Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ABL196Cna 1ON33331729e-19
Klac_YGOB_MFA1na 2ON33321071e-08
Sklu_YGOB_MFA2na 2ON33331026e-08
Ecym_6479singletonON3432982e-07
Kthe_YGOB_MFA1na 3ON3331982e-07
Kwal_YGOB_MFA1na 3ON3333965e-07
Sklu_YGOB_MFA1na 1ON3333957e-07
TBLA0J00550singletonON3430947e-07
YNL145W (MFA2)2.114ON3830948e-07
NDAI0K011702.114ON3430922e-06
NDAI0B044702.114ON3430922e-06
Kpol_1039.70na 4ON3333913e-06
Kpol_1039.70bsingletonON3333913e-06
TBLA0A01280singletonON3430903e-06
NDAI0K01420singletonON3430894e-06
Ecym_4022na 1ON3434894e-06
NCAS0G021802.114ON3430895e-06
CAGL0C01919gsingletonON3427895e-06
Suva_14.1942.114ON3827896e-06
Skud_14.1872.114ON3827887e-06
NCAS0B05140singletonON3427888e-06
Kpol_1039.70a2.114ON3333879e-06
TPHA0I012802.114ON3429861e-05
TPHA0I01275na 4ON3429861e-05
TBLA0A01750singletonON3427861e-05
TBLA0B04930singletonON3430852e-05
TBLA0A02390singletonON3425825e-05
Smik_14.1822.114ON3827818e-05
Smik_4.739na 5ON3626782e-04
Suva_2.636na 5ON3621764e-04
Skud_4.736na 5ON3631756e-04
YDR461W (MFA1)na 5ON3622757e-04
KAFR0K02130singletonON3530749e-04
KAFR0F005802.114ON3530749e-04
Klac_YGOB_MFA2singletonON3219600.12
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL196C
         (33 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL196C Chr2 complement(40215..40316) [102 bp, 33 aa] {ON} Non-s...    71   9e-19
Klac_YGOB_MFA1 Chr5 complement(1149528..1149629) [102 bp, 33 aa]...    46   1e-08
Sklu_YGOB_MFA2 Chr5 (1220858..1220959) [102 bp, 33 aa] {ON} ANNO...    44   6e-08
Ecym_6479 Chr6 (928035..928139) [105 bp, 34 aa] {ON} similar to ...    42   2e-07
Kthe_YGOB_MFA1 Chr7 (1301790..1301891) [102 bp, 33 aa] {ON} ANNO...    42   2e-07
Kwal_YGOB_MFA1 s56 complement(511414..511515) [102 bp, 33 aa] {O...    42   5e-07
Sklu_YGOB_MFA1 Chr5 (1176933..1177034) [102 bp, 33 aa] {ON} ANNO...    41   7e-07
TBLA0J00550 Chr10 complement(109603..109707) [105 bp, 34 aa] {ON}      41   7e-07
YNL145W Chr14 (352414..352530) [117 bp, 38 aa] {ON}  MFA2Mating ...    41   8e-07
NDAI0K01170 Chr11 (269630..269734) [105 bp, 34 aa] {ON}                40   2e-06
NDAI0B04470 Chr2 (1118223..1118327) [105 bp, 34 aa] {ON}               40   2e-06
Kpol_1039.70 s1039 complement(186672..186773) [102 bp, 33 aa] {O...    40   3e-06
Kpol_1039.70b s1039 complement(189037..189138) [102 bp, 33 aa] {...    40   3e-06
TBLA0A01280 Chr1 (304900..305004) [105 bp, 34 aa] {ON}                 39   3e-06
NDAI0K01420 Chr11 (325279..325383) [105 bp, 34 aa] {ON}                39   4e-06
Ecym_4022 Chr4 complement(55499..55603) [105 bp, 34 aa] {ON} sim...    39   4e-06
NCAS0G02180 Chr7 complement(390421..390525) [105 bp, 34 aa] {ON}       39   5e-06
CAGL0C01919g Chr3 complement(202384..202488) [105 bp, 34 aa] {ON...    39   5e-06
Suva_14.194 Chr14 (349190..349303) [114 bp, 38 aa] {ON} YNL145W ...    39   6e-06
Skud_14.187 Chr14 (342672..342785) [114 bp, 38 aa] {ON} YNL145W ...    39   7e-06
NCAS0B05140 Chr2 complement(956459..956563) [105 bp, 34 aa] {ON}       39   8e-06
Kpol_1039.70a s1039 complement(187909..188010) [102 bp, 33 aa] {...    38   9e-06
TPHA0I01280 Chr9 complement(292074..292178) [105 bp, 34 aa] {ON}...    38   1e-05
TPHA0I01275 Chr9 complement(290869..290973) [105 bp, 34 aa] {ON}       38   1e-05
TBLA0A01750 Chr1 (425269..425373) [105 bp, 34 aa] {ON}                 38   1e-05
TBLA0B04930 Chr2 complement(1161014..1161118) [105 bp, 34 aa] {O...    37   2e-05
TBLA0A02390 Chr1 (573085..573189) [105 bp, 34 aa] {ON}                 36   5e-05
Smik_14.182 Chr14 (331978..332091) [114 bp, 38 aa] {ON} YNL145W ...    36   8e-05
Smik_4.739 Chr4 (1306426..1306533) [108 bp, 36 aa] {ON} YDR461W ...    35   2e-04
Suva_2.636 Chr2 (1137378..1137485) [108 bp, 36 aa] {ON} YDR461W ...    34   4e-04
Skud_4.736 Chr4 (1305258..1305365) [108 bp, 36 aa] {ON} YDR461W ...    33   6e-04
YDR461W Chr4 (1385176..1385286) [111 bp, 36 aa] {ON}  MFA1Mating...    33   7e-04
KAFR0K02130 Chr11 complement(438634..438741) [108 bp, 35 aa] {ON}      33   9e-04
KAFR0F00580 Chr6 complement(119048..119155) [108 bp, 35 aa] {ON}...    33   9e-04
Klac_YGOB_MFA2 Chr3 (1339261..1339359) [99 bp, 32 aa] {ON} ANNOT...    28   0.12 

>ABL196C Chr2 complement(40215..40316) [102 bp, 33 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YNL145W (MFA2)
          Length = 33

 Score = 70.9 bits (172), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%)

Query: 1  MQLTNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          MQLTNNTNKDESTENKDNWIAKGYMWTPQCVIV
Sbjct: 1  MQLTNNTNKDESTENKDNWIAKGYMWTPQCVIV 33

>Klac_YGOB_MFA1 Chr5 complement(1149528..1149629) [102 bp, 33 aa]
          {ON} ANNOTATED BY YGOB - similar to Scer MFA1 pheromone
          Length = 33

 Score = 45.8 bits (107), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 24/32 (75%)

Query: 1  MQLTNNTNKDESTENKDNWIAKGYMWTPQCVI 32
          MQ T   +++ES ENK+NWI  G++W PQCV+
Sbjct: 1  MQPTQQASQNESAENKENWIIPGFVWVPQCVV 32

>Sklu_YGOB_MFA2 Chr5 (1220858..1220959) [102 bp, 33 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 33

 Score = 43.9 bits (102), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%)

Query: 1  MQLTNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          MQ  +N  + +S ENKDNWI +G  W PQCVI+
Sbjct: 1  MQPKSNATQKDSAENKDNWIIEGLAWNPQCVII 33

>Ecym_6479 Chr6 (928035..928139) [105 bp, 34 aa] {ON} similar to
          Ashbya gossypii ABL196C
          Length = 34

 Score = 42.4 bits (98), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 24/32 (75%)

Query: 2  QLTNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          Q + + N++  +ENKD+WI KG++W PQCVI 
Sbjct: 3  QHSKDGNQNGESENKDHWIIKGFVWNPQCVIA 34

>Kthe_YGOB_MFA1 Chr7 (1301790..1301891) [102 bp, 33 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 33

 Score = 42.4 bits (98), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/31 (64%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 3  LTNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          +T  T KD S+ENKDNWI KG  W PQCVI 
Sbjct: 4  ITQATQKD-SSENKDNWIQKGLAWDPQCVIA 33

>Kwal_YGOB_MFA1 s56 complement(511414..511515) [102 bp, 33 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 33

 Score = 41.6 bits (96), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 1  MQLTNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          MQ      +++S++NKDNWI KG  W PQCVI 
Sbjct: 1  MQPIAQATQNDSSDNKDNWIHKGLAWDPQCVIA 33

>Sklu_YGOB_MFA1 Chr5 (1176933..1177034) [102 bp, 33 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 33

 Score = 41.2 bits (95), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 1  MQLTNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          M+   +  +  STE+K+NWI KG+ W PQC+I 
Sbjct: 1  MKAATHATQKGSTEDKENWIIKGFAWDPQCIIA 33

>TBLA0J00550 Chr10 complement(109603..109707) [105 bp, 34 aa] {ON}
          
          Length = 34

 Score = 40.8 bits (94), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 20/30 (66%)

Query: 4  TNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          T  T KD S+ENKDN+I  G  W P C+IV
Sbjct: 5  TQATRKDNSSENKDNYIVPGLFWDPACIIV 34

>YNL145W Chr14 (352414..352530) [117 bp, 38 aa] {ON}  MFA2Mating
          pheromone a-factor, made by a cells; interacts with
          alpha cells to induce cell cycle arrest and other
          responses leading to mating; biogenesis involves
          C-terminal modification, N-terminal proteolysis, and
          export; also encoded by MFA1
          Length = 38

 Score = 40.8 bits (94), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 20/30 (66%)

Query: 4  TNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          T  T KD+S+E KDN+I KG  W P CVI 
Sbjct: 9  TQATQKDKSSEKKDNYIIKGLFWDPACVIA 38

>NDAI0K01170 Chr11 (269630..269734) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 40.0 bits (92), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 19/30 (63%)

Query: 4  TNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          T  T KD S+E KDN+I KG  W P CVI 
Sbjct: 5  TQATKKDNSSEKKDNYIVKGLFWDPACVIA 34

>NDAI0B04470 Chr2 (1118223..1118327) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 40.0 bits (92), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 19/30 (63%)

Query: 4  TNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          T  T KD S+E KDN+I KG  W P CVI 
Sbjct: 5  TQATKKDNSSEKKDNYIVKGLFWDPACVIA 34

>Kpol_1039.70 s1039 complement(186672..186773) [102 bp, 33 aa]
          {ON} complement(186672..186773) [102 nt, 34 aa]
          Length = 33

 Score = 39.7 bits (91), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 1  MQLTNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          MQ T    +  S+E KDN+I KG+ W P+CVIV
Sbjct: 1  MQSTTYAAQKNSSEKKDNYIVKGWFWDPECVIV 33

>Kpol_1039.70b s1039 complement(189037..189138) [102 bp, 33 aa]
          {ON} complement(189037..189138) [102 nt, 34 aa]
          Length = 33

 Score = 39.7 bits (91), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 1  MQLTNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          MQ T    +  S+E KDN+I KG+ W P+CVIV
Sbjct: 1  MQSTTYAAQKNSSEKKDNYIVKGWFWDPECVIV 33

>TBLA0A01280 Chr1 (304900..305004) [105 bp, 34 aa] {ON} 
          Length = 34

 Score = 39.3 bits (90), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 4  TNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          T  T KD S+ENKDN+I  G  W P C+I 
Sbjct: 5  TQATQKDNSSENKDNYIVPGLFWDPACIIA 34

>NDAI0K01420 Chr11 (325279..325383) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 38.9 bits (89), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 18/30 (60%)

Query: 4  TNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          T  T KD S E +DN+I KG  W P CVI 
Sbjct: 5  TEATKKDSSFEKRDNYIVKGLFWDPACVIA 34

>Ecym_4022 Chr4 complement(55499..55603) [105 bp, 34 aa] {ON}
          similar to Ashbya gossypii ABL196C MFa2
          Length = 34

 Score = 38.9 bits (89), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 1  MQLTNNTNKDES-TENKDNWIAKGYMWTPQCVIV 33
          MQ   + ++D + ++ KDNWI KGY W PQCVI 
Sbjct: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34

>NCAS0G02180 Chr7 complement(390421..390525) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 38.9 bits (89), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 4  TNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          T  T+KD S E +DN+I KG  W P CVI 
Sbjct: 5  TQATHKDNSAEKQDNYIVKGLFWDPACVIA 34

>CAGL0C01919g Chr3 complement(202384..202488) [105 bp, 34 aa] {ON}
          highly similar to uniprot|P34166 Saccharomyces
          cerevisiae YNL145w MFA2
          Length = 34

 Score = 38.9 bits (89), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 7  TNKDESTENKDNWIAKGYMWTPQCVIV 33
          T KD + E +DN+I KG+ W+P CVI 
Sbjct: 8  TQKDNTQEKRDNYIVKGFFWSPDCVIA 34

>Suva_14.194 Chr14 (349190..349303) [114 bp, 38 aa] {ON} YNL145W
          (REAL)
          Length = 38

 Score = 38.9 bits (89), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 7  TNKDESTENKDNWIAKGYMWTPQCVIV 33
          + KD+S+E KDN+I KG  W P CVI 
Sbjct: 12 SQKDKSSEKKDNYIIKGLFWDPACVIA 38

>Skud_14.187 Chr14 (342672..342785) [114 bp, 38 aa] {ON} YNL145W
          (REAL)
          Length = 38

 Score = 38.5 bits (88), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 7  TNKDESTENKDNWIAKGYMWTPQCVIV 33
          + KD S+E KDN+I KG  W P CVI 
Sbjct: 12 SQKDRSSEKKDNFIIKGLFWDPACVIA 38

>NCAS0B05140 Chr2 complement(956459..956563) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 38.5 bits (88), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 7  TNKDESTENKDNWIAKGYMWTPQCVIV 33
          + KD + ENKDN+I KG  W P CVI 
Sbjct: 8  SQKDNTAENKDNYIVKGLFWDPACVIA 34

>Kpol_1039.70a s1039 complement(187909..188010) [102 bp, 33 aa]
          {ON} complement(187909..188010) [102 nt, 34 aa]
          Length = 33

 Score = 38.1 bits (87), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 1  MQLTNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          MQ T    +  S+E KDN+I KG+ W P+CVI 
Sbjct: 1  MQSTTYAAQKNSSEKKDNYIVKGWFWDPECVIA 33

>TPHA0I01280 Chr9 complement(292074..292178) [105 bp, 34 aa] {ON}
          Anc_2.114 YNL145W
          Length = 34

 Score = 37.7 bits (86), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 19/29 (65%)

Query: 4  TNNTNKDESTENKDNWIAKGYMWTPQCVI 32
          T    KD ++E KDN+I KG  W P+CVI
Sbjct: 5  TQAIKKDTTSEKKDNYIVKGVFWDPECVI 33

>TPHA0I01275 Chr9 complement(290869..290973) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 37.7 bits (86), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 19/29 (65%)

Query: 4  TNNTNKDESTENKDNWIAKGYMWTPQCVI 32
          T    KD ++E KDN+I KG  W P+CVI
Sbjct: 5  TQAIKKDTTSEKKDNYIVKGVFWDPECVI 33

>TBLA0A01750 Chr1 (425269..425373) [105 bp, 34 aa] {ON} 
          Length = 34

 Score = 37.7 bits (86), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 7  TNKDESTENKDNWIAKGYMWTPQCVIV 33
          T K+ S+ENKDN+I  G  W P C+IV
Sbjct: 8  TQKENSSENKDNYIIPGLFWDPACIIV 34

>TBLA0B04930 Chr2 complement(1161014..1161118) [105 bp, 34 aa]
          {ON} 
          Length = 34

 Score = 37.4 bits (85), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 4  TNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          T  T K+ S+ENKDN+I  G  W P C+I 
Sbjct: 5  TQATQKENSSENKDNYIIPGLFWDPACIIA 34

>TBLA0A02390 Chr1 (573085..573189) [105 bp, 34 aa] {ON} 
          Length = 34

 Score = 36.2 bits (82), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 9  KDESTENKDNWIAKGYMWTPQCVIV 33
          K+ S+ENKDN+I  G  W P C+IV
Sbjct: 10 KETSSENKDNYIIPGLFWDPACIIV 34

>Smik_14.182 Chr14 (331978..332091) [114 bp, 38 aa] {ON} YNL145W
          (REAL)
          Length = 38

 Score = 35.8 bits (81), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 7  TNKDESTENKDNWIAKGYMWTPQCVIV 33
            K++S+E KDN+I KG  W P CVI 
Sbjct: 12 AQKNKSSEKKDNYIIKGLFWDPACVIA 38

>Smik_4.739 Chr4 (1306426..1306533) [108 bp, 36 aa] {ON} YDR461W
          (REAL)
          Length = 36

 Score = 34.7 bits (78), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 1/26 (3%)

Query: 9  KDES-TENKDNWIAKGYMWTPQCVIV 33
          KD++ TENKDN+I KG  W P CVI 
Sbjct: 11 KDKTNTENKDNYIIKGVFWDPACVIA 36

>Suva_2.636 Chr2 (1137378..1137485) [108 bp, 36 aa] {ON} YDR461W
          (REAL)
          Length = 36

 Score = 33.9 bits (76), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 15/21 (71%)

Query: 12 STENKDNWIAKGYMWTPQCVI 32
          STE KDN+I KG  W P C+I
Sbjct: 16 STEKKDNYIIKGVFWDPACII 36

>Skud_4.736 Chr4 (1305258..1305365) [108 bp, 36 aa] {ON} YDR461W
          (REAL)
          Length = 36

 Score = 33.5 bits (75), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 17/31 (54%)

Query: 3  LTNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          +T       S+E KDN+I KG  W P CVI 
Sbjct: 6  ITAAPKDKTSSEKKDNYIIKGVFWDPACVIA 36

>YDR461W Chr4 (1385176..1385286) [111 bp, 36 aa] {ON}  MFA1Mating
          pheromone a-factor, made by a cells; interacts with
          alpha cells to induce cell cycle arrest and other
          responses leading to mating; biogenesis involves
          C-terminal modification, N-terminal proteolysis, and
          export; also encoded by MFA2
          Length = 36

 Score = 33.5 bits (75), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 15/22 (68%)

Query: 12 STENKDNWIAKGYMWTPQCVIV 33
          S+E KDN+I KG  W P CVI 
Sbjct: 15 SSEKKDNYIIKGVFWDPACVIA 36

>KAFR0K02130 Chr11 complement(438634..438741) [108 bp, 35 aa] {ON}
          
          Length = 35

 Score = 33.1 bits (74), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 4  TNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          T+ T KD S+E KDN++    +W P CVI 
Sbjct: 6  TSATQKDNSSEKKDNYMVSSGVWDPVCVIA 35

>KAFR0F00580 Chr6 complement(119048..119155) [108 bp, 35 aa] {ON}
          Anc_2.114 YNL145W
          Length = 35

 Score = 33.1 bits (74), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 4  TNNTNKDESTENKDNWIAKGYMWTPQCVIV 33
          T+ T KD S+E KDN++    +W P CVI 
Sbjct: 6  TSATQKDNSSEKKDNYMVSSGVWDPVCVIA 35

>Klac_YGOB_MFA2 Chr3 (1339261..1339359) [99 bp, 32 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 32

 Score = 27.7 bits (60), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 8/19 (42%), Positives = 13/19 (68%)

Query: 14 ENKDNWIAKGYMWTPQCVI 32
          E+ D+W+  G  W P+C+I
Sbjct: 13 ESSDHWVFPGLTWNPKCII 31

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.124    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,088,102
Number of extensions: 111160
Number of successful extensions: 368
Number of sequences better than 10.0: 35
Number of HSP's gapped: 368
Number of HSP's successfully gapped: 35
Length of query: 33
Length of database: 53,481,399
Length adjustment: 8
Effective length of query: 25
Effective length of database: 52,564,071
Effective search space: 1314101775
Effective search space used: 1314101775
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)