           + ++KA+ELD   S  + +RA  +  +  F  A +D DKA   DP  V  Y +  LAC+ 
Sbjct: 30  EKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPKNVKAYHRRGLACVG 89

Query: 418 YREKK 422
             E K
Sbjct: 90  LLEFK 94

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 10/78 (12%)

Query: 359 AQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAY 418
           +Q+ +KAL LDPK+  AY+ R      + +F +A  D     +  PS           A 
Sbjct: 63  SQDCDKALALDPKNVKAYHRRGLACVGLLEFKKARADLTVVLKAKPSD----------AA 112

Query: 419 REKKFDDCETLFSEARRR 436
            ++  D CE +  E R R
Sbjct: 113 AKRALDICEKVIREERFR 130

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTTAALK 156
           K +GN  F  + Y++AI+ +  A+++ + P  V YSNRSACY  L K    + D    + 
Sbjct: 9   KQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECIN 68

Query: 157 LKPDYSKCLLRRATANESLGNYADA 181
           + P +SK   R   A+  LG+  +A
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 60/136 (44%), Gaps = 14/136 (10%)

Query: 102 GNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160
           G + F    +  A+K Y   +K   ED   YSNR+A    L    + + D   A++  P+
Sbjct: 403 GKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 161 YSKCLLRRATANESLGNYADAMLDLSA-----VSLYGGYSSQTIEPVLERNMNKQAMQVL 215
           + +  +R+ATA  ++  YA A+  L A       +  G SS+ I+ +          +  
Sbjct: 463 FVRAYIRKATAQIAVQEYAAALETLDAARTKDADVNNGASSREIDQLY--------YKAS 514

Query: 216 KQKLSGGEKHELPSNT 231
           +Q+   G  +E P  T
Sbjct: 515 QQRFQPGTGNETPEET 530

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 27/39 (69%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSAC 137
           K +GN+ +K ++++EAI+ Y+ A +L  D  + +NR+A 
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELHRDITYLNNRAAA 304

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 61/107 (57%), Gaps = 1/107 (0%)

Query: 83  MATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPL 141
           M+T    +  + A+ LK++GN+  K+++Y +A+++Y  A++L     +F+SNR+   + L
Sbjct: 1   MSTTPTTEAAQQAIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKL 60

Query: 142 NKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
           +  +  ++D  +AL+L P   K   RR  +   L ++  A  DLS V
Sbjct: 61  DNFQSCLDDCNSALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIV 107

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 43/100 (43%), Gaps = 12/100 (12%)

Query: 330 QKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQF 389
           Q+AIDL    N YI        + +  +  + + KA+ELD   S  + +RA     +  F
Sbjct: 11  QQAIDLKNEGNKYI-------KEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNF 63

Query: 390 DQAGKDFDKAKECDPSRVYPY-----IQLACLAYREKKFD 424
                D + A E DP  +  Y      QL  L +++ K D
Sbjct: 64  QSCLDDCNSALELDPKNIKAYHRRGLSQLGLLHFKKAKND 103

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 29/70 (41%), Gaps = 10/70 (14%)

Query: 365 ALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFD 424
           ALELDPK+  AY+ R      +  F +A  D     +  PS           A  ++  D
Sbjct: 73  ALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIVLKAKPSD----------ATAKRALD 122

Query: 425 DCETLFSEAR 434
            CE +  E R
Sbjct: 123 MCEKVIREER 132

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTTAALK 156
           K +GN  F  + ++ A++ +  A++  E+P  V YSNRS  Y  L K ++ + D T  +K
Sbjct: 8   KKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVK 67

Query: 157 LKPDYSKCLLRRATANESLGNYADA 181
           +K D+SK   R   A+  LGN  +A
Sbjct: 68  IKADWSKGHNRLGAAHFGLGNLDEA 92

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 1/85 (1%)

Query: 102 GNECFKDQRYEEAIKFY-DCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160
           G E F    +  A+K Y +  ++   D   YSNR+A    L      ++D   A+++ P 
Sbjct: 399 GKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPS 458

Query: 161 YSKCLLRRATANESLGNYADAMLDL 185
           + +  +R+ATA  ++  Y+ A+  L
Sbjct: 459 FVRAYIRKATAQIAVQEYSAAIETL 483

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 27/39 (69%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSAC 137
           K +GN+ +K ++++EAI  Y+ A  L++D  + +NR+A 
Sbjct: 262 KAEGNQLYKQRKFDEAIAKYEEAWNLQKDITYLNNRAAA 300

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 370 PKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLAC 415
           P  +  Y +RA     +  F  A KD DKA E DPS V  YI+ A 
Sbjct: 423 PHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPSFVRAYIRKAT 468

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 83  MATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKE-DPVFYSNRSACYVPL 141
           M+  +EE  +K A+  K++GN   K+++Y EA+++Y  A++L +   +F+SNR+   + L
Sbjct: 1   MSIVSEEAAQK-ALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKL 59

Query: 142 NKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
           +     +ED   +++L P   K + RR  +   L  ++ A  DL  +
Sbjct: 60  DNFLTALEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTI 106

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 2/86 (2%)

Query: 98  LKDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTTAAL 155
            K +GN+ F  + Y +AI+ +  A+++ E P  V +SNRSACY       K ++D    +
Sbjct: 6   FKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECV 65

Query: 156 KLKPDYSKCLLRRATANESLGNYADA 181
           K+ P ++K   R   A+  LG+  +A
Sbjct: 66  KINPSWAKGYNRLGAAHYGLGDLDEA 91

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 7/95 (7%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAA 154
           A A K +GN+ +K ++++EAI+ Y+ A +   D  + +NR+A        E  +E  T A
Sbjct: 255 AEAAKAEGNKLYKQRKFDEAIEKYNEAWETHNDITYLNNRAAAEYEKGDYEAAIETLTKA 314

Query: 155 L----KLKPDY---SKCLLRRATANESLGNYADAM 182
           +    +L+ DY   SK   R   +   LG+   A+
Sbjct: 315 VEQGRELRADYKVISKSFARMGNSYHKLGDLKKAI 349

 Score = 37.7 bits (86), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 1/89 (1%)

Query: 101 KGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKP 159
           +G E F    + +A++ Y   +K    D   YSNR+A    L      + D   A++  P
Sbjct: 395 QGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDP 454

Query: 160 DYSKCLLRRATANESLGNYADAMLDLSAV 188
           ++ +  +R+AT   ++ +YA A+  L + 
Sbjct: 455 NFVRAYIRKATGQIAIKDYAGAIETLDSA 483

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 52/99 (52%), Gaps = 2/99 (2%)

Query: 85  TFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCAL-KLKEDPVFYSNRSACYVPLNK 143
            F+++ K+  A   KD+GN     + Y++AI+ Y  A+ K   DP++YSNRS  Y+ +N 
Sbjct: 128 NFSDKDKQ-IADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186

Query: 144 LEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAM 182
            E  + D    + +  ++SK  +R A        Y DA+
Sbjct: 187 YESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTTAALK 156
           K +GN  F  + + +AI+ +  A+++   P  V YSNRSA Y    + ++ + D T  +K
Sbjct: 9   KQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVK 68

Query: 157 LKPDYSKCLLRRATANESLGNYADA 181
           + P +SK   R   A   LGN  +A
Sbjct: 69  INPTWSKGYNRLGAAEFGLGNLEEA 93

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 102 GNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160
           G E F    +  A+K Y   +K   ED   YSNR+A    L    + ++D   A+K  P+
Sbjct: 396 GKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPN 455

Query: 161 YSKCLLRRATANESLGNYADAM 182
           + +  +R+ATA  ++  YA+A+
Sbjct: 456 FVRAYIRKATAQIAIKEYANAL 477

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 26/39 (66%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSAC 137
           K +GN+ +K  +++EAI+ Y+ A  L +D  + +NRSA 
Sbjct: 259 KVEGNKLYKAHKFDEAIEQYNKAWALNKDITYLNNRSAA 297

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 48/91 (52%), Gaps = 2/91 (2%)

Query: 93  KYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVED 150
           K A   K +GN  F  + Y++AI  +  A+++ E P  V YSNRSA Y    + E+ + D
Sbjct: 3   KTADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSD 62

Query: 151 TTAALKLKPDYSKCLLRRATANESLGNYADA 181
               +K+ P ++K   R+  A + L  Y +A
Sbjct: 63  ADECIKINPSWAKGYTRKGAALQGLHKYEEA 93

 Score = 37.7 bits (86), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 3/88 (3%)

Query: 102 GNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160
           G E F    +  A+K Y   +K   +D   YSNR+A    L      + D   A++  P 
Sbjct: 392 GKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDPS 451

Query: 161 YSKCLLRRATANESLGNYADAM--LDLS 186
           + +  LR+AT   ++  +A A+  LDL+
Sbjct: 452 FIRAYLRKATCQIAVKEFAGAIETLDLA 479

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 4/67 (5%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAAL--- 155
           K +GN+ +K ++++EAI  Y+ A +  +D  + +NRSA        E  ++  T A+   
Sbjct: 255 KAEGNKAYKARQFDEAISHYNQAWETFKDITYLNNRSAAEYEKGDYETCIKTLTEAVENA 314

Query: 156 -KLKPDY 161
            +L+ DY
Sbjct: 315 RELRTDY 321

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 44/86 (51%), Gaps = 2/86 (2%)

Query: 98  LKDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTTAAL 155
            K +GN  F  + YE+A + +  A++  E P  V YSNRSAC+  L K  + + D    +
Sbjct: 6   FKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECV 65

Query: 156 KLKPDYSKCLLRRATANESLGNYADA 181
           K+ P +SK   R   A   LG   +A
Sbjct: 66  KINPAWSKGYNRVGAAYFGLGKLDEA 91

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 57/121 (47%), Gaps = 11/121 (9%)

Query: 78  PD-LSGMATFTEEQKEKYAMALKD---------KGNECFKDQRYEEAIKFY-DCALKLKE 126
           PD L+ +    +EQK + A A  D         +G E F    +  A+K Y +   +  E
Sbjct: 374 PDILTKLRNCEKEQKVREAQAYIDPEKAEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPE 433

Query: 127 DPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLS 186
           D   YSNR+A    L    + ++D   A+   P++ +  +R+ATA  ++  +A A+  L 
Sbjct: 434 DARGYSNRAAALAKLMSFPEAIKDCDMAISKDPNFIRAYIRKATAQIAVREFASAIETLD 493

Query: 187 A 187
           A
Sbjct: 494 A 494

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 54/102 (52%), Gaps = 7/102 (6%)

Query: 88  EEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKLEKV 147
           E+  +K A A K +GN+ +K ++++EAI+ Y+ A  L +D  + +NRSA        E+ 
Sbjct: 260 EQDSKKNADAEKAEGNKFYKARKFDEAIEHYNKAWDLHKDVTYLNNRSAAEYEKGDYEQA 319

Query: 148 VEDTTAAL----KLKPDY---SKCLLRRATANESLGNYADAM 182
           ++  T A+    +++ DY   SK   R   A   L ++  A+
Sbjct: 320 IKTLTEAVEQGREMRADYKLISKSFARIGNAYLKLEDFKKAI 361

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 98  LKDKGNECFKDQRYEEAIKFYDCALKLKEDP--VFYSNRSACYVPLNKLEKVVEDTTAAL 155
            K +GN  F  + Y +AI  +  A+++ E P  V YSNRSACY    K E+ ++D    +
Sbjct: 6   FKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECV 65

Query: 156 KLKPDYSKCLLRRATA 171
           K+ P +SK   R   A
Sbjct: 66  KISPSWSKGYNRVGAA 81

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 101 KGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKP 159
           +G E F    +  A+K Y   +K   +D   +SNR+A    L    + +ED   A+ + P
Sbjct: 386 QGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDP 445

Query: 160 DYSKCLLRRATANESLGNYADAMLDLS 186
           ++ +  +R+ATA  ++  +A A+  L+
Sbjct: 446 NFVRAYIRKATAQIAVKEFAAAIETLN 472

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 30/43 (69%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSAC 137
           A A K +GN+ +K +++EEAI+ Y+ A +L +D  + +NRSA 
Sbjct: 246 AEAEKAEGNKLYKARQFEEAIEHYNKAWELHKDITYLNNRSAA 288

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 313 GILKFLKNEPLEAHNLLQKAIDLFPRPNSYIY--MGLIMADKGQADEYAQNFEKALELDP 370
           G   FL  + ++A +L  KAI++   PN  +Y       A   + +E  ++ E+ +++ P
Sbjct: 10  GNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECVKISP 69

Query: 371 KSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPS 405
             S  Y       F + Q D+A K + +A E D S
Sbjct: 70  SWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDSS 104

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 51/98 (52%), Gaps = 1/98 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPLNKLEKVVEDTTA 153
           A+  KD+GN   K Q Y++AI+ Y  A++L     +FYSNR+  ++ L+  +  + D   
Sbjct: 12  ALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCND 71

Query: 154 ALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVSLY 191
           A+KL  +  K   RR  A   L  +  A  DL+ +  Y
Sbjct: 72  AIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTILLKY 109

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 51/97 (52%), Gaps = 5/97 (5%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKEDP---VFYSNRSACYVPLNKLEKVVEDT 151
           A+A K++GN   K+Q Y +AI+ Y  A++L  DP   +F+SNR+   + L+  +  + D 
Sbjct: 12  AVAFKNEGNTYIKEQNYMKAIELYSQAIEL--DPTQSIFFSNRALAQLKLDNFQSCMNDC 69

Query: 152 TAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
             AL+L P   K   RR  ++  L     A  DL  V
Sbjct: 70  DVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVV 106

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 1/89 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTA 153
           A +LK +GN+    + +E+A+  Y  A++ L  + V+Y+NR+A +  L K E+ V+D   
Sbjct: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAED 156

Query: 154 ALKLKPDYSKCLLRRATANESLGNYADAM 182
           A+K+ P YSK   R   A  +LG   +A+
Sbjct: 157 AIKVNPSYSKGYSRLGFAQYALGKPEEAL 185

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 71/153 (46%), Gaps = 18/153 (11%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKEDP---VFYSNRSACYVPLNKLEKVVEDT 151
           A + KD+GN+  K Q ++ A + Y  A++   DP   +FYSNR+   + L+     + D 
Sbjct: 9   ATSYKDEGNKFLKQQDFQRANELYTKAIE--TDPTQSIFYSNRALANLKLDNFMNALNDC 66

Query: 152 TAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVSLY--------GGYSSQTIEPVL 203
           T A++L     K   RR  AN  L N+  A  D + V  Y         G+   T E V+
Sbjct: 67  TNAIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIVLKYKPNDIIAKNGF--DTCEKVI 124

Query: 204 ERNMNKQAMQVLKQKLSGGEKHELPSNTSLASF 236
                K+A+    +K  G     +  +TSL+SF
Sbjct: 125 REERFKKAIGGSDEKTGGA---TICQSTSLSSF 154

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 51/127 (40%), Gaps = 24/127 (18%)

Query: 316 KFLKNEPLE-AHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKAL-------E 367
           KFLK +  + A+ L  KAI+  P         +  +++  A+    NF  AL       E
Sbjct: 18  KFLKQQDFQRANELYTKAIETDPT------QSIFYSNRALANLKLDNFMNALNDCTNAIE 71

Query: 368 LDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCE 427
           L+  +  AY+ R   N  +  F  A  DF+   +  P+ +            +  FD CE
Sbjct: 72  LNSSNLKAYHRRGLANIGLLNFKSARNDFNIVLKYKPNDIIA----------KNGFDTCE 121

Query: 428 TLFSEAR 434
            +  E R
Sbjct: 122 KVIREER 128

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 46/76 (60%), Gaps = 1/76 (1%)

Query: 101 KGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKP 159
           +GN+    ++++EAI+ Y  A+++   + V+YSNR+A Y  L + E+ V+D   A+++ P
Sbjct: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160

Query: 160 DYSKCLLRRATANESL 175
            YSK   R   A  +L
Sbjct: 161 TYSKGFSRLGFAKYAL 176

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%)

Query: 356 DEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLAC 415
           DE  + +  A+E+ P ++  Y +RA     ++Q++QA KD ++A E DP+    + +L  
Sbjct: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171

Query: 416 LAY 418
             Y
Sbjct: 172 AKY 174

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 52/89 (58%), Gaps = 1/89 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTA 153
           A A K +GN+    + +  A++ Y  A+K L  + ++Y+NR+A +  L + E+ ++D  +
Sbjct: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160

Query: 154 ALKLKPDYSKCLLRRATANESLGNYADAM 182
           A+K+ P YSK   R A A   LG + +A+
Sbjct: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEAL 189

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 49/97 (50%), Gaps = 5/97 (5%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKEDP---VFYSNRSACYVPLNKLEKVVEDT 151
           A+  K++GN   K+Q Y +AI+ Y  A++L  DP   +FYSNR+   + L+  +    D 
Sbjct: 12  AVEFKNEGNVFIKEQNYSKAIELYTKAIEL--DPNQSIFYSNRALAQLKLDNFQSAYNDC 69

Query: 152 TAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
             AL L     K   RR  AN  L  +  A  DL+ V
Sbjct: 70  NEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVV 106

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 60/225 (26%), Positives = 89/225 (39%), Gaps = 16/225 (7%)

Query: 327 NLLQKAIDLFPR-PNSYIYMG---LIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQM 382
           NL  + ++ FP  P ++  +G    ++ D G+A    + FEKA  LD K + AY  +   
Sbjct: 508 NLSDELMNSFPEAPETWCVVGNYFSLIKDHGEA---IKAFEKATSLDRKFAYAYTLQGHE 564

Query: 383 NFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPTAPE 442
           +   + +D A   + KA  CDP     Y  L   A R  K+D     F +AR   P    
Sbjct: 565 HAANETYDTAKIMYRKAIACDPQHYNAYYGLGDCASRLGKYDKALLYFEKARVINPVNAI 624

Query: 443 VPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAALLARQPSASNFAE 502
           +       L      + AL  Y+ A KL+           P   KA LL    S   F+ 
Sbjct: 625 LICCCGHSLEKLNLPDQALTYYELAEKLQPEM------TIPKYKKAQLLF---SLGKFSS 675

Query: 503 ATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADL 547
           A  +FE   +  P        L Q+        +AIK +  A +L
Sbjct: 676 AMYIFESLTKLSPEEVTVHFMLGQIYQTMGRKKDAIKEYTIALNL 720

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 61/145 (42%), Gaps = 1/145 (0%)

Query: 328 LLQKAIDLFPRP-NSYIYMGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVI 386
           + +KAI   P+  N+Y  +G   +  G+ D+    FEKA  ++P ++            +
Sbjct: 577 MYRKAIACDPQHYNAYYGLGDCASRLGKYDKALLYFEKARVINPVNAILICCCGHSLEKL 636

Query: 387 QQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNF 446
              DQA   ++ A++  P    P  + A L +   KF     +F    +  P    V   
Sbjct: 637 NLPDQALTYYELAEKLQPEMTIPKYKKAQLLFSLGKFSSAMYIFESLTKLSPEEVTVHFM 696

Query: 447 YAEILSDKGDFENALKEYDFARKLE 471
             +I    G  ++A+KEY  A  L+
Sbjct: 697 LGQIYQTMGRKKDAIKEYTIALNLD 721

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKED-PVFYSNRSACYVPLNKLEKVVEDTTA 153
           A+  K++GN+  K Q Y  AI+ Y  A+KL +   +++SNR+  ++ ++  +  + D   
Sbjct: 12  ALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDK 71

Query: 154 ALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
           AL++ P   K   RR  +   L  + +A  DL  V
Sbjct: 72  ALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIV 106

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 37/90 (41%), Gaps = 12/90 (13%)

Query: 345 MGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDP 404
           MG +  D  Q+     + +KALE+DPK+  AY+ R      + +F  A KD        P
Sbjct: 54  MGHLKMDNFQSG--INDCDKALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKP 111

Query: 405 SRVYPYIQLACLAYREKKFDDCETLFSEAR 434
           +           A  ++  D CE    E R
Sbjct: 112 ND----------ATAKRGLDVCEKFIREER 131

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 50/83 (60%), Gaps = 3/83 (3%)

Query: 88  EEQKE--KYAMALKDKGNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPLNKL 144
           EE KE    A ALK +GN+    + Y  A++ Y+ A+KL     V+Y+NR+A Y    K 
Sbjct: 94  EEDKELAAKAEALKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKY 153

Query: 145 EKVVEDTTAALKLKPDYSKCLLR 167
           ++ ++D  +A+K++P++SK   R
Sbjct: 154 DEAIKDAESAIKVEPNWSKGYSR 176

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 95/240 (39%), Gaps = 10/240 (4%)

Query: 309 LEHVGILKFLKNEPLEAHNLLQKAIDLFPRP-NSYIYMGLIMADKGQADEYAQNFEKALE 367
           LE    L +  ++ ++  NL  + ID FP    ++  +G   + +   DE  + F KA E
Sbjct: 463 LEIFSTLLWHLHDKVKLSNLANELIDNFPEAAQTWCVLGNHFSLQKDHDEAIKAFNKATE 522

Query: 368 LDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCE 427
           LDP+ + AY  +       + FD A   + KA  CD      Y  L     +    D   
Sbjct: 523 LDPRFAYAYTLQGHEYASNESFDTARTFYRKALACDSQHYNAYYGLGTCDSQNGNHDRSL 582

Query: 428 TLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGK 487
             F +AR   P    +       L    ++E ALK YDFA KL+               K
Sbjct: 583 LFFEKARMINPVNIVLICCCGVELEKVRNYELALKYYDFASKLQPN------SALAKYRK 636

Query: 488 AALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADL 547
           A LL    S   ++ A +LFE   + D  +      L ++        +A+K +  A +L
Sbjct: 637 AELLF---SLGRYSLAVELFEDLIKLDSENPNLHYMLGKIYQTMGRKKDAVKEYTVAMNL 693

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 5/82 (6%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKEDP-----VFYSNRSACYVPLNKLEKVVE 149
           A   K++GNE +K +RY++A + Y+  +++K D        +SNR+AC + L    + V 
Sbjct: 78  AENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVN 137

Query: 150 DTTAALKLKPDYSKCLLRRATA 171
           D   AL+  P   KC  R A A
Sbjct: 138 DCRQALQFNPTNIKCFYRIARA 159

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 98  LKDKGNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPLNKLEKVVEDTTAALK 156
           LK +GN C++ Q Y  A+++YD  L+    +P+ +SNR+ C + LN+ ++  +   A L 
Sbjct: 7   LKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLNRSQEAQKACQAGLA 66

Query: 157 L 157
           L
Sbjct: 67  L 67

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 83  MATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPL 141
           M+  T EQ  + A+ LK++GN   K Q + +AI  Y  A+ L     +++SNR+  ++ L
Sbjct: 1   MSNPTSEQSAE-ALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKL 59

Query: 142 NKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
           +  +  + D   ALKL P  +K   RR  +   L  +  A  DL  V
Sbjct: 60  DNFQSSLNDCDEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIV 106

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTA 153
           A  LK +GN+    + ++ AIK Y  A++ L  + V+Y+NR+A +  +   E+ ++D  +
Sbjct: 97  AETLKLEGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAES 156

Query: 154 ALKLKPDYSKCLLRRATANESLGNYADAM 182
           A+K  P YSK   R   A  +LG   DA+
Sbjct: 157 AIKTDPTYSKGYSRLGYAKFALGQAEDAL 185

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 47/95 (49%), Gaps = 1/95 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPLNKLEKVVEDTTA 153
           A+  K+KGNE  K   Y+ AI+FY  A+ L     +++SNR+  ++  +     V D   
Sbjct: 12  ALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDN 71

Query: 154 ALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
           ALKL P   K   RR  +   +  +  A  DL+ V
Sbjct: 72  ALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVV 106

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 50/99 (50%), Gaps = 5/99 (5%)

Query: 88  EEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKED-----PVFYSNRSACYVPLN 142
           E +  + A   K++GN+ +K +R+ +A + Y+ A+ +K D        Y+NR+AC + L 
Sbjct: 67  EGEPHEIAGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELK 126

Query: 143 KLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADA 181
              + + D   AL L P   KC  R A A  ++  + D 
Sbjct: 127 NYRRCINDCKMALSLNPKNIKCYFRMAKAFLAIEKFDDC 165

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKE-DPVFYSNRSACYVPLNKLEKVVEDTTA 153
           A+  KD+GN+    + Y +AI+ Y  A++L     +F+SNR+   + L++ +  +ED++ 
Sbjct: 9   ALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSK 68

Query: 154 ALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
           A++L     K   RR  A   L ++  A  DL  V
Sbjct: 69  AIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVV 103

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 351 DKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPY 410
           D GQA E    + KA+ELD   S  + +RA  N  + +F  A +D  KA E D S V  Y
Sbjct: 24  DYGQAIE---AYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIELDSSNVKGY 80

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 55/113 (48%), Gaps = 1/113 (0%)

Query: 327 NLLQKAIDLFP-RPNSYIYMGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFV 385
           +L+   +  +P +P ++  +G  ++ K   ++  + FEKA ++DPK + AY  +      
Sbjct: 538 SLVDYLLTYYPNKPETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSS 597

Query: 386 IQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFP 438
              FD A K F KA  CDP     Y  +   + +   +D+    F +AR+ +P
Sbjct: 598 NDSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYP 650

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKE-DPVFYSNRSACYVPLNKLEKVVEDTTA 153
           A+  K++GN   K+++Y+EA+++Y  A++L +   +++SNR+   + L+      ED   
Sbjct: 10  ALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDK 69

Query: 154 ALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
           A+ L P   K + RR  +   L  +  A  DL  V
Sbjct: 70  AIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVV 104

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTA 153
           A ALK +GN+    + Y+ A++ Y  A+K L  + V+++NR+A Y      ++ V+D   
Sbjct: 101 AEALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEE 160

Query: 154 ALKLKPDYSKCLLRRATA 171
           A+KL P YSK   R A A
Sbjct: 161 AIKLDPAYSKGYSRLAYA 178

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 38/67 (56%)

Query: 360 QNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYR 419
           + + +A+++ P ++  + +RA      Q +D+A KD ++A + DP+    Y +LA   Y 
Sbjct: 122 EKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYV 181

Query: 420 EKKFDDC 426
           ++ F++ 
Sbjct: 182 QENFEES 188

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 69/145 (47%), Gaps = 3/145 (2%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPLNKLEKVVEDTTA 153
           A+  K++GNE  K + Y  A++ Y  A++      +F+SNR+   + L++ +  +ED+  
Sbjct: 38  ALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSAR 97

Query: 154 ALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV--SLYGGYSSQTIEPVLERNMNKQA 211
           A++L     K   RR  A+  L  +  A  DL  V  +  G  + +    V ER + ++ 
Sbjct: 98  AIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEVVVRAKPGDEAVRRALEVCERMLRRER 157

Query: 212 MQVLKQKLSGGEKHELPSNTSLASF 236
            +   +     E+  L    SLASF
Sbjct: 158 FERAIRADGDEEQRRLCKTLSLASF 182

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 72/164 (43%), Gaps = 1/164 (0%)

Query: 309 LEHVGILKFLKNEPLEAHNLLQKAIDLFP-RPNSYIYMGLIMADKGQADEYAQNFEKALE 367
           +E    L +  ++ +++ NL    +D  P +P ++  +G +++ +   D   + FEKA +
Sbjct: 509 MEIFSTLLWHLHDKVKSSNLANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQ 568

Query: 368 LDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCE 427
           LDP  + AY  +   +      D A   + KA  CDP     Y  L   A +  ++++  
Sbjct: 569 LDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEAL 628

Query: 428 TLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLE 471
             F +AR   P    +       L   G  E AL+ Y+ A  L+
Sbjct: 629 LYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQ 672

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 69/171 (40%), Gaps = 13/171 (7%)

Query: 380 AQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPT 439
            +++F I  +D + K F++ K+  P+RV      + L +          L +      P 
Sbjct: 479 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPN 538

Query: 440 APEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAALLARQPSASN 499
            PE       +LS + D + A+K ++ A +L+           P    A  L     +SN
Sbjct: 539 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLD-----------PNFAYAYTLQGHEHSSN 587

Query: 500 FAE--ATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLS 548
            +   A   +  A   DP+   A  GL    ++  + +EA+  FE A  ++
Sbjct: 588 DSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSIN 638

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 2/96 (2%)

Query: 88  EEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEK 146
           EE K K A  LK +GN+    + ++ AI  Y  A+ +   + ++Y+NR+A Y  L   EK
Sbjct: 93  EETKVK-AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEK 151

Query: 147 VVEDTTAALKLKPDYSKCLLRRATANESLGNYADAM 182
             ED  +A+++ P+YSK   R   A  +L    +A+
Sbjct: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEAL 187

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTA 153
           A ALK +GN+    + +E AI  Y  A++ L  + V+++NR+A Y  L K  + VED  A
Sbjct: 98  AEALKLEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEA 157

Query: 154 ALKLKPDYSKCLLRRATANESLGNYADAM 182
           A+K+ P YSK   R   A  +LG   +A+
Sbjct: 158 AIKVNPSYSKGYSRLGFAQYALGRPEEAL 186

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 59/113 (52%), Gaps = 14/113 (12%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFY------DCALKLKEDPVFYSNRSACYVPLNKLEKVV 148
           A   K +GNE +K +R+++A + Y      +C  K   + +F +NR+AC + L    + +
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLF-ANRAACELELKNYRRCI 141

Query: 149 EDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVSLYGGYSSQTIEP 201
           ED + AL + P   KC  R + A  SL    +A    +A+     +++Q+IEP
Sbjct: 142 EDCSKALTINPKNIKCYYRTSKAFFSLSKLEEA--KSAAI-----FANQSIEP 187

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 5/82 (6%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLK-EDPV----FYSNRSACYVPLNKLEKVVE 149
           A   K +GNE +K +R+++A + Y   L ++ ED       Y+NR+AC + L    + +E
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIE 142

Query: 150 DTTAALKLKPDYSKCLLRRATA 171
           D + AL + P   KC  R + A
Sbjct: 143 DCSKALTINPKNVKCYYRTSKA 164

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 98  LKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALK 156
           LK +GN+   ++ YE AI  Y  A+K L  + ++Y+NR+A +  L   ++ VED  +A+ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164

Query: 157 LKPDYSKCLLR 167
           + P Y +   R
Sbjct: 165 IDPTYFRGYSR 175

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 2/76 (2%)

Query: 98  LKDKGNECFKDQRYEEAIKFYDCALKL--KEDPVFYSNRSACYVPLNKLEKVVEDTTAAL 155
           LK+ GN+ +K++ YE+A+ ++  AL        + YSNR+A ++ L    + +ED    +
Sbjct: 11  LKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCV 70

Query: 156 KLKPDYSKCLLRRATA 171
           +L P++ K   R   A
Sbjct: 71  ELAPNWDKGYSRVGVA 86

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 102 GNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160
           G + F ++ Y +A+K Y   +K     PV + NR+A +  L    +V++D   A+ + P 
Sbjct: 436 GKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPS 495

Query: 161 YSKCLLRRATA 171
           Y K  +R+  A
Sbjct: 496 YIKAYVRKGFA 506

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 45/82 (54%), Gaps = 5/82 (6%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPVF-----YSNRSACYVPLNKLEKVVE 149
           A   K +GNE +K +R+++A + Y   L ++ +  F     ++N++AC + L    + +E
Sbjct: 83  AGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIE 142

Query: 150 DTTAALKLKPDYSKCLLRRATA 171
           D + AL + P  +KC  R + A
Sbjct: 143 DCSKALSINPKNTKCYYRTSKA 164

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 98  LKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALK 156
           LK +GN+   ++ YE AI  Y  A+K L  + ++Y+NR+A +  L + ++ V+D  +A+ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164

Query: 157 LKPDYSKCLLR 167
           + P Y +   R
Sbjct: 165 IDPSYFRGYSR 175

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 34/61 (55%)

Query: 362 FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREK 421
           + +A+++ P ++  Y +RA  +  ++++DQA KD + A   DPS    Y +L    Y + 
Sbjct: 125 YTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQG 184

Query: 422 K 422
           K
Sbjct: 185 K 185

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 46/99 (46%), Gaps = 5/99 (5%)

Query: 88  EEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV-----FYSNRSACYVPLN 142
           E +  + A   K++GN+ +K +R+ +A + Y   +++K D        Y+NR+AC + L 
Sbjct: 71  EGEPHEIAENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELK 130

Query: 143 KLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADA 181
                + D   AL   P   KC  R   A  ++  +  A
Sbjct: 131 NFRSCISDCKTALTYNPKNIKCYFRMGKAFTAINKFESA 169

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPLNKLEKVVEDTTA 153
           A +LK +GN+    + YE AIK Y  A+ +   + V+Y+NR+A +  L   ++ ++D  +
Sbjct: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152

Query: 154 ALKLKPDYSKCLLR 167
           A+K+   YSK   R
Sbjct: 153 AVKVDSSYSKGYSR 166

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 5/99 (5%)

Query: 88  EEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLK--EDPV---FYSNRSACYVPLN 142
           E +  + A   K++GN+ F  +R+ EA   Y+  +++K   D +    ++NR+AC + L 
Sbjct: 73  EGEPHEVAENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELK 132

Query: 143 KLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADA 181
                + D   AL L P   KC  R   A   L N  +A
Sbjct: 133 NYRSCINDCKHALTLNPKNIKCYYRMGKAFYLLNNIEEA 171

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 78/209 (37%), Gaps = 48/209 (22%)

Query: 337 PR-PNSYIYMGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKD 395
           PR P ++  +G  ++ +    E  + FEKA ++DPK + AY  +         FD A + 
Sbjct: 525 PRIPETWCCLGNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRC 584

Query: 396 FDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKG 455
           + KA  CDP     Y  L  ++ +  ++++    F +AR   P                 
Sbjct: 585 YRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINP----------------- 627

Query: 456 DFENALKEYDFARKLEDAQEGIHVGVAPLVGKAAL--LARQPSASNFAEATKLFELACEK 513
                                I+V V    G  AL  L+ Q       +A + +ELACE 
Sbjct: 628 ---------------------INV-VLVCCGGVALEKLSYQ------EKALQYYELACEL 659

Query: 514 DPRSEQAKIGLAQLKLQQEEVDEAIKLFE 542
            P S  A    A L         A+K FE
Sbjct: 660 QPSSSLATFKRAHLLYSMGRYTLALKFFE 688

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 53/144 (36%), Gaps = 34/144 (23%)

Query: 362 FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRV-------------- 407
           + KA+  DP    AYY    ++  + Q+++A   F+KA+  +P  V              
Sbjct: 585 YRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVALEKLS 644

Query: 408 -----YPYIQLAC---------------LAYREKKFDDCETLFSEARRRFPTAPEVPNFY 447
                  Y +LAC               L Y   ++      F E +   P    V    
Sbjct: 645 YQEKALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEATVHFLL 704

Query: 448 AEILSDKGDFENALKEYDFARKLE 471
            +I S  G  ++A+KEY  A  L+
Sbjct: 705 GQIYSILGRKKDAIKEYTIALNLD 728

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 72/164 (43%), Gaps = 1/164 (0%)

Query: 309 LEHVGILKFLKNEPLEAHNLLQKAIDLFP-RPNSYIYMGLIMADKGQADEYAQNFEKALE 367
           +E    L +  ++ +++ NL    +D  P +P ++  +G +++ +   D   + FEKA +
Sbjct: 502 MEIFSTLLWHLHDKVKSSNLANGLMDTMPNKPETWCCVGNLLSLQKDHDAAIKAFEKATQ 561

Query: 368 LDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCE 427
           LDP  + AY  +   +      D A   + KA  CDP     Y  L   + +  ++++  
Sbjct: 562 LDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEAL 621

Query: 428 TLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLE 471
             F +AR   P    +       L   G  E AL+ Y+ A  L+
Sbjct: 622 LYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQ 665

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 69/171 (40%), Gaps = 13/171 (7%)

Query: 380 AQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPT 439
            +++F I  +D + K F++ K+  P+RV      + L +          L +      P 
Sbjct: 472 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPN 531

Query: 440 APEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAALLARQPSASN 499
            PE       +LS + D + A+K ++ A +L+           P    A  L     +SN
Sbjct: 532 KPETWCCVGNLLSLQKDHDAAIKAFEKATQLD-----------PNFAYAYTLQGHEHSSN 580

Query: 500 FAE--ATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLS 548
            +   A   +  A   DP+   A  GL    ++  + +EA+  FE A  ++
Sbjct: 581 DSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSIN 631

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 53/101 (52%), Gaps = 3/101 (2%)

Query: 85  TFTEEQKEKYAMA--LKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPL 141
              EE  E  A A  LK +GN+   ++ YE AIK Y  A+  L  + ++Y+NR+A +  L
Sbjct: 90  NIPEEDAETKAKAEELKIQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSL 149

Query: 142 NKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAM 182
            + ++ ++D  +A+ + P Y +   R   A  + G   +A+
Sbjct: 150 KEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEAL 190

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 34/61 (55%)

Query: 362 FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREK 421
           + +A+++ P ++  Y +RA  +  ++++D+A KD + A   DPS    Y +L    Y + 
Sbjct: 125 YTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQG 184

Query: 422 K 422
           K
Sbjct: 185 K 185

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 5/79 (6%)

Query: 98  LKDKGNECFKDQRYEEAIKFYDCALKLKEDPV-----FYSNRSACYVPLNKLEKVVEDTT 152
            K++GN+ +K +R+++A + Y+  +++K D        Y+NR+AC + +    + + D  
Sbjct: 81  FKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLNDCK 140

Query: 153 AALKLKPDYSKCLLRRATA 171
            AL+  P   KC  R   A
Sbjct: 141 TALQYNPKNLKCYYRMGKA 159

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 72/164 (43%), Gaps = 1/164 (0%)

Query: 309 LEHVGILKFLKNEPLEAHNLLQKAIDLFP-RPNSYIYMGLIMADKGQADEYAQNFEKALE 367
           +E    L +  ++ +++ NL    +D  P +P ++  +G +++ +   D   + FEKA +
Sbjct: 514 MEIYSTLLWHLHDKVKSSNLANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQ 573

Query: 368 LDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCE 427
           LDP  + AY  +   +      D A   + KA  CDP     Y  L   + +  ++++  
Sbjct: 574 LDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEAL 633

Query: 428 TLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLE 471
             F +AR   P    +       L   G  E  L+ Y+ A +L+
Sbjct: 634 LYFEKARSINPVNVVLICCCGGSLEKLGYKEKVLQYYELACQLQ 677

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 69/171 (40%), Gaps = 13/171 (7%)

Query: 380 AQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPT 439
            +++F I  +D + K F++ K+  P+RV      + L +          L +      P 
Sbjct: 484 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIYSTLLWHLHDKVKSSNLANGLMDTMPN 543

Query: 440 APEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAALLARQPSASN 499
            PE       +LS + D + A+K ++ A +L+           P    A  L     +SN
Sbjct: 544 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLD-----------PNFAYAYTLQGHEHSSN 592

Query: 500 FAE--ATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLS 548
            +   A   +  A   DP+   A  GL    ++  + +EA+  FE A  ++
Sbjct: 593 DSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSIN 643

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 92/223 (41%), Gaps = 22/223 (9%)

Query: 304 KLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPR-PNSYIYMGLIMADKGQADEYAQNF 362
           K AI    +G L  L  +  EA   L+KA +L PR   +Y   G   ++    D     +
Sbjct: 455 KSAITWCCLGNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCY 514

Query: 363 EKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLAC------L 416
            KAL ++P    A+Y        + Q+D+A   F+KA+  +P  V   +   C      L
Sbjct: 515 RKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV--ILNCCCGVALERL 572

Query: 417 AYREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEG 476
             REK  D     +  A    P +       +++L + G + NAL+ ++   +L   +  
Sbjct: 573 GRREKALD----FYQLACELQPNSSLALFKKSQLLFNLGQYSNALQNFEKLEQLTPNEAP 628

Query: 477 IHVGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQ 519
           IH  +  L     ++ R+       +A   F +A   DP+  Q
Sbjct: 629 IHFLLGQLY---QIVGRK------KDAITQFTIAMNLDPKGIQ 662

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 58/130 (44%), Gaps = 12/130 (9%)

Query: 281 FTDAVEKFTAAHEANPDNAALKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPN 340
           + +A+  F  A   NP N  L     +ALE +G     + E  +A +  Q A +L  +PN
Sbjct: 541 YDEALLHFEKARSINPVNVILNCCCGVALERLG-----RRE--KALDFYQLACEL--QPN 591

Query: 341 SYIYM---GLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFD 397
           S + +     ++ + GQ     QNFEK  +L P  +  ++   Q+  ++ +   A   F 
Sbjct: 592 SSLALFKKSQLLFNLGQYSNALQNFEKLEQLTPNEAPIHFLLGQLYQIVGRKKDAITQFT 651

Query: 398 KAKECDPSRV 407
            A   DP  +
Sbjct: 652 IAMNLDPKGI 661

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 44/84 (52%), Gaps = 5/84 (5%)

Query: 102 GNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKL---EKVVEDTTAALKLK 158
           G  C K  +Y+EA+  ++ A  +  +PV       C V L +L   EK ++    A +L+
Sbjct: 532 GMSCIKLGQYDEALLHFEKARSI--NPVNVILNCCCGVALERLGRREKALDFYQLACELQ 589

Query: 159 PDYSKCLLRRATANESLGNYADAM 182
           P+ S  L +++    +LG Y++A+
Sbjct: 590 PNSSLALFKKSQLLFNLGQYSNAL 613

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 70/184 (38%), Gaps = 11/184 (5%)

Query: 366 LELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDD 425
           +E D KS+  +     +  + +  D+A K   KA   DP   Y Y            FD+
Sbjct: 450 MEQDDKSAITWCCLGNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDN 509

Query: 426 CETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLV 485
            +  + +A    P                G ++ AL  ++ AR +      ++V +    
Sbjct: 510 AKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINP----VNVILNCCC 565

Query: 486 GKAA-LLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAA 544
           G A   L R+  A +F      ++LACE  P S  A    +QL     +   A++ FE  
Sbjct: 566 GVALERLGRREKALDF------YQLACELQPNSSLALFKKSQLLFNLGQYSNALQNFEKL 619

Query: 545 ADLS 548
             L+
Sbjct: 620 EQLT 623

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 47/86 (54%), Gaps = 3/86 (3%)

Query: 85  TFTEEQKEKYAMA--LKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPL 141
              EE  E  A A  LK +GN+   ++ YE AI  Y  A++ L  + ++Y+NR+A +  L
Sbjct: 90  NIPEEDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSL 149

Query: 142 NKLEKVVEDTTAALKLKPDYSKCLLR 167
            + ++ V+D  +++ + P Y +   R
Sbjct: 150 REYDEAVKDAESSISIDPSYFRGYSR 175

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 34/61 (55%)

Query: 362 FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREK 421
           + +A+++ P ++  Y +RA  +  ++++D+A KD + +   DPS    Y +L    Y + 
Sbjct: 125 YTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAKYAQG 184

Query: 422 K 422
           K
Sbjct: 185 K 185

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 46/93 (49%), Gaps = 5/93 (5%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLK-----EDPVFYSNRSACYVPLNKLEKVVE 149
           A   K +GN+ +K +R+ +A + Y   + +K      +   Y+NR+AC + +    + + 
Sbjct: 81  AENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCIN 140

Query: 150 DTTAALKLKPDYSKCLLRRATANESLGNYADAM 182
           D   AL+L P   KC  R A A  +L    +A+
Sbjct: 141 DCKQALQLNPKNIKCYYRIAKAFTALERLDEAL 173

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 72/164 (43%), Gaps = 1/164 (0%)

Query: 309 LEHVGILKFLKNEPLEAHNLLQKAIDLFP-RPNSYIYMGLIMADKGQADEYAQNFEKALE 367
           +E    L +  ++ +++ NL    +D+ P +P ++  +G +++ +   D   + FEKA +
Sbjct: 520 MEIFSTLLWHLHDKVKSSNLANGLMDIMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQ 579

Query: 368 LDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCE 427
           LDP  + AY  +   +      D A   + KA  CD      Y  L   + +  ++++  
Sbjct: 580 LDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDSQHYNAYYGLGTSSMKLGQYEEAL 639

Query: 428 TLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLE 471
             F +AR   P    +       L   G  E AL+ Y+ A  L+
Sbjct: 640 LYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQ 683

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 5/99 (5%)

Query: 88  EEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKED-----PVFYSNRSACYVPLN 142
           E +  + A   K++GN+ ++ +RY++A + Y+  +++  D        + NR+AC + L 
Sbjct: 73  EGEPHEIAENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELK 132

Query: 143 KLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADA 181
              + + D   AL+  P   KC  R   A  SL    +A
Sbjct: 133 NHRRCINDCKEALRYNPKNVKCFYRMGRAFFSLNKLEEA 171

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 49/89 (55%), Gaps = 1/89 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTA 153
           A + K +GN+    + Y  AI+ Y  A+K L  + ++Y+NR+A Y  + + +  ++D   
Sbjct: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158

Query: 154 ALKLKPDYSKCLLRRATANESLGNYADAM 182
           A+++ P YSK   R A A  +L    +A+
Sbjct: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEAL 187

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%)

Query: 360 QNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAY 418
           + + +A++  P +   Y +RA     ++++D A KD +KA E DP+    Y +LA   Y
Sbjct: 120 EKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKY 178

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 46/92 (50%), Gaps = 5/92 (5%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLK--EDPV---FYSNRSACYVPLNKLEKVVE 149
           A   K++GNE +K ++Y +A + Y   + +K  +D +    Y+NR+AC + L    K +E
Sbjct: 74  AGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIE 133

Query: 150 DTTAALKLKPDYSKCLLRRATANESLGNYADA 181
           D   AL       KC  R   A  S+  + ++
Sbjct: 134 DCKKALSFNVKNIKCYYRMGKAFLSVDRFDES 165

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 81/217 (37%), Gaps = 44/217 (20%)

Query: 333 IDLFPRPN-SYIYMGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQ 391
           ID +P  + S+ ++G   +     D+  +  +KA  ++P+ + AY         I  FD 
Sbjct: 611 IDNYPNNSISWCFIGNYFSLINDHDKAIKYLKKATTINPRFTYAYTLEGHEQASIDAFDT 670

Query: 392 AGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEIL 451
           A   + KA  CDP+    Y  L     R  ++D     F +A+   P+        A +L
Sbjct: 671 AKNCYRKAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMINPSN-------AILL 723

Query: 452 SDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAALLARQPSASNFAEATKLFELAC 511
              G    AL++ +F  K                                 A   +ELAC
Sbjct: 724 CCCGS---ALEKLNFNEK---------------------------------ALNYYELAC 747

Query: 512 EKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLS 548
              P S  AK  LA+L       + A+++ E   +++
Sbjct: 748 NLQPNSSFAKFKLAKLLYSMSRYNLALEILEQVIEMA 784

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 48/95 (50%), Gaps = 5/95 (5%)

Query: 93  KYAMALKDKGNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPLNKLEKVVEDT 151
           K A  LK+KGNE  K ++Y +AI  Y  A+KL   +  +Y+NR+  Y+  N  +  + D 
Sbjct: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191

Query: 152 TAAL----KLKPDYSKCLLRRATANESLGNYADAM 182
             ++    K+ P   K   R   A   +G+Y  ++
Sbjct: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL 226

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 7/86 (8%)

Query: 88  EEQKEKYAMALKDKGNECFKDQRYEEAIKFY------DCALKLKEDPVFYSNRSACYVPL 141
           E +  + A   K +GNE +K +R+++A + Y      +C  K   + +F +NR+AC + L
Sbjct: 76  EGEPHEIAENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLF-ANRAACELEL 134

Query: 142 NKLEKVVEDTTAALKLKPDYSKCLLR 167
               K VED   AL + P   KC  R
Sbjct: 135 KNYRKCVEDCGKALTINPKNIKCYYR 160

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 5/92 (5%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKED-----PVFYSNRSACYVPLNKLEKVVE 149
           A   K++GN+ ++ +RY++A + Y+  + +K D        +SNR+AC + L    + V 
Sbjct: 78  AENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVN 137

Query: 150 DTTAALKLKPDYSKCLLRRATANESLGNYADA 181
           D   AL+      KC  R A A   L    DA
Sbjct: 138 DCKRALQYNVKNIKCYYRIAKAFLLLNKLEDA 169

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTA 153
           A ALK +GN+    + +E AI  Y  A++ L  + ++Y+NR+A +  L + ++ V D   
Sbjct: 93  AEALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEK 152

Query: 154 ALKLKPDYSKCLLR 167
           A+++ P YSK   R
Sbjct: 153 AIEIDPAYSKGYSR 166

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 35/61 (57%)

Query: 362 FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREK 421
           + +A+E+ P ++  Y +RA  +  ++Q+D+A  D +KA E DP+    Y +L    Y + 
Sbjct: 116 YSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQN 175

Query: 422 K 422
           K
Sbjct: 176 K 176

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPLNKLEKVVEDTTA 153
           A+  K++GN   K++ + +AI+ Y  A+ L     +++SNR+  +  ++  +  + D   
Sbjct: 12  ALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 154 ALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
           ALKL P   K   RRA +  +L  +  A  DL+ +
Sbjct: 72  ALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTVL 106

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 360 QNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQ--LACLA 417
           + + +A++LD   S  + +RA  +F +  F  A  D D+A + DP  +  Y +  L+C+A
Sbjct: 33  EKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKLDPKNIKAYHRRALSCMA 92

Query: 418 YREKK 422
             E K
Sbjct: 93  LLEFK 97

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 3/46 (6%)

Query: 363 EKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFD---KAKECDPS 405
           ++AL+LDPK+  AY+ RA     + +F +A KD     KAK  DP+
Sbjct: 70  DEALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTVLLKAKPNDPA 115

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 81/218 (37%), Gaps = 43/218 (19%)

Query: 339 PNSYIYMGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDK 398
           P ++  MG  ++ +   ++  + FEKA ++DP  + AY  +   +     FD A   + K
Sbjct: 535 PQTWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRK 594

Query: 399 AKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPT------------------- 439
           A  CDP     Y  L     +  ++D+    F +AR   P                    
Sbjct: 595 ALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEKLQYQE 654

Query: 440 --------------APEVPNF-YAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPL 484
                         +  + NF  A +L   G +  AL+ ++   KL   +  +H  +  L
Sbjct: 655 KALSYYELACELQPSSSLANFKRAHLLYSMGRYSVALQYFEELTKLAPDEATVHFLLGQL 714

Query: 485 VGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKI 522
                +L R+       +A K F +A   DP+  Q  I
Sbjct: 715 Y---QILGRK------KDAVKEFTIAMNLDPKGNQLII 743

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTA 153
           A+ LK++GN+  K++ Y +A ++Y  A++   E+ + YSNR+   + L+  +  ++D   
Sbjct: 13  ALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKR 72

Query: 154 ALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
           A++L  +  K   RRA +   L  +  A  DL  V
Sbjct: 73  AIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIV 107

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 8/90 (8%)

Query: 97  ALKDKGNECFKDQRYEEAIKFYD-CALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAAL 155
            +K++GN  F++  +  A ++Y  C     E+P+ YSNR+   + L K  + ++     L
Sbjct: 6   TVKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGL 65

Query: 156 -------KLKPDYSKCLLRRATANESLGNY 178
                  K +P   K L R   A ESL  +
Sbjct: 66  GKLEDNEKDEPIRKKLLYRLHLAQESLNKF 95

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 46/94 (48%), Gaps = 6/94 (6%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKE------DPVFYSNRSACYVPLNKLEKVV 148
           A+ LK +GN+  + + Y++AI  Y  A+ L +      D  + SN+S       + E+  
Sbjct: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143

Query: 149 EDTTAALKLKPDYSKCLLRRATANESLGNYADAM 182
           +D  A +K+ P +SK   R A A      Y DAM
Sbjct: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 56/107 (52%), Gaps = 2/107 (1%)

Query: 83  MATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPL 141
           M+T T   + K A+  K++GN   K++ + +AI+ Y  A+ L     +++SNR+  +  +
Sbjct: 1   MSTPTAADRAK-ALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKV 59

Query: 142 NKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
           +  +  + D   A+KL P   K   RRA +  +L  +  A  DL+ +
Sbjct: 60  DNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVL 106

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 360 QNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQ--LACLA 417
           + + +A++LD   S  + +RA  +F +  F  A  D D+A + DP  +  Y +  L+C+A
Sbjct: 33  EKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMA 92

Query: 418 YREKK 422
             E K
Sbjct: 93  LLEFK 97

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 3/46 (6%)

Query: 363 EKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFD---KAKECDPS 405
           ++A++LDPK+  AY+ RA     + +F +A KD +   KAK  DP+
Sbjct: 70  DEAIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVLLKAKPNDPA 115

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query: 98  LKDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYS-----NRSACYVPLNKLEKVVEDTT 152
            K++GN+ +K +R+ +A   Y+  +++K D    S     NR+AC + L    + + D  
Sbjct: 80  FKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCR 139

Query: 153 AALKLKPDYSKCLLRRATA 171
            ALKL P   K   R   A
Sbjct: 140 EALKLNPKNPKAFFRIGKA 158

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 83  MATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKL-KEDPVFYSNRSACYVPL 141
           M+  TE  + K A   K++GN   K++ + +AI+ Y  A+ L     +++SNR+  +  +
Sbjct: 1   MSNPTEADRVK-AHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKV 59

Query: 142 NKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
           +  +  + D   A+KL P   K   RRA +  +L  +  A  DL+ +
Sbjct: 60  DNFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKAKRDLNVL 106

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 360 QNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQ--LACLA 417
           + + +A++LD   +  + +RA  +F +  F  A  D D+A + DP  +  Y +  L+C+A
Sbjct: 33  EKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMA 92

Query: 418 YREKK 422
             E K
Sbjct: 93  LLEFK 97

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 46/92 (50%), Gaps = 10/92 (10%)

Query: 88  EEQKEKYAMALKDKGNECFKDQRYEEAIKFY--------DCALKLKEDPVFYSNRSACYV 139
           E +  + A   K++GN+ +K +R+++A   Y        +  +K+KE    ++N++AC +
Sbjct: 69  EGEPHEIAENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKES--LFANKAACEL 126

Query: 140 PLNKLEKVVEDTTAALKLKPDYSKCLLRRATA 171
            L    + + D   AL+L P   KC  R   A
Sbjct: 127 ELKNFRRCINDCKNALQLNPKNVKCYFRMTRA 158

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 48/99 (48%), Gaps = 5/99 (5%)

Query: 88  EEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKL-----KEDPVFYSNRSACYVPLN 142
           E +  + A   K++ N+ +K +R+ +A + Y   +K+       +   ++NR+AC + L 
Sbjct: 78  EGEPHEIAENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELK 137

Query: 143 KLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADA 181
                V D   A+++ P   KC  R   A  +LG + +A
Sbjct: 138 NYRSCVADCQKAMEINPMNLKCFYRMGKAFLALGKFKEA 176

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 1/95 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKED-PVFYSNRSACYVPLNKLEKVVEDTTA 153
           A+  KD+GN+  K Q + +A + Y  A++L +   +F+SNR+  ++  +  +  + D   
Sbjct: 12  ALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDK 71

Query: 154 ALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
           AL+L     K   RR  +   L  +  A  DL  V
Sbjct: 72  ALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTV 106

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTA 153
           A+  K++GN   K++ + +AI+ Y  A+ L     +++SNR+  +  ++  +  + D   
Sbjct: 12  ALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 154 ALKLKPDYSKCLLRRATANESLGNYADAMLDLSAV 188
           A+KL P   K   RRA +  +L  +  A  DL+ +
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKAKKDLNVL 106

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 360 QNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQ--LACLA 417
           + + +A++LD   S  + +RA  +F +  F  A  D D+A + DP  +  Y +  L+C+A
Sbjct: 33  EKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMA 92

Query: 418 YREKK 422
             E K
Sbjct: 93  LLEFK 97

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 37.4 bits (85), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 98  LKDKGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTAALK 156
            K +GN+ FK+  Y  AIK Y+  +++  E+P+ YSN++   +  NK ++ V      LK
Sbjct: 6   FKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGLK 65

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 82/210 (39%), Gaps = 9/210 (4%)

Query: 338 RPNSYIYMGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFD 397
           +P ++  +G + + +   DE  + FEKA E+DP  +  Y  +   +      D A   + 
Sbjct: 508 KPQTWCSLGNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYR 567

Query: 398 KAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDF 457
           KA   DP     Y  L     +  ++++    F +AR   P    +       L      
Sbjct: 568 KAIASDPQHYNAYYGLGMCCMKLGQYEEALLYFEKARSINPVNVILICCCGVALEKMSYQ 627

Query: 458 ENALKEYDFARKLEDAQEGIHVGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRS 517
           E AL+ Y+ A +L+ +        A L+    ++AR      ++ A + FE   E  P  
Sbjct: 628 EKALQYYELASELQPSSSLAKFKKAHLL---YVMAR------YSVALENFEELAELAPDE 678

Query: 518 EQAKIGLAQLKLQQEEVDEAIKLFEAAADL 547
                 L QL        +A+K F  A +L
Sbjct: 679 ATVHFLLGQLYQIMGRKKDAVKEFTIAMNL 708

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 3/53 (5%)

Query: 98  LKDKGNECFKDQRYEEAIKFYD--CALKLKEDPVFYSNRSACYVPLNKLEKVV 148
           LK KGN  FK+  YE AI +Y+  CAL    +P+++SN +   + L + ++ V
Sbjct: 44  LKVKGNTFFKNGDYETAILYYEKACALD-SSNPIYFSNMATALIKLERWQEAV 95

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 36.6 bits (83), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTAALKL 157
           K  GN  FKD  Y +A+++Y   ++++ E+P+ YSN +   + L K  + +E     LK 
Sbjct: 7   KTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGLKY 66

Query: 158 KPD 160
             D
Sbjct: 67  VND 69

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 36.6 bits (83), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTAALKL 157
           K++GN  FK+  Y+ A + Y   + ++ E+P+ YSN++   + L +  +VVE     L  
Sbjct: 7   KEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTF 66

Query: 158 KPDYSKCLLRR 168
            P+ +  + ++
Sbjct: 67  TPNTTDTVYKK 77

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 36.2 bits (82), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 98  LKDKGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTAALK 156
           LK KGN  FK+  Y EAI +Y+  + +   +P+ YSN++   +  ++ ++ +      L+
Sbjct: 6   LKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQ 65

Query: 157 L 157
           L
Sbjct: 66  L 66

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 52/124 (41%), Gaps = 17/124 (13%)

Query: 364 KALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKF 423
           K+LE+DP  S  +YH  +++ +   +  A   F +A   D      +  +  L Y+  ++
Sbjct: 297 KSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 356

Query: 424 DDCETLFSEARRRFPTAPEVPNFYAEILSDKG--------DFENALKEYDFARKLEDAQE 475
            D    ++ A R  P       + +E+  D G           +AL  Y  A +L+   E
Sbjct: 357 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLNDALDAYKQAARLDP--E 407

Query: 476 GIHV 479
            +H+
Sbjct: 408 NVHI 411

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 36.2 bits (82), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTAALK 156
           K++GN  FK   Y EA+  YD  +  + ++PV YSN++   + L +  + ++     L+
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLR 66

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 38.1 bits (87), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 5/100 (5%)

Query: 88  EEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV-----FYSNRSACYVPLN 142
           E +  + A   K++GN+ +K +R+++A   Y  AL +K D +      Y N +AC + + 
Sbjct: 63  EGEPHEIATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIK 122

Query: 143 KLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAM 182
                +     ALKL     K   R   A   LG + D++
Sbjct: 123 NYRSCINYCREALKLNAKNVKAFFRIGKAYLELGRFEDSL 162

>ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL022C (CDC16)
          Length = 707

 Score = 38.5 bits (88), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 1/95 (1%)

Query: 370 PKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETL 429
           PKSS  ++      F I    +A K F KA   DP+  Y ++  A     E + +   + 
Sbjct: 419 PKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 478

Query: 430 FSEARRRFPTAPEVPNFYAEILSDKGDFENALKEY 464
           +S A R FP    +P+ Y  +   + D     +EY
Sbjct: 479 YSTAARFFP-GTHLPHLYLGMQYSRMDTLTLAEEY 512

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 35.8 bits (81), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTAALKL 157
           K++GNE +K   Y +AI  YD  +  + ++PV +SN++   + L +  + +E     L+L
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 158 KPDYSKCLLR 167
                   LR
Sbjct: 68  AASPQHAALR 77

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 38.5 bits (88), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 52/124 (41%), Gaps = 17/124 (13%)

Query: 364 KALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKF 423
           K+LE+DP  +  +YH  +++ V   +  A   F +A   D      +  +  L Y+  ++
Sbjct: 306 KSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 365

Query: 424 DDCETLFSEARRRFPTAPEVPNFYAEILSDKG--------DFENALKEYDFARKLEDAQE 475
            D    ++ A R  P       + +E+  D G           +AL  Y  A +L+   E
Sbjct: 366 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARLDP--E 416

Query: 476 GIHV 479
            IH+
Sbjct: 417 NIHI 420

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 37.7 bits (86), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 5/99 (5%)

Query: 88  EEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKL-----KEDPVFYSNRSACYVPLN 142
           E +  + A   K +GNE +K ++Y  A   Y+  +++     K + + + N++AC + + 
Sbjct: 67  EGEPHEIAENFKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMK 126

Query: 143 KLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADA 181
                + D   AL   P   KC  R A A  ++  Y ++
Sbjct: 127 NYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDES 165

>Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar to
           Ashbya gossypii ACR168W
          Length = 717

 Score = 38.1 bits (87), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 1/95 (1%)

Query: 370 PKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETL 429
           PKSS  ++      F I    +A K F KA   DP+  Y ++  A     E + +   + 
Sbjct: 429 PKSSVTWFAVGTYYFSINNIPEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 488

Query: 430 FSEARRRFPTAPEVPNFYAEILSDKGDFENALKEY 464
           +S A R FP    +P+ Y  +   + D     +EY
Sbjct: 489 YSTAARFFP-GTHLPHLYLGMQYSRMDTLTLAEEY 522

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 37.7 bits (86), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 72  VDQNGEPDLSGMATFT-EEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLK--EDP 128
           V+  G  +L  +     E +  + A   K++GN+ +K +RY++A   Y   +++K  +D 
Sbjct: 55  VENGGNVELEALKALAYEGEPHEVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDS 114

Query: 129 V---FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATA 171
           +    Y NR+AC + L      + D   AL       K   R   A
Sbjct: 115 INGSLYLNRAACELELRNFRSCINDCKKALNFNAKCVKAFYRMGQA 160

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 85/235 (36%), Gaps = 18/235 (7%)

Query: 366 LELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDD 425
           L LD  +  A+     ++ + +  D+A   F KA + DP   Y Y            FD+
Sbjct: 485 LTLDKYNPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDN 544

Query: 426 CETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLV 485
            ++ F +A     T               G FE AL  ++ AR L      ++V +    
Sbjct: 545 AKSCFRKALTIEKTHYNALYGLGMCCVKLGKFEEALLFFEKARALNP----VNVILNCCC 600

Query: 486 GKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAA 545
           G A    +QP       A   +ELA E  P S  A    +QL L   +   A+  FE   
Sbjct: 601 GVALERLQQPE-----RALNFYELATELQPNSSLALFKKSQLLLNMGQYSSALHNFERLE 655

Query: 546 DLS--RAFEEKLQATTFAEAAKIQK-------RIRADPVMSAKIQETLDAYRAQG 591
            L+   A    L    +    K Q         +  DP  S  I+E ++    QG
Sbjct: 656 SLTPDEAHVHFLLGNLYQIVGKKQDAMNQYTIAMNLDPKGSQLIKEAMEKCHEQG 710

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 5/89 (5%)

Query: 97  ALKDKGNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKL---EKVVEDTTA 153
           AL   G  C K  ++EEA+ F++ A  L  +PV       C V L +L   E+ +     
Sbjct: 562 ALYGLGMCCVKLGKFEEALLFFEKARAL--NPVNVILNCCCGVALERLQQPERALNFYEL 619

Query: 154 ALKLKPDYSKCLLRRATANESLGNYADAM 182
           A +L+P+ S  L +++    ++G Y+ A+
Sbjct: 620 ATELQPNSSLALFKKSQLLLNMGQYSSAL 648

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 52/127 (40%), Gaps = 12/127 (9%)

Query: 281 FTDAVEKFTAAHEANPDNAALKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPN 340
           F +A+  F  A   NP N  L     +ALE +        +P  A N  + A +L  +PN
Sbjct: 576 FEEALLFFEKARALNPVNVILNCCCGVALERL-------QQPERALNFYELATEL--QPN 626

Query: 341 SYIYM---GLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFD 397
           S + +     ++ + GQ      NFE+   L P  +  ++    +  ++ +   A   + 
Sbjct: 627 SSLALFKKSQLLLNMGQYSSALHNFERLESLTPDEAHVHFLLGNLYQIVGKKQDAMNQYT 686

Query: 398 KAKECDP 404
            A   DP
Sbjct: 687 IAMNLDP 693

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 58/123 (47%), Gaps = 17/123 (13%)

Query: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLK--EDPV---FYSNRSACYVPLNKLEKVVE 149
           A   K++ N+ +K +R++EA + Y   +++K  +D V    ++N +AC + +    + + 
Sbjct: 78  AENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNFRRCIN 137

Query: 150 DTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVSLYGGY-------SSQTIEPV 202
               AL+  P   KC  R A A   L       LD +  S+  G        S QT+E V
Sbjct: 138 LCQKALQFNPKNMKCYYRIAKAFYQLNK-----LDEAKESVKFGLTIDSENKSLQTLEGV 192

Query: 203 LER 205
           ++R
Sbjct: 193 IDR 195

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 43/210 (20%), Positives = 81/210 (38%), Gaps = 9/210 (4%)

Query: 338 RPNSYIYMGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFD 397
           +P ++  +G + + +   DE  + F+KA +LDP    AY  +      +  +D A   + 
Sbjct: 589 KPETWCAVGNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYR 648

Query: 398 KAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDF 457
           KA   D      Y  +   + +  +++     F +AR   P+   +       +   G+ 
Sbjct: 649 KAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQ 708

Query: 458 ENALKEYDFARKLEDAQEGIHVGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRS 517
           E AL  Y+ A +++          A L+          S + + +A   FE   +  P  
Sbjct: 709 EKALNYYELACQIQPTSSLAKFKRAHLLY---------SMAKYTQALDAFEELIKIAPEE 759

Query: 518 EQAKIGLAQLKLQQEEVDEAIKLFEAAADL 547
              +  L QL        +AIK +  A +L
Sbjct: 760 ATVQFILGQLYQIMGRKKDAIKRYTIAMNL 789

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 331 KAIDLFPRPNSYIY--MGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQ 388
           +AI +  R  ++ Y  +G+   ++ Q  E  + F  AL +DP    ++    Q  F   +
Sbjct: 675 EAIKMELRSTNWPYRVIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAYFACGR 734

Query: 389 FDQAGKDFDKAKECDPSRVY 408
            + + K F+KA E DP  +Y
Sbjct: 735 VEASTKVFEKAIEIDPLHLY 754

>CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189w SKI3
           antiviral protein
          Length = 1411

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 501 AEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADL 547
           AE+ + F+LA   DP   ++ IGL Q  L    V+ ++K+FE A DL
Sbjct: 696 AESIQWFQLALRIDPTDVESWIGLGQSYLNCGRVEASLKVFERALDL 742

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%)

Query: 362  FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREK 421
            F KA+ L P+     +  A ++      D A +  +KA+   P+   P++ LA L  ++ 
Sbjct: 985  FIKAMSLSPRDPTIIFAYAMLSLRCNDIDLATQLINKAQTISPAESSPWLGLALLNEKKN 1044

Query: 422  KFDDCETLFSEA 433
               +  +LFS A
Sbjct: 1045 GSSNSVSLFSHA 1056

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 35.0 bits (79), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 98  LKDKGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTAALK 156
           LK KGN  FK   YE A+ +Y  A+     +P+ YSN +   + L K  + V+     LK
Sbjct: 7   LKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGLK 66

Query: 157 L 157
           +
Sbjct: 67  M 67

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 53/124 (42%), Gaps = 17/124 (13%)

Query: 364 KALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKF 423
           K+LE+DP  +A +YH  +++ +   +  A   F +A   D      +  +  L Y+  ++
Sbjct: 296 KSLEIDPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 355

Query: 424 DDCETLFSEARRRFPTAPEVPNFYAEILSDKG--------DFENALKEYDFARKLEDAQE 475
            D    ++ A R  P       + +E+  D G           +AL  Y  A +L+   +
Sbjct: 356 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNKQLNDALDAYKQAARLDP--D 406

Query: 476 GIHV 479
            +H+
Sbjct: 407 NVHI 410

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 61/144 (42%), Gaps = 18/144 (12%)

Query: 262 GLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAIALEHVGILKFLKNE 321
           G+C L   + G YE       +++  F  AH  NP N  L     +  E +G     + +
Sbjct: 489 GMCCL---KLGQYE-------ESLLHFQKAHSINPVNVILICCCGVVFEKLG----HQQD 534

Query: 322 PLEAHNLLQKAIDLFPRPNSYIYM-GLIMADKGQADEYAQNFEKALELDPKSSAAYYHRA 380
            L+ + L   A +L P  +  ++    ++   G  +    NFEK + + P  +  ++   
Sbjct: 535 ALKYYEL---ACELQPTSSLALFKKSQLLLSMGSYNSALVNFEKLVIMAPDEATVHFLLG 591

Query: 381 QMNFVIQQFDQAGKDFDKAKECDP 404
           Q+  ++ +   A K+F  A   DP
Sbjct: 592 QLYHIVGRKKDAIKEFTVAMNLDP 615

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 85/223 (38%), Gaps = 12/223 (5%)

Query: 325 AHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNF 384
            H L+  ++D F  P ++  +G + +     DE  ++F+KA +LDP+ + AY  +     
Sbjct: 403 CHELM--SVDRFT-PQTWCCVGNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYS 459

Query: 385 VIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPTAPEVP 444
               FD A   + KA   +         L     +  ++++    F +A    P    + 
Sbjct: 460 SNDAFDTAKTCYRKALATNSQHYNASYGLGMCCLKLGQYEESLLHFQKAHSINPVNVILI 519

Query: 445 NFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAALLARQPSASNFAEAT 504
                +    G  ++ALK Y+ A +L+            L  K+ LL    S  ++  A 
Sbjct: 520 CCCGVVFEKLGHQQDALKYYELACELQPTSS------LALFKKSQLLL---SMGSYNSAL 570

Query: 505 KLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADL 547
             FE      P        L QL        +AIK F  A +L
Sbjct: 571 VNFEKLVIMAPDEATVHFLLGQLYHIVGRKKDAIKEFTVAMNL 613

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 33.9 bits (76), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 3/67 (4%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTAALK- 156
           K+ GN  FK   Y EA+  YD  +  + ++PV YSN++   + L +    ++     L+ 
Sbjct: 12  KELGNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRY 71

Query: 157 -LKPDYS 162
            L P+++
Sbjct: 72  ALGPEHA 78

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 52/126 (41%), Gaps = 17/126 (13%)

Query: 362 FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREK 421
             K+LE+DP  +  +YH  +++ +   +  A   F +A   D      +  +  L Y+  
Sbjct: 293 LSKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQIS 352

Query: 422 KFDDCETLFSEARRRFPTAPEVPNFYAEILSDKG--------DFENALKEYDFARKLEDA 473
           ++ D    ++ A R  P       + +E+  D G           +AL  Y  A +L+  
Sbjct: 353 QYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARLDP- 404

Query: 474 QEGIHV 479
            E +H+
Sbjct: 405 -ENMHI 409

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 52/124 (41%), Gaps = 17/124 (13%)

Query: 364 KALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKF 423
           K+LE+DP  +  +YH  +++ +   +  A   F +A   D      +  +  L Y+  ++
Sbjct: 289 KSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 348

Query: 424 DDCETLFSEARRRFPTAPEVPNFYAEILSDKG--------DFENALKEYDFARKLEDAQE 475
            D    ++ A R  P       + +E+  D G           +AL  Y  A +L+   E
Sbjct: 349 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLSDALDAYKQAARLDP--E 399

Query: 476 GIHV 479
            IH+
Sbjct: 400 NIHI 403

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 56/126 (44%), Gaps = 21/126 (16%)

Query: 487 KAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKL------ 540
           K A+L R  S SNFA  T   ++A + +P S +  IG+++  + Q  ++   KL      
Sbjct: 9   KLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTPKLVLSIPI 68

Query: 541 ----FEAAADLSRAFEEKL--------QATTFAEAAKI---QKRIRADPVMSAKIQETLD 585
                  A D++R+ E+++        +  T   A+K+   +  + +D V+  K+ +   
Sbjct: 69  PSTNIVTACDVARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDDVLKVKVDDQAV 128

Query: 586 AYRAQG 591
                G
Sbjct: 129 GVHVNG 134

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 78/198 (39%), Gaps = 18/198 (9%)

Query: 391 QAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEI 450
           +A K F+K  + DP+  Y Y   A     +  FD  +  F   R+   T  +  N Y  I
Sbjct: 583 EAIKAFEKVTKLDPTFTYGYTLQAHEYLSDDSFDLAKNYF---RKAVSTDSQHYNAYYGI 639

Query: 451 --LSDK-GDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAALLARQPSASNFAEATKLF 507
              S K G+FE+AL  ++ AR +  +    +V +    G A      P      +A   +
Sbjct: 640 GMCSMKLGEFEHALLYFEKARSINPS----NVILICCCGVAFEKLSYPE-----KALSYY 690

Query: 508 ELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLSRAFEEKLQATTFAEAAKIQ 567
           ELAC+  P S  AK   A L         A++ FE    L  A EE        +   I 
Sbjct: 691 ELACQVQPSSSLAKFKRAHLLYSMANYPLALECFEELTKL--APEEATVHFILGQLYNIM 748

Query: 568 KRIRADPVMSAKIQETLD 585
            R + D V    I   LD
Sbjct: 749 GR-KKDAVKEYTIAMNLD 765

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 41/101 (40%)

Query: 339 PNSYIYMGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDK 398
           P ++  +G + + +    E  + FEK  +LDP  +  Y  +A        FD A   F K
Sbjct: 565 PQTWCCLGNLFSLQKDHKEAIKAFEKVTKLDPTFTYGYTLQAHEYLSDDSFDLAKNYFRK 624

Query: 399 AKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPT 439
           A   D      Y  +   + +  +F+     F +AR   P+
Sbjct: 625 AVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSINPS 665

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 60/161 (37%), Gaps = 43/161 (26%)

Query: 354 QADEY--------AQN-FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDP 404
           QA EY        A+N F KA+  D +   AYY     +  + +F+ A   F+KA+  +P
Sbjct: 605 QAHEYLSDDSFDLAKNYFRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSINP 664

Query: 405 SRV--------------YP-----YIQLAC---------------LAYREKKFDDCETLF 430
           S V              YP     Y +LAC               L Y    +      F
Sbjct: 665 SNVILICCCGVAFEKLSYPEKALSYYELACQVQPSSSLAKFKRAHLLYSMANYPLALECF 724

Query: 431 SEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLE 471
            E  +  P    V     ++ +  G  ++A+KEY  A  L+
Sbjct: 725 EELTKLAPEEATVHFILGQLYNIMGRKKDAVKEYTIAMNLD 765

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 91/228 (39%), Gaps = 55/228 (24%)

Query: 259 LLKGLCALHARQAGSYEIADEAFTDAVE---KFTAAHEANPDNAALKQKLAIALEHVGIL 315
           L  G+  L+ R  GS E A+EAF   +E   KF  A+E       +  +L I  +H G  
Sbjct: 141 LWHGIGILYDR-YGSLEYAEEAFAKVLELDPKFDKANE-------IYFRLGIIYKHQG-- 190

Query: 316 KFLKNEPLEAHN-LLQKAIDLFPRPNSYIYMGLIMADKG--------------QADEYAQ 360
           KF  N+ L+  N +L        + + +  +G ++ + G              Q D +A+
Sbjct: 191 KF--NQALDCFNYILTNPPQPLKQWDIWFQIGNVLENIGVWENAKIAYENVLLQNDRHAK 248

Query: 361 ------------------NFEKAL-------ELDPKSSAAYYHRAQMNFVIQQFDQAGKD 395
                             N EKAL       E+D + S  +YH  +++ +   ++ A + 
Sbjct: 249 VLQQLGCLYAMNNNLNFYNPEKALNYLLRSLEVDSEDSTTWYHLGRIHMIRSDYNAAYEA 308

Query: 396 FDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPTAPEV 443
           F +A   D      +  +  L Y+  ++ D    ++ A R  P   EV
Sbjct: 309 FQQAVNRDARNPIFWCSIGVLYYQIYQYRDALDAYTRAIRLNPYISEV 356

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 93/241 (38%), Gaps = 50/241 (20%)

Query: 232 SLASFFRIFPSETSL-ENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTA 290
           S+AS        T+L   Y      D + +  L +L    A  Y   D AF  AV  +  
Sbjct: 40  SIASLAETLNDTTTLIRAYHSVLAHDPLSVTALVSL----ANFYRSTD-AFDKAVHYYEK 94

Query: 291 AHEANPDNAALKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPN-SYIYMGL-I 348
           A        AL   LA     +G    + +E  +A+N  Q+A+     PN   ++ G+ I
Sbjct: 95  A-------VALDSTLAEVWSLLGHSYLMLDELQKAYNAYQQALYHLADPNVPRLWHGIGI 147

Query: 349 MADKGQADEYAQN-FEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRV 407
           + D+  + EYA+  F K LELDPK                        FDKA E      
Sbjct: 148 LYDRYGSLEYAEEAFAKVLELDPK------------------------FDKANEI----- 178

Query: 408 YPYIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEI---LSDKGDFENALKEY 464
             Y +L  +   + KF+     F+      P   +  + + +I   L + G +ENA   Y
Sbjct: 179 --YFRLGIIYKHQGKFNQALDCFNYILTNPPQPLKQWDIWFQIGNVLENIGVWENAKIAY 236

Query: 465 D 465
           +
Sbjct: 237 E 237

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 52/124 (41%), Gaps = 17/124 (13%)

Query: 364 KALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKF 423
           K+LE+D + +  +YH  +++ +   +  A   F +A   D      +  +  L Y+  ++
Sbjct: 302 KSLEVDSQDATTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 361

Query: 424 DDCETLFSEARRRFPTAPEVPNFYAEILSDKG--------DFENALKEYDFARKLEDAQE 475
            D    ++ A R  P       + +E+  D G           +AL  Y  A +L+   E
Sbjct: 362 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLNDALDAYKQAARLDP--E 412

Query: 476 GIHV 479
            IH+
Sbjct: 413 NIHI 416

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 32.7 bits (73), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 99  KDKGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTAALK 156
           K +GN  FK   Y EA+  YD  +  + ++PV YSN++   + L +  + ++     L+
Sbjct: 12  KQQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGLQ 70

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 55/258 (21%), Positives = 88/258 (34%), Gaps = 55/258 (21%)

Query: 288 FTAAHEANPDNAALKQKLAIALEHVG---ILKFLKNEPLEAHNLLQKAIDLFPRPNSYIY 344
           F A  EA P      +  +  L H+     L  L +E LE + L          P ++  
Sbjct: 365 FMALREAQPFRLPDMEIFSTLLWHLNDTTGLSHLCHELLEVNRL---------APETWCC 415

Query: 345 MGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDP 404
           +G + + K   +E  + F+++ +LDP  + AY  +         FD A   + KA   + 
Sbjct: 416 IGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALASNS 475

Query: 405 SRVYPYIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEY 464
                Y  L   + +  ++++C   F +AR   P    +       L      E AL+ Y
Sbjct: 476 QHYNAYYGLGMCSLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQERALQNY 535

Query: 465 DFARKLEDAQEGIHVGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGL 524
           D                                           LACE  P S  A    
Sbjct: 536 D-------------------------------------------LACELQPMSSLALFKR 552

Query: 525 AQLKLQQEEVDEAIKLFE 542
           AQL L   + + A++ FE
Sbjct: 553 AQLLLAMGKYNYALESFE 570

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 360 QNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDP 404
           QN++ A EL P SS A + RAQ+   + +++ A + F+K  +  P
Sbjct: 533 QNYDLACELQPMSSLALFKRAQLLLAMGKYNYALESFEKLVKIAP 577

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 61/130 (46%), Gaps = 9/130 (6%)

Query: 445 NFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAP--LVGKAALLARQPSASNFAE 502
           N+  E+ +   ++ +A++  +   K E A+  +     P  ++G   L  +Q S     +
Sbjct: 629 NYMTEVYAKSNNWSSAVQIAERLVKAEKAKRVLQTMNWPYRVIGIGNLERQQES-----D 683

Query: 503 ATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADL--SRAFEEKLQATTF 560
           + + F+ A   DP   ++ IGL Q  L    ++ +IK+FE A +L  S  + +  ++   
Sbjct: 684 SIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELDSSHTYAKYFKSIAL 743

Query: 561 AEAAKIQKRI 570
           +E  +  + I
Sbjct: 744 SEMGEFTESI 753

>AGR398W Chr7 (1459591..1462764) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL145C (CTR9)
          Length = 1057

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 6/89 (6%)

Query: 455 GDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAALLARQPSA-SNFAEATKLFELACEK 513
           GD+E  +  Y      E +  G  VG + L   A    R   A  ++ +A  LF+ A  K
Sbjct: 308 GDYEKVISLYQ-----EISNWGYLVGTSVLSESAFWCGRAYYARQDYRKAFSLFQEALRK 362

Query: 514 DPRSEQAKIGLAQLKLQQEEVDEAIKLFE 542
           +  +  AK GL Q ++Q   V+E+I  FE
Sbjct: 363 NEDNLLAKFGLGQTQIQNNLVEESILTFE 391

>Ecym_3275 Chr3 (519806..522169) [2364 bp, 787 aa] {ON} similar to
           Ashbya gossypii AER051C
          Length = 787

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 36/67 (53%), Gaps = 7/67 (10%)

Query: 218 KLSGGEKHELPSNTSLASFFR-IFPSETSLENYDETSEADRILLKGLC-----ALHARQA 271
           K+   EK +L    SL S+FR  FPSE  + N +++SEA    L+ LC     A+  R +
Sbjct: 201 KVHPKEKFQLDVKQSLESYFRHFFPSEDRIYNLEKSSEATNA-LRVLCQKYPRAVQWRDS 259

Query: 272 GSYEIAD 278
             Y IAD
Sbjct: 260 RGYLIAD 266

>NCAS0H03540 Chr8 (672730..675012) [2283 bp, 760 aa] {ON} Anc_2.665
           YKL022C
          Length = 760

 Score = 34.7 bits (78), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 1/78 (1%)

Query: 370 PKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETL 429
           PKS+  ++  A     I+   +A K F KA   DPS    ++  A     E + D   + 
Sbjct: 466 PKSAITWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAWLGFAHTYGLEGEHDQALSA 525

Query: 430 FSEARRRFPTAPEVPNFY 447
           ++ A R FP    VPN +
Sbjct: 526 YATAARFFP-GIHVPNLF 542

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 34.7 bits (78), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%)

Query: 133 NRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADA 181
           NR+AC+  + +LEK + D T    ++P   KC +R+    + L    DA
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDA 147

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 32.7 bits (73), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 99  KDKGNECFKDQRYEEAIKFYD-CALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAAL 155
           K +GN  FK   Y  A KFYD C ++   +P+ YSN++   +     ++ +      L
Sbjct: 7   KTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGL 64

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 52/124 (41%), Gaps = 17/124 (13%)

Query: 364 KALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKF 423
           K+LE+DP  +  +YH  +++ +   +  A   F +A   D      +  +  L Y+  ++
Sbjct: 295 KSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 354

Query: 424 DDCETLFSEARRRFPTAPEVPNFYAEILSDKG--------DFENALKEYDFARKLEDAQE 475
            D    ++ A R  P       + +E+  D G           +AL  Y  A +L+   +
Sbjct: 355 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYRQASRLDP--D 405

Query: 476 GIHV 479
            +H+
Sbjct: 406 NVHI 409

>TPHA0C00900 Chr3 (188665..190770) [2106 bp, 701 aa] {ON} Anc_8.310
           YLR117C
          Length = 701

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 318 LKNEPL-EAHNLLQKAIDLFPRPNSYIYMGLIMADK-GQADEYAQNFEKALELDPKSSA 374
           +KNE +  A NLL +A+++ PR +   Y  LI+ +  G  D     F K + L+P  +A
Sbjct: 108 IKNEFINHARNLLNRAVNILPRVDKLWYKYLILEESIGNIDITRSLFNKWISLEPNVNA 166

>Kpol_1057.14 s1057 (25908..28082) [2175 bp, 724 aa] {ON}
           (25908..28082) [2175 nt, 725 aa]
          Length = 724

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 1/78 (1%)

Query: 370 PKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETL 429
           PK++  ++  A     +Q+  +A K F K+   DP+    +I  +     E + D   + 
Sbjct: 431 PKNAITWFGVATYYMTVQKISEARKYFSKSSILDPNFAPSWIGFSHTFALEGEHDQAISA 490

Query: 430 FSEARRRFPTAPEVPNFY 447
           +S A R FP    +PN +
Sbjct: 491 YSTASRFFP-GMHLPNLF 507

>KLLA0E08009g Chr5 (720700..722865) [2166 bp, 721 aa] {ON} similar
           to uniprot|P09798 Saccharomyces cerevisiae YKL022C CDC16
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
           required for sporulation
          Length = 721

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 47/106 (44%), Gaps = 8/106 (7%)

Query: 359 AQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAY 418
           A+NF       PKS   ++  A     + +  +A K F ++   DPS  Y ++  A    
Sbjct: 425 AENF-------PKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLGFAHTYV 477

Query: 419 REKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEY 464
            E + +   + +S A R FP    +P+ Y  +  ++ D  +  +EY
Sbjct: 478 AEGEHEQALSAYSTAARFFP-GTHLPHLYLGMQYNRMDDLSLAEEY 522

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 98  LKDKGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACYVPLNKLEKVVEDTTAALK 156
           LK +GN  F+   Y +A  +YD  +KL+  +P+ YSN++   +        VE     LK
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

Query: 157 LKPDYSK 163
                +K
Sbjct: 66  YTSSSTK 72

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 60/133 (45%), Gaps = 16/133 (12%)

Query: 278 DEAFTDAVEKFTAAHEANPDNAALKQKLAIALEHVG-----ILKFLKNEPLEAHNLLQKA 332
           ++AF +A   +  A   NP++      L ++   +G     +L F K   +   N++   
Sbjct: 485 NDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVILNC 544

Query: 333 IDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQA 392
                        G+ +   G+ ++    ++ A EL P SS A + ++Q+ F + Q+  A
Sbjct: 545 C-----------CGVALERLGRREKALDFYQLACELQPNSSLALFKKSQLLFNLGQYSNA 593

Query: 393 GKDFDKAKECDPS 405
            ++F+K ++  P+
Sbjct: 594 LQNFEKLEQLTPN 606

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 44/84 (52%), Gaps = 5/84 (5%)

Query: 102 GNECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKL---EKVVEDTTAALKLK 158
           G  C K  +Y+EA+  ++ A  +  +PV       C V L +L   EK ++    A +L+
Sbjct: 513 GMSCIKLGQYDEALLHFEKARSI--NPVNVILNCCCGVALERLGRREKALDFYQLACELQ 570

Query: 159 PDYSKCLLRRATANESLGNYADAM 182
           P+ S  L +++    +LG Y++A+
Sbjct: 571 PNSSLALFKKSQLLFNLGQYSNAL 594

>Skud_12.455 Chr12 complement(801256..801786) [531 bp, 176 aa] {ON}
           YLR370C (REAL)
          Length = 176

 Score = 32.7 bits (73), Expect = 1.6,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 51/105 (48%), Gaps = 12/105 (11%)

Query: 194 YSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPSNTS---LASFFRIFPSETSLENYD 250
           +S+  ++P  +R +   A+  L  K  G      PSN+    +     +F + +  +N++
Sbjct: 5   HSTFPVDPNTDRMVGNFALLPLNTKFRGPA---YPSNSDYDIIDECLDLFRANSFFKNFE 61

Query: 251 ETSEADRILLKGL-----CALHARQAGSYEIADEAFTD-AVEKFT 289
             S ADR+L+ G+     C  H + + SY  A +  T+ A++ FT
Sbjct: 62  IKSPADRVLIYGILFINDCLAHLKISTSYSEAVKVLTNVALDNFT 106

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 87/223 (39%), Gaps = 12/223 (5%)

Query: 327 NLLQKAIDLFP-RPNSYIYMGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFV 385
           +L  + ++  P +P ++  +G + + +   ++  + FEKA ++D   + AY  +   +  
Sbjct: 469 HLSNELVETLPNKPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSS 528

Query: 386 IQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPN 445
               D A   + +A  CDP     Y  L     +  ++D     F +AR   P    +  
Sbjct: 529 NDSIDTAKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNVILIC 588

Query: 446 FYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAALLARQPSA-SNFAEAT 504
                L      E AL+ Y+ A +L+ +        A L+     +AR  +A  NF E  
Sbjct: 589 CCGVALEKLSYQEKALQYYEQACELQPSSSLAKFKKAHLLYS---MARYSAALENFEELA 645

Query: 505 KLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADL 547
           KL        P        L QL        +A+K F  A +L
Sbjct: 646 KL-------APDEATVHFLLGQLYQIMGRKKDAVKEFTVAMNL 681

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 65/183 (35%), Gaps = 48/183 (26%)

Query: 341 SYIYMGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAK 400
           +Y   G   +     D     + +AL  DP+   AYY        + Q+D+A   F+KA+
Sbjct: 518 AYTLQGHEHSSNDSIDTAKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKAR 577

Query: 401 ECDPSRVYPYIQLAC-------LAYREK------------------KFDDCETLFSEAR- 434
             +P  V   I + C       L+Y+EK                  KF     L+S AR 
Sbjct: 578 NINPVNV---ILICCCGVALEKLSYQEKALQYYEQACELQPSSSLAKFKKAHLLYSMARY 634

Query: 435 -----------RRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLE--------DAQE 475
                      +  P    V     ++    G  ++A+KE+  A  L+        DA E
Sbjct: 635 SAALENFEELAKLAPDEATVHFLLGQLYQIMGRKKDAVKEFTVAMNLDPKGNPLIIDALE 694

Query: 476 GIH 478
             H
Sbjct: 695 KCH 697

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 32/171 (18%), Positives = 67/171 (39%), Gaps = 13/171 (7%)

Query: 380 AQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPT 439
            ++++ I  ++++   F++ +   P+R       + L +          L +E     P 
Sbjct: 421 GKLHYEILNYEESLNHFNQLRRMQPTRTQDIEIFSTLLWHLHDSTRLSHLSNELVETLPN 480

Query: 440 APEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGKAALLARQPSASN 499
            P+       + S + D E+A+K ++ A K++                A  L     +SN
Sbjct: 481 KPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYN-----------FAYAYTLQGHEHSSN 529

Query: 500 --FAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLS 548
                A   +  A   DP+   A  GL    ++  + D+A+  FE A +++
Sbjct: 530 DSIDTAKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNIN 580

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 34/77 (44%)

Query: 367 ELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDC 426
           E+DP  +A +YH  +++ +   +  A   F +A   D      +  +  L Y+  ++ D 
Sbjct: 307 EIDPSDAATWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 366

Query: 427 ETLFSEARRRFPTAPEV 443
              ++ A R  P   EV
Sbjct: 367 LDAYTRAIRLNPYISEV 383

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 50/124 (40%), Gaps = 17/124 (13%)

Query: 364 KALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKF 423
           K+LE DP  +  +YH  +++ +   +  A   F +A   D      +  +  L Y+  ++
Sbjct: 291 KSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 350

Query: 424 DDCETLFSEARRRFPTAPEVPNFYAEILSDKG--------DFENALKEYDFARKLEDAQE 475
            D    ++ A R  P       + +E+  D G           +AL  Y  A +L+    
Sbjct: 351 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLSDALDAYKQAARLD--VN 401

Query: 476 GIHV 479
            IH+
Sbjct: 402 NIHI 405

>KAFR0E01260 Chr5 complement(252045..254654) [2610 bp, 869 aa] {ON}
           Anc_3.265 YBR055C
          Length = 869

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 12/91 (13%)

Query: 286 EKFTAAHEANPDNAALKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYM 345
           E   A    NP++ +L  K AI LEH         EP   H ++++A+   P  N     
Sbjct: 276 ELVAAGIHLNPNSKSLWIK-AIELEH---------EPFNKHRVIKRALQELP--NDETLW 323

Query: 346 GLIMADKGQADEYAQNFEKALELDPKSSAAY 376
            L++  +   DE  +  EKA+E  P S   +
Sbjct: 324 KLVIKHENDKDEALKILEKAVEFVPDSMDLW 354

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 35/80 (43%)

Query: 364 KALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKF 423
           K+LE DP  +  +YH  +++ +   +  A   F +A   D      +  +  L Y+  ++
Sbjct: 289 KSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 348

Query: 424 DDCETLFSEARRRFPTAPEV 443
            D    ++ A R  P   EV
Sbjct: 349 RDALDAYTRAIRLNPYISEV 368

>CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {ON}
           similar to uniprot|P16522 Saccharomyces cerevisiae
           YHR166c CDC23
          Length = 639

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 75/355 (21%), Positives = 132/355 (37%), Gaps = 49/355 (13%)

Query: 180 DAMLDLSAVSLYGGYSSQTIEPVLERNMNKQAMQVLK---QKLSGGEKHELPSNTSLASF 236
           DA  D S+   +GG   ++I+    +N      ++L    Q L   + H++P N SL   
Sbjct: 173 DAADDFSS---FGGLKKKSIDDPHNKNDQSGVTEILNELDQYLEDVQSHKVPKN-SLGYA 228

Query: 237 FRIFPSETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANP 296
              +     L+  +  S A R  L+ L          Y      ++D +E  T   E+  
Sbjct: 229 LLFYLRGILLKESNSKSMAIRAYLRSL--------RIYSFNYSCWSDLLECITTVEESQ- 279

Query: 297 DNAALKQKLAIALEH-VGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQA 355
                     + L H +   +F   E + + + L+  I     P     + L    +G  
Sbjct: 280 ----------MLLSHFMSNFQFENLENINSQSKLESNI-----PFKIFQLLLFKEFQGNV 324

Query: 356 DEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLAC 415
           DEY   FE  L L P  +     +A  ++    +  + + F+K  E DP R+      + 
Sbjct: 325 DEYLTTFEDLLTLFPNFTFLQAQKALTSYQYMDYVNSEQIFEKIMEDDPYRLDDMDTFSN 384

Query: 416 LAY---REKKFDDCETLFSEARRRFP-TAPEVPNFYAEILSDKGDFENALKEYDFARKLE 471
           + Y   +  K        S+  R  P T   + N+Y    S + + E ++  +  A  L+
Sbjct: 385 ILYVMQKNAKLAYLAQFVSQIDRFRPETCCVIANYY----SARQEHEKSIMYFRRALTLD 440

Query: 472 DAQEGIHVGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQ 526
                       L+G   +  +  +A     A + +  A + DPR  +A  GL Q
Sbjct: 441 KKT----TSAWTLMGHEFVELKNSNA-----AIESYRRAVDIDPRDFRAWYGLGQ 486

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%)

Query: 359 AQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPY 410
           A+ + KA+ELD   S  + +RA  +  +  F  A  D +KA E DP  V  Y
Sbjct: 32  AELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNKAIELDPKNVKAY 83

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%)

Query: 364 KALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPS 405
           KA+ELDPK+  AY+ R      + +F++A KD        P+
Sbjct: 71  KAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIVLRAKPN 112

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 39/94 (41%), Gaps = 7/94 (7%)

Query: 364 KALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKF 423
           K+LE DP  +  +YH  +++ +   +  A   F +A   D      +  +  L Y+  ++
Sbjct: 287 KSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 346

Query: 424 DDCETLFSEARRRFPTAPEVPNFYAEILSDKGDF 457
            D    ++ A R  P       + +E+  D G  
Sbjct: 347 RDALDAYTRAIRLNP-------YISEVWYDLGTL 373

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 35/80 (43%)

Query: 364 KALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKF 423
           K+LE DP  +  +YH  +++ +   +  A   F +A   D      +  +  L Y+  ++
Sbjct: 281 KSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 340

Query: 424 DDCETLFSEARRRFPTAPEV 443
            D    ++ A R  P   EV
Sbjct: 341 RDALDAYTRAIRLNPYISEV 360

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 52/104 (50%), Gaps = 7/104 (6%)

Query: 446 FYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAP--LVGKAALLARQPSASNFAEA 503
           +  E+ ++  ++E A++  +   K E A+  +     P  ++G A L  +Q S+S     
Sbjct: 634 YITEMYTNNANWEAAVQISERLVKAEKAKRILQSTSWPYRVLGIAYLQNQQESSS----- 688

Query: 504 TKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADL 547
            + F+ A   DP   ++ +GL Q  L    ++ ++K+FE A +L
Sbjct: 689 IEWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAMEL 732

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
           (REAL)
          Length = 1424

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 2/73 (2%)

Query: 338 RPNSYIY--MGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKD 395
           R N++ +  +G+   +K +  +  + F+ AL +DP    ++    Q      + + + K 
Sbjct: 692 RSNNWPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKV 751

Query: 396 FDKAKECDPSRVY 408
           FDKA E  PS  Y
Sbjct: 752 FDKAIELQPSHTY 764

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 35/80 (43%)

Query: 364 KALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKF 423
           K+LELDP  S  +Y+  +++   + F  A +   +A   D      +  +  L Y+  + 
Sbjct: 405 KSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQIGQN 464

Query: 424 DDCETLFSEARRRFPTAPEV 443
            D    ++ A R  P   EV
Sbjct: 465 HDALDAYTRAIRLNPYISEV 484

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 36/80 (45%)

Query: 364 KALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKF 423
           K+LE+D   + ++YH  +++ +   +  A   F +A   D      +  +  L Y+  ++
Sbjct: 349 KSLEIDSTDATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQY 408

Query: 424 DDCETLFSEARRRFPTAPEV 443
            D    ++ A R  P   EV
Sbjct: 409 RDALDAYTRAIRLNPYISEV 428

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 42/204 (20%), Positives = 70/204 (34%), Gaps = 43/204 (21%)

Query: 339 PNSYIYMGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDK 398
           P ++  +G + + K   +E  + F+++ +LDP  + AY  +         FD A   + K
Sbjct: 409 PETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRK 468

Query: 399 AKECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFE 458
           A   +P     +  L     +  ++++C   F +AR   P    +       L      E
Sbjct: 469 ALGSNPQHYNAHYGLGMCCLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQE 528

Query: 459 NALKEYDFARKLEDAQEGIHVGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSE 518
            AL+ YD                                           LACE  P S 
Sbjct: 529 KALQYYD-------------------------------------------LACELQPVSS 545

Query: 519 QAKIGLAQLKLQQEEVDEAIKLFE 542
            A    AQL L   + + A++ FE
Sbjct: 546 LALFKRAQLLLAMGKYNFALENFE 569

>CAGL0L09823g Chr12 (1052444..1054675) [2232 bp, 743 aa] {ON} some
           similarities with uniprot|P09798 Saccharomyces
           cerevisiae YKL022c CDC16
          Length = 743

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 1/81 (1%)

Query: 367 ELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDC 426
           E DP++   +Y  A    ++ +  +A K F K+   DP+    ++  A     E + D  
Sbjct: 449 EKDPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQA 508

Query: 427 ETLFSEARRRFPTAPEVPNFY 447
            + +S A R FP    +PN +
Sbjct: 509 ISAYSTAARFFP-GMSLPNLF 528

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 50/115 (43%), Gaps = 28/115 (24%)

Query: 96  MALKDKGNECFKDQRYEEAIKFYDCALKL--KEDP---VFYSNRSACYVPLNKLEKVVED 150
           +  K +G+E FK+  Y  A++ Y+ +L    +  P   + YSN  A  + + +  K +ED
Sbjct: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474

Query: 151 TTAALKLKPD-----------------------YSKCLLRRATANESLGNYADAM 182
              AL L P                        +SK ++R+A + E L NY  A+
Sbjct: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLAL 529

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 98  LKDKGNECFKDQRYEEAIKFY-DCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAALK 156
           L+ KGN+ +    YE A+ +Y + +L    +PV  +N S   + L + E  +     AL+
Sbjct: 11  LRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRALE 70

Query: 157 L 157
           +
Sbjct: 71  I 71

>ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp,
           785 aa] {ON} similar to uniprot|P09798 Saccharomyces
           cerevisiae YKL022C CDC16 Subunit of the
           anaphase-promoting complex/cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition required for sporulation
          Length = 785

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 371 KSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETLF 430
           K+S  ++  A    V+++ ++A K F K+   DP+    ++  A     E + D   + +
Sbjct: 495 KNSITWFSVATYYMVVEKIEEARKYFSKSSILDPNFAPAWLGFAHTYAIEGEQDQAISAY 554

Query: 431 SEARRRFPTAPEVPNFY 447
           S A R FP    +PN +
Sbjct: 555 STAARFFP-GIHLPNLF 570

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
           (SKI3) - Contains 8 copies of the TPR domain [contig 8]
           FULL
          Length = 1410

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 33/69 (47%)

Query: 342 YIYMGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKE 401
           Y  +G+   +K    E  + F+ AL +DP    ++    Q  +   + + + K F+KA E
Sbjct: 683 YRVLGIANLEKQSESESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALE 742

Query: 402 CDPSRVYPY 410
            +P+  Y +
Sbjct: 743 VEPTSAYAH 751

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 312 VGILKFLKNEPLEAHNLLQKAIDLFPRP-NSYIYMGLIMADKGQADEYAQNFEKALELDP 370
           +GI    K    E+    Q A+ + P    S++ +G      G+ +   + FEKALE++P
Sbjct: 686 LGIANLEKQSESESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALEVEP 745

Query: 371 KSSAAYYHRA 380
            S+ A+Y +A
Sbjct: 746 TSAYAHYFKA 755

>YLR370C Chr12 complement(861718..862254) [537 bp, 178 aa] {ON}
           ARC18Subunit of the ARP2/3 complex, which is required
           for the motility and integrity of cortical actin patches
          Length = 178

 Score = 30.8 bits (68), Expect = 6.4,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 50/105 (47%), Gaps = 12/105 (11%)

Query: 194 YSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPSNTS---LASFFRIFPSETSLENYD 250
           +S+  ++P  +R +   A+  L  K  G      PSN+    +     +F + +  +N++
Sbjct: 5   HSTFPVDPNTDRMVGNFALLPLNTKFRGPA---YPSNSDYDIIDECLDLFRANSFFKNFE 61

Query: 251 ETSEADRILLKGL-----CALHARQAGSYEIADEAFTD-AVEKFT 289
             S ADR+L+ G+     C  H +   S+  A +  T+ A++ FT
Sbjct: 62  IKSPADRVLIYGILFINDCLAHLKITTSFNEAVKVLTNVALDNFT 106

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 25/121 (20%), Positives = 48/121 (39%), Gaps = 17/121 (14%)

Query: 367 ELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDC 426
           E DP  +  +YH  +++ +   +  A   F +A   D      +  +  L Y+  ++ D 
Sbjct: 279 EFDPSDATTWYHLGRIHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 338

Query: 427 ETLFSEARRRFPTAPEVPNFYAEILSDKG--------DFENALKEYDFARKLEDAQEGIH 478
              ++ A R  P       + +E+  D G           +AL  Y  A +L+   E +H
Sbjct: 339 LDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARLDP--ENVH 389

Query: 479 V 479
           +
Sbjct: 390 I 390

>ZYRO0A03036g Chr1 (245136..247739) [2604 bp, 867 aa] {ON} similar
           to uniprot|P19735 Saccharomyces cerevisiae YBR055C PRP6
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 867

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 51/124 (41%), Gaps = 14/124 (11%)

Query: 260 LKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAIALEHVGILKFLK 319
           LK LC          E+A ++F  A+E+   +   + +    K        ++  L+F +
Sbjct: 567 LKFLCL-----TDQVELAQKSFAMAMERLRDSQVPHLEKLYYK--------YISFLRFRR 613

Query: 320 NEPLEAHNLLQKAIDLFPR-PNSYIYMGLIMADKGQADEYAQNFEKALELDPKSSAAYYH 378
                   L +  I  FP  P  Y+ +G I  D GQ +E    FE+  ++ P+    +  
Sbjct: 614 QNTAAIKMLNETCIPKFPNCPKFYLQLGQIHYDLGQTEESQMAFERGTKMLPQGIPLWIS 673

Query: 379 RAQM 382
            A++
Sbjct: 674 LARI 677

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 50/124 (40%), Gaps = 17/124 (13%)

Query: 364 KALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKF 423
           K+LE+D   +  +YH  +++ V   +  A   F +A   D      +  +  L Y+  ++
Sbjct: 369 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQY 428

Query: 424 DDCETLFSEARRRFPTAPEVPNFYAEILSDKG--------DFENALKEYDFARKLEDAQE 475
            D    ++ A R  P       + +E+  D G           +AL  Y  A +L+    
Sbjct: 429 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLNDALDAYKQAARLDP--N 479

Query: 476 GIHV 479
            +H+
Sbjct: 480 NVHI 483

>Skud_11.5 Chr11 complement(10283..14143) [3861 bp, 1286 aa] {ON}
            YKL215C (REAL)
          Length = 1286

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 284  AVEKFTAAHEANPDNAALKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYI 343
             + K+  A +AN  + ++K+ LA  ++H+G  KF   + L+  +L++  +D+ P    Y+
Sbjct: 961  TILKYMTAIQANA-SESIKKMLAKMVDHLGTTKFSGEDRLDDGSLIKLQVDINPEKEEYV 1019

Query: 344  Y 344
            +
Sbjct: 1020 F 1020

>SAKL0D05390g Chr4 complement(423990..425981) [1992 bp, 663 aa] {ON}
           similar to uniprot|P32477 Saccharomyces cerevisiae
           YJL101C GSH1 Gamma glutamylcysteine synthetase catalyzes
           the first step in the gamma-glutamyl cycle for
           glutathione (GSH) biosynthesis expression induced by
           oxidants cadmium and mercury
          Length = 663

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 59/143 (41%), Gaps = 14/143 (9%)

Query: 103 NECFKDQRYEEAIKFYDCALKLKEDPVFYSNRSACYV------PLNKLEKVVEDTTAALK 156
           NE  KD   E+ +  +  A +  +DP+++ +     V        N +  V  D      
Sbjct: 19  NEHVKDNGIEQLLNIFLAANRRHDDPLYWGDELEYMVCQFNKENRNVVLSVTHDDVLTTL 78

Query: 157 LKPDYSKCLLRRATANESLGNYADAMLDLSAVSLYGGYSSQTIEPVLERNMNKQAMQVLK 216
              D + C  R    +   G +   ML+ +    Y G     +   +E+NM K+ + + +
Sbjct: 79  NTDDLALCNKRDVHFHPEYGRF---MLEATPAGPYKG----AVWDYVEKNMEKRRL-LAE 130

Query: 217 QKLSGGEKHELPSNTSLASFFRI 239
           +KL G + H+L    SL  F R+
Sbjct: 131 EKLKGYQDHDLVVPLSLTVFPRM 153

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 34/120 (28%)

Query: 99  KDKGNECFK-------DQRYEEAIKFY--DCALKLKEDPVFYSNRSACYVPLNKLEKVVE 149
           KD+G E FK        Q YE+++     + AL++    V YSN +A    + + ++ + 
Sbjct: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332

Query: 150 DTTAALKLKPD---------------------YSKCLLRRATANESLGNYADAMLDLSAV 188
           D  +AL++ P                      + K + RRA A E + NY  A+ D  ++
Sbjct: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 65/155 (41%), Gaps = 31/155 (20%)

Query: 98  LKDKGNECFKDQRYEEAIKFYDCALK-------LKEDPVFYSNRSACYVPLNKLEKVVED 150
            K+KG   F+   Y  A + Y+ +L        L+   V +SN   C + + +  + + D
Sbjct: 328 FKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRV--VSFSNIIICRLKVGEYREALSD 385

Query: 151 TTAALKLKPD-------------------YSKCLLRRATANESLGNYADAMLDLSAVSLY 191
            ++ALKL P                    +SK +  +A A E + NY  A+     +   
Sbjct: 386 ASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLIEA 445

Query: 192 GGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHE 226
           G  SS+ +E    R   ++A+ + K+ +S   K E
Sbjct: 446 GVTSSKVLE---ARRQCQKAIALEKKPVSVARKSE 477

>Smik_4.531 Chr4 complement(955033..956277) [1245 bp, 414 aa] {ON}
           YDR282C (REAL)
          Length = 414

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 35/77 (45%), Gaps = 4/77 (5%)

Query: 181 AMLDLSAVSLYGGYSSQTIEPVLERNMNKQAM--QVLKQKLSGGEKHELPSNTSLASFFR 238
            MLD +A S   G S  T   VLE  M K  +  + + + +S G K  L S+ +L S  R
Sbjct: 245 GMLDKAAFS--SGLSRSTNLAVLEEAMEKHILKTRTITENISRGTKLNLKSSDALKSIGR 302

Query: 239 IFPSETSLENYDETSEA 255
           +F     L  Y E  E 
Sbjct: 303 LFLIRGKLNLYSELIET 319

>YDR141C Chr4 complement(734901..739997) [5097 bp, 1698 aa] {ON}
           DOP1Golgi-localized, leucine-zipper domain containing
           protein; involved in endosome to Golgi transport,
           organization of the ER, establishing cell polarity, and
           morphogenesis; detected in highly purified mitochondria
           in high-throughput studies
          Length = 1698

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 71/165 (43%), Gaps = 29/165 (17%)

Query: 394 KDFDKAKECDPSRVY-------PYIQLACLAYREKKFDD---CETLFSEARRRFPTAPEV 443
           KDFD   +     +Y       P   L  L++ + K DD   CE L ++ R         
Sbjct: 516 KDFDNIYKLQKFSLYNKLLNYIPERALLPLSHSKLKHDDEVSCEELLAKIR--------- 566

Query: 444 PNFYAEILSDKGDFENALKEYDFARKLED-AQEGIHVGVAPLVGKAALLARQPSASNFAE 502
             FY  +     +  + L++ + A +L     E +   +A L+ K  LL+      N  E
Sbjct: 567 -GFYTNV----SNPSSILEKENIAERLPPFTTEDLTFLIADLIQKK-LLSSLWDLENINE 620

Query: 503 ATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADL 547
           ++KLF    EK P SE+ K G + +    +++ ++I  FEA   L
Sbjct: 621 SSKLFIAIFEKIPESEELK-GRSHISWSDKKITQSI--FEAIPRL 662

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 48/118 (40%), Gaps = 7/118 (5%)

Query: 342 YIYMGL-IMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAK 400
           Y  MG+  + D+ + D   + F+ AL +DP    ++    Q  F   + + + K F+KA 
Sbjct: 687 YRVMGISFLEDQNETDS-IEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAV 745

Query: 401 ECDPSRVYP-YIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDF 457
           E  P   Y  Y     LA    + D+ E      R      PE   F  E+ +   D+
Sbjct: 746 ELSPDHNYAKYFNSVALA----QMDEFERAIDILRHVLKDEPEKEVFKMELATQIVDY 799

>SAKL0H03168g Chr8 (296695..299076) [2382 bp, 793 aa] {ON} similar
           to uniprot|Q03128 Saccharomyces cerevisiae YDL060W TSR1
           Protein required for processing of 20S pre- rRNA in the
           cytoplasm associates with pre-40S ribosomal particles
          Length = 793

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 223 EKHELPSNTSLASFFR-IFPSETSLENYDETSEADRILLKGLCALHARQ 270
           EK +L    SL S+F+  FP+E  + N +++SEA    L+ LC  + RQ
Sbjct: 205 EKFQLDVKQSLESYFKHFFPNEDRIYNLEKSSEASNA-LRTLCQKYPRQ 252

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 50/124 (40%), Gaps = 17/124 (13%)

Query: 364 KALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKF 423
           K+LE+D   +  +YH  +++ V   +  A   F +A   D      +  +  L Y+  ++
Sbjct: 299 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQY 358

Query: 424 DDCETLFSEARRRFPTAPEVPNFYAEILSDKG--------DFENALKEYDFARKLEDAQE 475
            D    ++ A R  P       + +E+  D G           +AL  Y  A +L+    
Sbjct: 359 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARLDP--N 409

Query: 476 GIHV 479
            +H+
Sbjct: 410 NVHI 413

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,371,285
Number of extensions: 2314367
Number of successful extensions: 8642
Number of sequences better than 10.0: 245
Number of HSP's gapped: 8590
Number of HSP's successfully gapped: 418
Length of query: 594
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 479
Effective length of database: 40,294,809
Effective search space: 19301213511
Effective search space used: 19301213511
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)