Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ABL129W8.837ON34534512301e-170
Ecym_46088.837ON4062407981e-103
SAKL0D01540g8.837ON3652107045e-90
TDEL0B006008.837ON3692127021e-89
CAGL0M02937g8.837ON3732106984e-89
KAFR0B039008.837ON3792136812e-86
Kpol_1068.118.837ON3812146752e-85
TBLA0D032308.837ON3752146584e-83
Kwal_27.102758.837ON3792146585e-83
KLLA0D01859g8.837ON3712106577e-83
ZYRO0G14124g8.837ON3692236506e-82
Smik_13.4898.837ON3722126508e-82
NCAS0C004308.837ON3692116499e-82
KLTH0C03938g8.837ON3762206403e-80
NDAI0K004408.837ON4042156423e-80
YMR276W (DSK2)8.837ON3732126384e-80
Skud_13.4488.837ON3642126375e-80
TPHA0I002208.837ON3772216333e-79
Suva_13.4648.837ON3662136291e-78
KNAG0J002908.837ON3672225593e-68
Kpol_1036.628.311ON77731278e-09
TBLA0B032408.837ON2842161389e-09
CAGL0B01589g8.311ON77731207e-08
TPHA0C008908.311ON77731163e-07
TDEL0F043808.311ON77731153e-07
ZYRO0D05962g8.311ON77731136e-07
NDAI0J010708.311ON77731129e-07
SAKL0H15818g8.311ON77711111e-06
Kwal_27.101521.480ON381671183e-06
NCAS0B035208.311ON77711075e-06
TDEL0G017504.16ON77711041e-05
NDAI0H002704.16ON77711032e-05
KLLA0F17974g8.311ON77711013e-05
Kwal_YGOB_Anc_5.7015.701ON128711035e-05
KAFR0D022305.701ON128711025e-05
KAFR0H002205.701ON128711025e-05
Suva_11.3305.701ON128711025e-05
Skud_11.3335.701ON128711025e-05
YIL148W (RPL40A)5.701ON128711025e-05
YKR094C (RPL40B)5.701ON128711025e-05
KLTH0E01078g5.701ON128711026e-05
Suva_10.32singletonON6256986e-05
Kpol_1043.695.701ON128711026e-05
ZYRO0G06622g5.701ON128711026e-05
NDAI0E050305.701ON128711026e-05
NCAS0A032105.701ON128711026e-05
NCAS0G002405.701ON128711026e-05
SAKL0E14894g5.701ON128711026e-05
KLLA0A00616g5.701ON128711027e-05
TPHA0E002405.701ON128711027e-05
TPHA0D046005.701ON128711027e-05
TBLA0E021105.701ON128711027e-05
CAGL0G02475g5.701ON128711027e-05
Skud_9.205.701ON125561017e-05
Smik_11.3575.701ON125561017e-05
Ecym_40195.701ON128711027e-05
TDEL0B022005.701ON128711017e-05
KLTH0C03410g1.480ON391671078e-05
Smik_9.215.701ON124561018e-05
Suva_9.405.701ON144561028e-05
AFR285C5.701ON128711019e-05
KNAG0L021205.701ON128711019e-05
Ecym_41818.386ON152711029e-05
KNAG0J028804.16ON153711021e-04
Ecym_84084.16ON153711011e-04
TPHA0K022504.16ON153711011e-04
ZYRO0C04026g8.386ON152711011e-04
AGL128W8.386ON152711011e-04
Suva_10.34singletonON151561011e-04
Kwal_23.33118.386ON150711011e-04
KLTH0F08734g8.386ON150711011e-04
TPHA0C023908.386ON150711011e-04
KNAG0C065805.701ON149711001e-04
SAKL0H13926g8.386ON154711002e-04
NCAS0C029408.386ON152711002e-04
KLLA0D18304g8.386ON150711002e-04
KNAG0A027308.386ON15071992e-04
YLR167W (RPS31)8.386ON152711002e-04
NDAI0G022808.386ON15271992e-04
KAFR0H020008.386ON15271992e-04
CAGL0G08173g8.386ON15271992e-04
TDEL0F051008.386ON15071992e-04
TBLA0G006704.16ON229711013e-04
NDAI0D049304.16ON229711013e-04
KAFR0I014704.16ON229711013e-04
Kwal_55.206074.16ON231711013e-04
Suva_10.33singletonON254711023e-04
NDAI0F003005.701ON187561003e-04
YDR139C (RUB1)8.311ON7773943e-04
Kpol_1030.58.386ON15271983e-04
Kpol_1024.168.386ON15271983e-04
KLTH0E05852g4.16ON409711023e-04
SAKL0H25784g4.16ON305711014e-04
TBLA0H031808.386ON15271974e-04
Suva_10.2668.386ON15271974e-04
Skud_12.2348.386ON15271974e-04
Smik_12.2298.386ON15271974e-04
ACL062C4.16ON382711014e-04
KLTH0G12540g8.311ON7756925e-04
Skud_12.294.16ON381711015e-04
YLL039C (UBI4)4.16ON381711015e-04
Suva_10.304.16ON381711015e-04
KLLA0E00749g4.16ON381711015e-04
ZYRO0G07854g4.16ON460711015e-04
NCAS0C058504.16ON388711015e-04
Smik_12.184.16ON460711015e-04
Kpol_1070.64.16ON533711015e-04
KAFR0E005301.480ON379561006e-04
CAGL0D05082g4.16ON533711016e-04
AFR358W1.480ON41369980.001
KAFR0C030008.142ON39746980.001
NCAS0B045908.142ON44742930.005
NDAI0B01850singletonON40344920.006
Ecym_35721.480ON44369900.012
TBLA0D022108.142ON56338900.013
NDAI0G003301.480ON42758890.015
Suva_5.321.480ON40958880.017
SAKL0D11814g1.480ON40058880.018
YGL181W (GTS1)8.142ON39638880.019
Smik_7.918.142ON39938880.021
CAGL0L01309g1.480ON39258870.029
Skud_5.531.480ON39758860.032
SAKL0H24772g8.142ON41443860.032
TDEL0B046908.142ON44238860.037
CAGL0L06028g8.142ON50538850.051
Suva_7.818.142ON40138840.055
KAFR0I027801.480ON21470830.057
TPHA0O004401.480ON36958830.067
Smik_5.561.480ON39758840.068
NCAS0G041201.480ON39258820.094
YEL037C (RAD23)1.480ON39858810.13
Kpol_370.61.480ON40453760.51
KNAG0I009508.311ON110106720.52
Suva_10.31singletonON6459680.62
Skud_7.908.142ON39638750.68
TDEL0C025901.480ON36848750.71
TBLA0B021601.480ON40462750.79
NCAS0C040908.142ON39657740.91
Kpol_541.508.142ON51138741.0
KLLA0E22133g1.480ON38347731.2
Suva_2.3008.311ON8655681.2
TPHA0H004008.142ON46638731.5
ZYRO0D08140g6.343ON7347652.1
ZYRO0F05192g1.480ON38458703.2
KNAG0G005101.480ON37546693.8
ZYRO0G19096g8.142ON53638676.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL129W
         (345 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...   478   e-170
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...   311   e-103
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...   275   5e-90
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...   275   1e-89
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...   273   4e-89
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...   266   2e-86
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...   264   2e-85
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...   258   4e-83
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...   258   5e-83
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...   257   7e-83
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...   254   6e-82
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...   254   8e-82
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...   254   9e-82
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...   251   3e-80
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...   251   3e-80
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...   250   4e-80
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...   249   5e-80
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...   248   3e-79
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...   246   1e-78
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...   219   3e-68
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    54   8e-09
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    58   9e-09
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    51   7e-08
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    49   3e-07
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    49   3e-07
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    48   6e-07
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    48   9e-07
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    47   1e-06
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    50   3e-06
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    46   5e-06
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    45   1e-05
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    44   2e-05
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    44   3e-05
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    44   5e-05
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    44   5e-05
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    44   5e-05
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    44   5e-05
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    44   5e-05
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    44   5e-05
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    44   5e-05
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    44   6e-05
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    42   6e-05
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    44   6e-05
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    44   6e-05
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    44   6e-05
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    44   6e-05
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    44   6e-05
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    44   6e-05
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    44   7e-05
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    44   7e-05
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    44   7e-05
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    44   7e-05
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    44   7e-05
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     44   7e-05
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    44   7e-05
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    44   7e-05
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    44   7e-05
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    46   8e-05
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     44   8e-05
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     44   8e-05
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    44   9e-05
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    44   9e-05
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    44   9e-05
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    44   1e-04
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    44   1e-04
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    44   1e-04
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    44   1e-04
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    44   1e-04
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    44   1e-04
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    44   1e-04
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    44   1e-04
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    44   1e-04
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    43   1e-04
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    43   2e-04
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    43   2e-04
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    43   2e-04
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    43   2e-04
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    43   2e-04
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    43   2e-04
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    43   2e-04
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    43   2e-04
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    43   2e-04
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    44   3e-04
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              44   3e-04
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    44   3e-04
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    44   3e-04
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    44   3e-04
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        43   3e-04
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    41   3e-04
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    42   3e-04
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    42   3e-04
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    44   3e-04
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    44   4e-04
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    42   4e-04
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    42   4e-04
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    42   4e-04
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    42   4e-04
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    44   4e-04
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    40   5e-04
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    44   5e-04
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    44   5e-04
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    44   5e-04
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    44   5e-04
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    44   5e-04
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             44   5e-04
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    44   5e-04
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    44   5e-04
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    43   6e-04
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    44   6e-04
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    42   0.001
KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.1...    42   0.001
NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {O...    40   0.005
NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {O...    40   0.006
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    39   0.012
TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.1...    39   0.013
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    39   0.015
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    39   0.017
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    39   0.018
YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protei...    39   0.019
Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]...    39   0.021
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    38   0.029
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    38   0.032
SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]...    38   0.032
TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.1...    38   0.037
CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa] ...    37   0.051
Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]...    37   0.055
KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.48...    37   0.057
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    37   0.067
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    37   0.068
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    36   0.094
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    36   0.13 
Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON} (10094..11...    34   0.51 
KNAG0I00950 Chr9 (180436..180768) [333 bp, 110 aa] {ON} Anc_8.31...    32   0.52 
Suva_10.31 Chr10 complement(68008..68199) [192 bp, 64 aa] {ON} Y...    31   0.62 
Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W (...    33   0.68 
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    33   0.71 
TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {O...    33   0.79 
NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142     33   0.91 
Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {O...    33   1.0  
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    33   1.2  
Suva_2.300 Chr2 complement(528809..528920,529056..529204) [261 b...    31   1.2  
TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142...    33   1.5  
ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar ...    30   2.1  
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    32   3.2  
KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}...    31   3.8  
ZYRO0G19096g Chr7 complement(1584121..1585731) [1611 bp, 536 aa]...    30   6.9  

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score =  478 bits (1230), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 262/345 (75%), Positives = 262/345 (75%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY
Sbjct: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KIADGHAIHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSGGFNPLADLTGA 120
           KIADGHAIHLVK                                  QSGGFNPLADLTGA
Sbjct: 61  KIADGHAIHLVKSGGAKAAPAASAAGGESTGAAAGAGAVPSSISAGQSGGFNPLADLTGA 120

Query: 121 RYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQHP 180
           RYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQHP
Sbjct: 121 RYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQHP 180

Query: 181 HLQAMGPAAREMLQSPFFRQMLTNPDIIRQMSRLXXXXXXXXXXXXTDFXXXXXXXXXXX 240
           HLQAMGPAAREMLQSPFFRQMLTNPDIIRQMSRL            TDF           
Sbjct: 181 HLQAMGPAAREMLQSPFFRQMLTNPDIIRQMSRLQMGMGGAGAEQGTDFPAPGSAATPDA 240

Query: 241 XXXXXXXXXXIXXXXXXXXXXXXXXXXDRGLAMPPLDPAMLSSLFGAGAASPAPADNRPP 300
                     I                DRGLAMPPLDPAMLSSLFGAGAASPAPADNRPP
Sbjct: 241 AAPAPNPLAAILGLQPGAANPLGAAPADRGLAMPPLDPAMLSSLFGAGAASPAPADNRPP 300

Query: 301 EERYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLNGDV 345
           EERYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLNGDV
Sbjct: 301 EERYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLNGDV 345

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score =  311 bits (798), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 154/240 (64%), Positives = 170/240 (70%), Gaps = 11/240 (4%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M+I + VKSGQN+W+VS + S S+G LKQ IA+VS IPAENQRLIYSGKILKDDQTVESY
Sbjct: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KIADGHAIHLVK-----------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSG 109
           KIADGH+IHLV+                                             Q G
Sbjct: 61  KIADGHSIHLVRSGGGKVSGSSGATGGASGSVEAVGSGGRNSTAGSGSTVPNNITAGQMG 120

Query: 110 GFNPLADLTGARYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNP 169
           GFNPLADLTGARYAGY NLPSTDMFGPDGGLNSA+GQEEI+GML+NPIFQSQ+NEML NP
Sbjct: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLANP 180

Query: 170 QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQMSRLXXXXXXXXXXXXTDF 229
           QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQM+TNPD+IRQ+SR              DF
Sbjct: 181 QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQMDMGAANGQSTNDF 240

 Score =  117 bits (293), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 65/80 (81%), Gaps = 3/80 (3%)

Query: 269 RGLAMPPLDPAMLSSLFGAGAASPA---PADNRPPEERYEQQLRQLNDMGFFDFDRNVAA 325
           RG ++PPLDPAMLS+L   G  +       DNRPPEERY+QQL QLN+MGF DFDRNVAA
Sbjct: 327 RGFSLPPLDPAMLSALLSGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAA 386

Query: 326 LRRAGGSVQGALDALLNGDV 345
           LRR+GGSVQGAL+ALLNGDV
Sbjct: 387 LRRSGGSVQGALNALLNGDV 406

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score =  275 bits (704), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 156/210 (74%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M+I + +KSGQN+W+VS+E + +V ELK+ I+KVSEIP  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60

Query: 61  KIADGHAIHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSGGFNPLADLTGA 120
           KIAD HA+HLV+                                  Q+GGFNPLADLTGA
Sbjct: 61  KIADDHAVHLVRSGGPKPAASKSESTSATDTGAAAAAAVPSNISSGQTGGFNPLADLTGA 120

Query: 121 RYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQHP 180
           RYAGY NLPS DMFGPDGGL +A   +EI+ ML+NPI QSQMNEML+NPQM+DF+IQQ+P
Sbjct: 121 RYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQQNP 180

Query: 181 HLQAMGPAAREMLQSPFFRQMLTNPDIIRQ 210
            LQAMGP ARE+LQS +FRQM+TNPD+IRQ
Sbjct: 181 QLQAMGPRARELLQSDYFRQMMTNPDMIRQ 210

 Score =  119 bits (297), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 62/76 (81%), Gaps = 4/76 (5%)

Query: 274 PPLDPAMLSSLFGAGAASPAPA----DNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRA 329
           P  DP++LSS  G   A+P       DNRPPEERYEQQLRQLNDMGFFDFDRNVAALRR+
Sbjct: 290 PQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRS 349

Query: 330 GGSVQGALDALLNGDV 345
           GGSVQGALDALLNGDV
Sbjct: 350 GGSVQGALDALLNGDV 365

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  275 bits (702), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 133/212 (62%), Positives = 154/212 (72%), Gaps = 2/212 (0%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M+I +QVK GQ++WEVSV    +V E K EIAKVSEIPA NQRLIYSGKILKDDQ VESY
Sbjct: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60

Query: 61  KIADGHAIHLVKXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXQSGGFNPLADLT 118
           KI DGHAIHLVK                                    Q+GGFNPL+DLT
Sbjct: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT 120

Query: 119 GARYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQ 178
            ARYAG+TNLPS DMFGPDGGL +   Q++++GMLENPIFQSQMNEML+NPQM+DF+IQ 
Sbjct: 121 SARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMIQS 180

Query: 179 HPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQ 210
           +P LQAMGP AR++LQSPFFRQMLTNP ++RQ
Sbjct: 181 NPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQ 212

 Score =  120 bits (300), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 58/72 (80%), Positives = 64/72 (88%), Gaps = 1/72 (1%)

Query: 275 PLDPAMLSSLFGAGAASP-APADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGSV 333
           P DP+ML+SL G GAA   A  DNRPPEERYEQQLRQLNDMGFFDF++NVAALRR+GGSV
Sbjct: 298 PFDPSMLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAALRRSGGSV 357

Query: 334 QGALDALLNGDV 345
           QGALD+LLNGDV
Sbjct: 358 QGALDSLLNGDV 369

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score =  273 bits (698), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 132/210 (62%), Positives = 157/210 (74%), Gaps = 2/210 (0%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M+I I +KSGQN+W+VS++ S ++  LK+EIAKVSEIP+ NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESY 60

Query: 61  KIADGHAIHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSGGFNPLADLTGA 120
            I D HAIH+VK                                  Q+GGFNPLADLTGA
Sbjct: 61  NIKDDHAIHMVKSGGNASTSNAPTNANESSNSSTTAVPSNIASG--QTGGFNPLADLTGA 118

Query: 121 RYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQHP 180
           RYAGY NLPS DMFGPDGG+N+A  Q+E++ M+ENPIFQSQMNEML+NP+M+DF+IQ +P
Sbjct: 119 RYAGYANLPSADMFGPDGGINNAPDQDEMLRMMENPIFQSQMNEMLSNPEMLDFMIQSNP 178

Query: 181 HLQAMGPAAREMLQSPFFRQMLTNPDIIRQ 210
            LQAMGP AR+MLQSPFFRQMLTNP +IRQ
Sbjct: 179 QLQAMGPQARQMLQSPFFRQMLTNPAMIRQ 208

 Score =  124 bits (311), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 59/76 (77%), Positives = 64/76 (84%)

Query: 270 GLAMPPLDPAMLSSLFGAGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRA 329
           G+  P  DP +L+SL G    +PA  DNRPPEERYEQQLRQLNDMGFFDFDRNVAALRR+
Sbjct: 298 GVQQPAFDPTLLASLLGGQLPAPAQEDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRS 357

Query: 330 GGSVQGALDALLNGDV 345
           GGSVQGALDALLNGDV
Sbjct: 358 GGSVQGALDALLNGDV 373

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score =  266 bits (681), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 129/213 (60%), Positives = 153/213 (71%), Gaps = 3/213 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M+I I +KSGQN+W+V+   S S+  LK+EI+K+SEIPA NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60

Query: 61  KIADGHAIHLVKX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSGGFNPLADL 117
           KI +GH+IHLVK                                     Q+GGFNPL DL
Sbjct: 61  KIEEGHSIHLVKSGGNVARNSAATNTTPTATSNENTNSAPSVPSNIASGQTGGFNPLNDL 120

Query: 118 TGARYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQ 177
           T ARYAGY N+PS DMFGPDGGLNS   Q++++ ML+NP+FQSQMNEML+NPQMIDF+IQ
Sbjct: 121 TSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMIQ 180

Query: 178 QHPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQ 210
            +P LQAMGP AR+MLQSP FRQML NPD+IRQ
Sbjct: 181 SNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQ 213

 Score =  116 bits (291), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 63/74 (85%), Gaps = 2/74 (2%)

Query: 274 PPLDPAMLSSLFGAGAA--SPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGG 331
           P  DPA+L+S+ G   +  +PA  DNRPPEERYE QLRQLNDMGFFDFDRNVAALRR+GG
Sbjct: 306 PAFDPALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDRNVAALRRSGG 365

Query: 332 SVQGALDALLNGDV 345
           SVQGALDALLNGDV
Sbjct: 366 SVQGALDALLNGDV 379

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score =  264 bits (675), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 155/214 (72%), Gaps = 4/214 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M IKI +KSGQN+WEV+V+ S +V +LK+EIAKVSEIP ENQRLIYSGKILKDDQ +E Y
Sbjct: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60

Query: 61  KIADGHAIHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXQSGGFNPLADL 117
           KI D H+IHLVK                                     QSGGFNPL+DL
Sbjct: 61  KIQDEHSIHLVKSGGASKTNTSASAAAASTSTATNSDSNAPLPSNIAAGQSGGFNPLSDL 120

Query: 118 TGARYAGY-TNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLI 176
           T ARYAGY  NLPS DMFGPDGG+NS   Q++++ MLENP+FQSQMNEML+NPQMIDF+I
Sbjct: 121 TSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI 180

Query: 177 QQHPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQ 210
           Q +P LQAMGP AR+M QSPFFRQMLTNP++IRQ
Sbjct: 181 QSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIRQ 214

 Score =  109 bits (273), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 51/72 (70%), Positives = 57/72 (79%)

Query: 274 PPLDPAMLSSLFGAGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGSV 333
           P  DP++ +S+F          DNRPPEERYE QLRQLNDMGFFDFDRNVAALRR+GGSV
Sbjct: 310 PAFDPSLFASMFQPPQQQQQEQDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRSGGSV 369

Query: 334 QGALDALLNGDV 345
           QGALDALL+ DV
Sbjct: 370 QGALDALLSNDV 381

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score =  258 bits (658), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 151/214 (70%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           MTI + +KSGQN W+V +EAS ++ + K +IA VSEIPA NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60

Query: 61  KIADGHAIHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSGGFNPLADLTGA 120
           KI DGH+IH+VK                                  +  GFNPL+DLT A
Sbjct: 61  KIQDGHSIHMVKSGAHATASSTTNSMTTTNTTAPQNNNGSSGMSTGRGSGFNPLSDLTSA 120

Query: 121 RYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQHP 180
           RYAGYTNLPS DMFGPDGG  ++  Q++++ MLENP+FQSQMNEML+NP+++DFLI  +P
Sbjct: 121 RYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLINSNP 180

Query: 181 HLQAMGPAAREMLQSPFFRQMLTNPDIIRQMSRL 214
            LQ++GP AR M QSP FRQMLTNPD+IRQ  R+
Sbjct: 181 QLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRM 214

 Score = 94.7 bits (234), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 42/49 (85%), Positives = 47/49 (95%)

Query: 294 PADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLN 342
           P DNRPPEERYE QLRQLNDMGFFDFD+NVAALRR+GGSVQGA++ALL+
Sbjct: 325 PEDNRPPEERYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALLS 373

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score =  258 bits (658), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 151/214 (70%), Gaps = 4/214 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M+I + VKSGQ++W+VSV+A  +V + K  IA+ S+I  ENQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60

Query: 61  KIADGHAIHLVKXXXXXXXXX----XXXXXXXXXXXXXXXXXXXXXXXXXQSGGFNPLAD 116
           KI DGHA+HLVK                                      Q+GGFNPL+D
Sbjct: 61  KILDGHAVHLVKSGTKSGSGAIGAPGSGSTAPTNTASSGAAAAPASLSSGQAGGFNPLSD 120

Query: 117 LTGARYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLI 176
           LT ARYAGY NLPS D FGPDGG+ SA   ++++ MLENP+ QSQMNEML+NPQMIDFLI
Sbjct: 121 LTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFLI 180

Query: 177 QQHPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQ 210
           QQ P LQ+MGP AR+MLQSPFFRQM+TNP++IRQ
Sbjct: 181 QQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQ 214

 Score =  120 bits (300), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 59/75 (78%), Positives = 63/75 (84%), Gaps = 2/75 (2%)

Query: 273 MPPLDPAMLSSLFGAGA--ASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAG 330
           +P  DPAMLS+L G     AS  P D RPPEERYEQQLRQLNDMGFF+FDRNVAALRR+G
Sbjct: 305 LPAFDPAMLSALLGGAGNNASQQPQDTRPPEERYEQQLRQLNDMGFFEFDRNVAALRRSG 364

Query: 331 GSVQGALDALLNGDV 345
           GSVQGALDALLNGDV
Sbjct: 365 GSVQGALDALLNGDV 379

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score =  257 bits (657), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 150/210 (71%), Gaps = 2/210 (0%)

Query: 3   IKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKI 62
           I + VKSGQN W V +E++ ++   K+ I+ VS +PA+NQRLIYSGKILKD +TVESYKI
Sbjct: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63

Query: 63  ADGHAIHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSGGFNPLADLTGARY 122
            DGH++H+VK                                  Q+GGFNPLADLTGARY
Sbjct: 64  QDGHSVHMVKSGGASAATTGSTTTGSAASPAATNSAAPSNISAGQTGGFNPLADLTGARY 123

Query: 123 AGYTNLPSTDMFGPDGGLNSAVGQ--EEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQHP 180
           AG  NLPS DMFGPDGGLNS+ G   E ++ MLENPIFQSQMNEML+NPQM+DFLIQQ+P
Sbjct: 124 AGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQQNP 183

Query: 181 HLQAMGPAAREMLQSPFFRQMLTNPDIIRQ 210
            LQA+GP AR+MLQSPFFRQM+T+P +IRQ
Sbjct: 184 QLQALGPRARDMLQSPFFRQMMTDPQMIRQ 213

 Score =  112 bits (281), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 63/75 (84%), Gaps = 3/75 (4%)

Query: 274 PPLDPAMLSSLFG--AGAASPAPA-DNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAG 330
           P  +  +L+S+FG  + A   APA DNRPPEERYE QLRQLNDMGFFDFDRNVAALRRAG
Sbjct: 297 PQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAG 356

Query: 331 GSVQGALDALLNGDV 345
           GSVQGALDALLNGDV
Sbjct: 357 GSVQGALDALLNGDV 371

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score =  254 bits (650), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 124/223 (55%), Positives = 151/223 (67%), Gaps = 14/223 (6%)

Query: 2   TIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYK 61
           TI +Q+KSGQN+WEV+V+   +V   K+EI+KVSEIPA +QRLIYSGKILKDDQT++ Y 
Sbjct: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62

Query: 62  IADGHAIHLVKXXXXXXXXXXXXXXX--------------XXXXXXXXXXXXXXXXXXXQ 107
           + DGH++HLVK                                                Q
Sbjct: 63  LQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSAGQ 122

Query: 108 SGGFNPLADLTGARYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLN 167
           SGGFNPLADLT ARYAG+T+LPS DMFGPDGG  +   QE+++ ML+NPIFQSQMNEML+
Sbjct: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEMLS 182

Query: 168 NPQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQ 210
           NPQM+DF+IQ +P LQAMGP AR+M QSPFFRQMLTNP +IRQ
Sbjct: 183 NPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQ 225

 Score =  113 bits (283), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 53/69 (76%), Positives = 60/69 (86%)

Query: 277 DPAMLSSLFGAGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGA 336
           DP +L+S+ GA +    P DNRPPEERYE QLRQLN+MGFFDFDRNVAALRR+GGSVQGA
Sbjct: 301 DPQLLASMLGAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGA 360

Query: 337 LDALLNGDV 345
           LD+LLNGDV
Sbjct: 361 LDSLLNGDV 369

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score =  254 bits (650), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 148/212 (69%), Gaps = 2/212 (0%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M++ I +KSGQ++WEVSV    +V + K+ I+K + +P  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIADGHAIHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSGGFNPLADLTGA 120
            I DGH++HLVK                                  QS GFNPLADLT A
Sbjct: 61  HIQDGHSVHLVKSQPKPQPGAAAGTNNATATGAAAGTVATPNMSSGQSAGFNPLADLTSA 120

Query: 121 RYAGYTNLPSTDMFGPDGGL--NSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQ 178
           RYAGY N+PS DMFGPDGG   N +  Q+E++ M+ENPIFQSQMNEML+NPQM+DF+IQ 
Sbjct: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 179 HPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQ 210
           +P LQAMGP AR+MLQSP FRQMLTNPD+IRQ
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQ 212

 Score =  118 bits (295), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 64/79 (81%), Gaps = 3/79 (3%)

Query: 270 GLAMPPLDPAMLSSLFG---AGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAAL 326
           G  MP  DPA+L+S+F    A A +  P D RPPEERYE QLRQLNDMGFFDFDRNVAAL
Sbjct: 294 GTGMPAFDPALLASMFQPQQASAQASQPEDTRPPEERYEHQLRQLNDMGFFDFDRNVAAL 353

Query: 327 RRAGGSVQGALDALLNGDV 345
           RR+GGSVQGALD+LLNGDV
Sbjct: 354 RRSGGSVQGALDSLLNGDV 372

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  254 bits (649), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 154/211 (72%), Gaps = 5/211 (2%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M+I I VKSGQN W+VS++ + ++ +LK+EIAKVSE+PA NQRLI+SGKILKDDQTVE Y
Sbjct: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60

Query: 61  KIADGHAIHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSGGFNPLADLTGA 120
           KI DG +IH+VK                                  ++GGFNPL+DLT A
Sbjct: 61  KILDGLSIHMVKSGGGSANKNKSPPPQANTTATPVAPNMAAG----ETGGFNPLSDLTSA 116

Query: 121 RYAGYTNLPSTDMFGPDGGLN-SAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQH 179
           RYAGY NLPS D FGPDGGLN S   Q+E++ ML+NP+FQSQMNEML+NPQM+DF+IQ +
Sbjct: 117 RYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQAN 176

Query: 180 PHLQAMGPAAREMLQSPFFRQMLTNPDIIRQ 210
           P LQAMGP AR++LQ+P FRQMLTNPD+IRQ
Sbjct: 177 PQLQAMGPQARQILQNPMFRQMLTNPDMIRQ 207

 Score =  104 bits (259), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 57/72 (79%)

Query: 274 PPLDPAMLSSLFGAGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGSV 333
           P  DP+  +S+F   AA     D RPPEERYE QLRQLNDMGFFDFDRNVAALRR+GG+V
Sbjct: 298 PAFDPSFFASMFQPPAAQQQQEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGNV 357

Query: 334 QGALDALLNGDV 345
           + AL+ALLNGDV
Sbjct: 358 ESALNALLNGDV 369

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score =  251 bits (640), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 147/220 (66%), Gaps = 10/220 (4%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M+I + +KSGQN+W+V+++ S ++ + K  IA  SEI  ENQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60

Query: 61  KIADGHAIHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSG----------G 110
           KI D H++HLVK                                  QS           G
Sbjct: 61  KILDDHSVHLVKSGGSKKATSPGATAAASGDATATGATSTPAAQPQQSAPANLSTGQGNG 120

Query: 111 FNPLADLTGARYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQ 170
           FNPL+DLT ARYAG+ NLPS D FGPDGG+ SA   ++++ MLENP+ QSQMNEML+NPQ
Sbjct: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNPQ 180

Query: 171 MIDFLIQQHPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQ 210
           MIDFLIQQ P LQ+MGP AR +LQSPFFRQM+TNPD+IRQ
Sbjct: 181 MIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQ 220

 Score =  119 bits (298), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 59/73 (80%), Positives = 64/73 (87%), Gaps = 1/73 (1%)

Query: 274 PPLDPAMLSSLFG-AGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGS 332
           P LDP +LSS+ G AGAA+  P D RPPEERYE QLRQLNDMGFF+FDRNVAALRR+GGS
Sbjct: 304 PALDPMVLSSILGGAGAANQQPQDTRPPEERYEHQLRQLNDMGFFEFDRNVAALRRSGGS 363

Query: 333 VQGALDALLNGDV 345
           VQGALDALLNGDV
Sbjct: 364 VQGALDALLNGDV 376

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score =  251 bits (642), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 148/215 (68%), Gaps = 6/215 (2%)

Query: 2   TIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYK 61
           TI I +KSGQN W+VS++ + S+  LK EIAKVSEIPA NQRLIYSGKILKDDQ V+ Y 
Sbjct: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62

Query: 62  IADGHAIHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSGGFNPLADLTGAR 121
           I DGH++HLV+                                  Q+GGFNPLADLT AR
Sbjct: 63  IQDGHSVHLVRSGKKSTPTPATTNTTTNASNNTVPSNISAG----QTGGFNPLADLTSAR 118

Query: 122 YAGYT-NLPSTDMFGPDGGLN-SAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQH 179
           YAGY  NLPS D FGPDGG+N S    +E + ML+NPI QSQMNEML+NPQMIDF+IQ +
Sbjct: 119 YAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQSN 178

Query: 180 PHLQAMGPAAREMLQSPFFRQMLTNPDIIRQMSRL 214
           P LQAMGP AR+M QSP FRQMLTNPD+IRQ  +L
Sbjct: 179 PQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQL 213

 Score =  115 bits (287), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 56/77 (72%), Positives = 63/77 (81%), Gaps = 3/77 (3%)

Query: 272 AMPPLDPAMLSSLFG-AGAASPAPA--DNRPPEERYEQQLRQLNDMGFFDFDRNVAALRR 328
            +PP DP+M +SLFG AGA S  P   D RPPEERYE QLRQLNDMGFFDFDRN+AALRR
Sbjct: 328 TLPPFDPSMFASLFGGAGAPSTTPQQQDTRPPEERYETQLRQLNDMGFFDFDRNIAALRR 387

Query: 329 AGGSVQGALDALLNGDV 345
            GGSV+ A++ALLNGDV
Sbjct: 388 TGGSVEAAVNALLNGDV 404

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score =  250 bits (638), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 147/212 (69%), Gaps = 2/212 (0%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M++ I +KSGQ++WEV+V    +V + K+ I K + IP  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIADGHAIHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSGGFNPLADLTGA 120
            I DGH++HLVK                                  QS GFNPLADLT A
Sbjct: 61  HIQDGHSVHLVKSQPKPQTASAAGANNATATGAAAGTGATPNMSSGQSAGFNPLADLTSA 120

Query: 121 RYAGYTNLPSTDMFGPDGGL--NSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQ 178
           RYAGY N+PS DMFGPDGG   N +  Q+E++ M+ENPIFQSQMNEML+NPQM+DF+IQ 
Sbjct: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 179 HPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQ 210
           +P LQAMGP AR+MLQSP FRQMLTNPD+IRQ
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQ 212

 Score =  113 bits (283), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 54/73 (73%), Positives = 60/73 (82%)

Query: 273 MPPLDPAMLSSLFGAGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGS 332
           MP  DPA+L+S+F     +    D RPPEERYE QLRQLNDMGFFDFDRNVAALRR+GGS
Sbjct: 301 MPAFDPALLASMFQPPVQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGS 360

Query: 333 VQGALDALLNGDV 345
           VQGALD+LLNGDV
Sbjct: 361 VQGALDSLLNGDV 373

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score =  249 bits (637), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 120/212 (56%), Positives = 148/212 (69%), Gaps = 2/212 (0%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M++ I +KSGQ++WEV+V    +V + K+ I+K + IP  NQRLIYSGKILKDDQTV+SY
Sbjct: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60

Query: 61  KIADGHAIHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSGGFNPLADLTGA 120
            I DGH++HLVK                                  QS GFNPLADLT A
Sbjct: 61  HIQDGHSVHLVKSQPKPDAGGATGANNATATSAAVGTSATPNMSSGQSAGFNPLADLTSA 120

Query: 121 RYAGYTNLPSTDMFGPDGGL--NSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQ 178
           RYAGY N+PS DMFGPDGG   N +  Q+E++ M+ENPIFQSQMNEML+NPQM+DF+IQ 
Sbjct: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 179 HPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQ 210
           +P LQAMGP AR+MLQSP FRQMLTNP+++RQ
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQ 212

 Score =  116 bits (291), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 3/76 (3%)

Query: 273 MPPLDPAMLSSLFG---AGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRA 329
           MP  DPA+L+S+F    A A +  P D+RPPEERYE QLRQLNDMGFFDFDRNVAALRR+
Sbjct: 289 MPAFDPALLASMFQPQQASAQASQPEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRRS 348

Query: 330 GGSVQGALDALLNGDV 345
           GGSVQGALD+LLNGDV
Sbjct: 349 GGSVQGALDSLLNGDV 364

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score =  248 bits (633), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 155/221 (70%), Gaps = 7/221 (3%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M+I +Q+KSGQN+W+V+VE S ++ E K+ I+K S+IPA NQRLIYSGKILKD +TVESY
Sbjct: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60

Query: 61  KIADGHAIHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSG---GFNPLADL 117
           KI DGH+IHLVK                                   SG   GFNPLADL
Sbjct: 61  KIQDGHSIHLVKSGDASANAAKSSTAAAATANAAAGSAESAVPTNITSGQTNGFNPLADL 120

Query: 118 TGARYAGYT-NLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLI 176
           T ARYAGY   +PS DMFGPDGG+ +   Q++++ MLENP+FQSQMNEML+NPQM++++I
Sbjct: 121 TSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180

Query: 177 QQHPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQ---MSRL 214
             +P LQA+GP AREM QSPFFRQMLTNPD+IRQ   M+R+
Sbjct: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARM 221

 Score =  101 bits (251), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 57/72 (79%), Gaps = 1/72 (1%)

Query: 274 PPLDPAMLSSLFGAGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGSV 333
           P  +P+ML+S+       PA  D RPPE RYE QLRQLNDMGFF+FDRN+AALRR+GGSV
Sbjct: 307 PGFNPSMLASMLQQ-PRQPAQEDTRPPEVRYESQLRQLNDMGFFEFDRNIAALRRSGGSV 365

Query: 334 QGALDALLNGDV 345
           QGALDALLN DV
Sbjct: 366 QGALDALLNNDV 377

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score =  246 bits (629), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 148/213 (69%), Gaps = 3/213 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M++ + VKSGQ++WEVSV    +V + K+ I++ + IP  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNVYVKSGQDKWEVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIADGHAIHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-QSGGFNPLADLTG 119
            I DGH++HLVK                                   QS GFNPLADLT 
Sbjct: 61  HIQDGHSVHLVKSQPRPQAGAATGAGGDAGASATNASVSATPNMSSGQSAGFNPLADLTS 120

Query: 120 ARYAGYTNLPSTDMFGPDGGL--NSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQ 177
           ARYAGY N+PS DMFGPDGG   N +  Q+E++ M++NPIFQSQMNEML+NPQM+DF+IQ
Sbjct: 121 ARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMDNPIFQSQMNEMLSNPQMLDFMIQ 180

Query: 178 QHPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQ 210
            +P LQAMGP AR+MLQSP FRQMLTNPD+IRQ
Sbjct: 181 SNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQ 213

 Score =  111 bits (277), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 56/76 (73%), Positives = 62/76 (81%), Gaps = 3/76 (3%)

Query: 273 MPPLDPAMLSSLFGAGAASPAPA---DNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRA 329
           MP  DPA+L+S+F    A+       D RPPEERYEQQLRQLNDMGFFDFDRNVAALRR+
Sbjct: 291 MPAFDPALLASMFQPQQAAAQAPQPEDTRPPEERYEQQLRQLNDMGFFDFDRNVAALRRS 350

Query: 330 GGSVQGALDALLNGDV 345
           GGSVQGALD+LLNGDV
Sbjct: 351 GGSVQGALDSLLNGDV 366

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score =  219 bits (559), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 124/222 (55%), Positives = 143/222 (64%), Gaps = 12/222 (5%)

Query: 1   MTIKIQVKSGQNRWEVSVEAS---GSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTV 57
           M I + VK GQNRW+V+V +     +V + K+ +A V+ +P ENQRLIYSGKILKD QT+
Sbjct: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60

Query: 58  ESYKIADGHAIHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--QSGGFNPLA 115
           E YKI DGH +HLVK                                    Q  GFNPLA
Sbjct: 61  EEYKITDGHTVHLVKSGGAKSAGSSSSSSEATTAAGTAGTAPAAGASMAAGQQPGFNPLA 120

Query: 116 DLTGARYAGYT-NLPSTDMFGPDGGLNSAVGQ------EEIIGMLENPIFQSQMNEMLNN 168
           DLT ARYAGY   +PS DMFGPDGGL S  G       EEI+ MLENPIFQSQMNEM +N
Sbjct: 121 DLTSARYAGYNLPMPSADMFGPDGGLTSGGGPGGPQSQEEILSMLENPIFQSQMNEMFSN 180

Query: 169 PQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQ 210
           PQM+DFLIQ +P LQAMGP AREMLQSP FRQMLTNPD++RQ
Sbjct: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVRQ 222

 Score =  107 bits (266), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 52/60 (86%), Positives = 54/60 (90%)

Query: 286 GAGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLNGDV 345
           GA A + AP D RPPEERYEQQLRQLNDMGF DFDRNVAALRRAGGS+QGALDALLNGDV
Sbjct: 308 GATAPAAAPQDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 53.5 bits (127), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 46/73 (63%), Gaps = 5/73 (6%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGS--VGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVE 58
          M +K++  +G+   E+SVE  GS  V  +K+ + +   IP   QRLI+ GK + D+QTV+
Sbjct: 1  MYVKVKTLTGK---EISVEIQGSDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVD 57

Query: 59 SYKIADGHAIHLV 71
          S K+ DG  +HLV
Sbjct: 58 SAKLTDGMQLHLV 70

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score = 57.8 bits (138), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 92/216 (42%), Gaps = 22/216 (10%)

Query: 3   IKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKI 62
           I + +K  + ++ +  E    + ++  +I    +IP  NQRLIYSG+IL  ++T++ Y  
Sbjct: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61

Query: 63  ADGHAIHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSGGFNPLADLTGARY 122
            DGH I ++                                         P+   T    
Sbjct: 62  KDGHCIIVI----------IHKEEKNNLHPPPNNTTNLNPNNSVYPASNTPINSPTP--- 108

Query: 123 AGYTNLPSTDMFGPD------GGLNSAVGQEEIIGMLENPIFQSQMNEM-LNNPQMIDFL 175
            G  N+ +     PD        ++    + E++ +L++P    Q NEM LNN  ++ FL
Sbjct: 109 FGEGNIITITTTSPDPYGVRSNEVHDPEVERELLQVLDHP-RSFQENEMLLNNQNLLRFL 167

Query: 176 IQQHPHLQAMG-PAAREMLQSPFFRQMLTNPDIIRQ 210
           IQ +PHL+ M    AR++L+ P  ++   + + + Q
Sbjct: 168 IQTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQ 203

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 50.8 bits (120), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 45/73 (61%), Gaps = 5/73 (6%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGS--VGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVE 58
          M IK++  +G+   E+ VE SG   V  +K+ + +   IPA  QRLI+ GK + +D T+ 
Sbjct: 1  MIIKVKTLTGK---EIPVEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTIS 57

Query: 59 SYKIADGHAIHLV 71
          + K++DG  +HLV
Sbjct: 58 TAKLSDGMQLHLV 70

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 49.3 bits (116), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 44/73 (60%), Gaps = 5/73 (6%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGS--VGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVE 58
          M IK++  +G+   E+++E  GS  V  +K  + +   IP   QRLI+ GK + D+QTVE
Sbjct: 1  MQIKVKTLTGK---EIAIEVQGSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVE 57

Query: 59 SYKIADGHAIHLV 71
          S  + DG  +HLV
Sbjct: 58 SANLIDGMQLHLV 70

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 5/73 (6%)

Query: 1  MTIKIQVKSGQNRWEVSVE--ASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVE 58
          M IK++  +G+   E++VE  +   +  +KQ + +   IP   QRLI+ GK + D QT+E
Sbjct: 1  MIIKVKTLTGK---EIAVELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLE 57

Query: 59 SYKIADGHAIHLV 71
          + K+ DG  +HLV
Sbjct: 58 AAKLVDGMVLHLV 70

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 48.1 bits (113), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 5/73 (6%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGS--VGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVE 58
          M IK++  +G+   E++VE +G   +  +K+ + +   IP   QRLI+ GK + D QTV 
Sbjct: 1  MIIKVKTLTGK---EIAVELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVS 57

Query: 59 SYKIADGHAIHLV 71
          S K+ DG  +HLV
Sbjct: 58 SAKLVDGMQLHLV 70

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 47.8 bits (112), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 5/73 (6%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGS--VGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVE 58
          M IK++  +G+   E+ VE SG+  V  +K+ + +   IP   QRLI+ GK + D+Q+V 
Sbjct: 1  MIIKVKTLTGK---EIPVEISGNEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVS 57

Query: 59 SYKIADGHAIHLV 71
          S  + DG  +HLV
Sbjct: 58 SANLVDGMQLHLV 70

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M +K++  +G+    +S+E+   V  +K+ + +   IP   QRLI+ GK ++DDQTV+S 
Sbjct: 1  MELKVKTLTGKE-IPISLESHEKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSA 59

Query: 61 KIADGHAIHLV 71
           ++ G  +HLV
Sbjct: 60 NLSSGMQLHLV 70

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 3  IKIQVKSGQNR-WEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYK 61
          +KI  K  + +   + +E S +V E KQ++A+  E      +LIYSGKIL+DD+T+  YK
Sbjct: 2  VKINFKDFKKQVLALELELSSTVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYK 61

Query: 62 IADGHAI 68
          + DG  +
Sbjct: 62 LKDGDQV 68

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 45.8 bits (107), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M IK++  +G+    V ++ +  V  +K+ + +   IP   QRLI+ GK + D+QTV S 
Sbjct: 1  MIIKVKTLTGKE-IPVDIQGTDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVSSA 59

Query: 61 KIADGHAIHLV 71
           + DG  +HLV
Sbjct: 60 NLIDGMQLHLV 70

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M +K++  +G+    V V++S +V  +K+ + +   IP   Q+LI+ GK + D+ T+ S 
Sbjct: 1  MQLKVKTLTGK-EISVDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSA 59

Query: 61 KIADGHAIHLV 71
           + DG  +HLV
Sbjct: 60 DLQDGSLLHLV 70

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
          aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
          RPL40AFusion protein, identical to Rpl40Bp, that is
          cleaved to yield ubiquitin and a ribosomal protein of
          the large (60S) ribosomal subunit with similarity to
          rat L40; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes
          Length = 128

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
          128 aa] {ON}  RPL40BFusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128
          aa] {ON} highly similar to uniprot|P61864 Saccharomyces
          cerevisiae YKR094c RPL40B and highly similar to
          uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 16 VSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAIHLV 71
          + VE S ++  +K +I     IP + QRLI++GK L+D +T+  Y I     +HLV
Sbjct: 1  LEVEYSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 56

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa]
          {ON} complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128
          aa] {ON} highly similar to uniprot|P14796 Saccharomyces
          cerevisiae YKR094C RPL40B
          Length = 128

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634)
          [387 bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
          [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
          Saccharomyces cerevisiae YLR167W RPS31 and highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YIL148W and highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094C and highly similar to
          uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
          proteins that are cleaved to yield a ribosomal protein
          of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YKR094C RPL40B Fusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083)
          [387 bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387
          bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
          bp, 128 aa] {ON} highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C
          (REAL)
          Length = 125

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAIHLV 71
          + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y I     +HLV
Sbjct: 12 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa]
          {ON} YKR094C (REAL)
          Length = 125

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAIHLV 71
          + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y I     +HLV
Sbjct: 12 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
          similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 3  IKIQVKSGQNR-WEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYK 61
          +KI  K  + +   + +++  ++ E KQ +A+  +      +LIYSGKIL+DD+T+  YK
Sbjct: 2  VKINFKDFKKQVLALELDSGSTISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYK 61

Query: 62 IADGHAI 68
          + DG  +
Sbjct: 62 LNDGDQV 68

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C
          (REAL)
          Length = 124

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAIHLV 71
          + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y I     +HLV
Sbjct: 11 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 66

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W
          (REAL)
          Length = 144

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAIHLV 71
          + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y I     +HLV
Sbjct: 31 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 86

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp,
          128 aa] {ON} Syntenic homolog of Saccharomyces
          cerevisiae YKR094C (RPL40B) and YIL148W (RPL40A);
          1-intron
          Length = 128

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
          bp, 128 aa] {ON} 
          Length = 128

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
          Ashbya gossypii ACL062C
          Length = 153

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAIHLV 71
          + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y I     +HLV
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAIHLV 71
           + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y I     +HLV
Sbjct: 91  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304)
          [450 bp, 149 aa] {ON} 
          Length = 149

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
          YLL039C
          Length = 229

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
          YIL148W
          Length = 229

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa]
          {ON} YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16  VSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAIHLV 71
           + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y I     +HLV
Sbjct: 74  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 129

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 5/73 (6%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGS--VGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVE 58
          M +K++  +G+   E+SVE   S  V  +K+ + +   IP   QRLI+ GK + D  TV 
Sbjct: 1  MIVKVKTLTGK---EISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVT 57

Query: 59 SYKIADGHAIHLV 71
             + +G  +HLV
Sbjct: 58 DAHLVEGMQLHLV 70

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 105 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 163

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 164 NIQKESTLHLV 174

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 181 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 239

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 240 NIQKESTLHLV 250

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 257 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 315

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 316 NIQKESTLHLV 326

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 333 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 391

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 392 NIQKESTLHLV 402

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039c UBI4 ubiquitin
          Length = 305

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLL039C
          (UBI4)
          Length = 382

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 364 NIQKESTLHLV 374

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 40.0 bits (92), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 32/56 (57%)

Query: 16 VSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAIHLV 71
          V V+    V  +K+ + +   IP   QRLI+ GK + DD++V S  ++ G  +HLV
Sbjct: 15 VVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSANLSSGMQLHLV 70

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
          381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 364 NIQKESTLHLV 374

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
          UBI4Ubiquitin, becomes conjugated to proteins, marking
          them for selective degradation via the ubiquitin-26S
          proteasome system; essential for the cellular stress
          response; encoded as a polyubiquitin precursor
          comprised of 5 head-to-tail repeats
          Length = 381

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 364 NIQKESTLHLV 374

>Suva_10.30 Chr10
          complement(67747..67841,68061..68288,68558..69013,
          69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++ K L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDY 363

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 364 NIQKESTLHLV 374

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 364 NIQKESTLHLV 374

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 440 NIQKESTLHLV 450

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 364 NIQKESTLHLV 374

>Smik_12.18 Chr12
          complement(49088..49552,49091..49552,49091..49546)
          [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 155 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 213

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 214 NIQKESTLHLV 224

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 231 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 289

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 290 NIQKESTLHLV 300

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 309 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 367

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 368 NIQKESTLHLV 378

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 385 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 443

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 444 NIQKESTLHLV 454

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
          complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 440 NIQKESTLHLV 450

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 457 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 515

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 516 NIQKESTLHLV 526

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 35/56 (62%)

Query: 16 VSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAIHLV 71
          V +E+S ++ + K ++A +     +  +LI+SGK+LKDDQTV S  + D   + ++
Sbjct: 15 VELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCGLKDNDQVIMM 70

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
          to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
          ubiquitin
          Length = 533

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIADGHAIHLV 71
           I     +HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 440 NIQKESTLHLV 450

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60
           M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L+D +T+  Y
Sbjct: 457 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 515

Query: 61  KIADGHAIHLV 71
            I     +HLV
Sbjct: 516 NIQKESTLHLV 526

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 1  MTIKIQVKS-GQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVES 59
          M I I  K   + R  + +  S ++ E KQ +A+  +      ++I+SGK+L+D  T+E 
Sbjct: 1  MNITIHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEG 60

Query: 60 YKIADGHAI 68
           K+ DG  +
Sbjct: 61 CKLKDGDQV 69

>KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.142
           YGL181W
          Length = 397

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 32/46 (69%)

Query: 295 ADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 340
           +D+   E  Y +Q+RQL +MGF D ++N+ AL+++ G++  A+D L
Sbjct: 181 SDDDRYESDYRRQVRQLKEMGFSDSEKNLKALKKSNGNMNRAIDVL 226

>NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {ON}
           Anc_8.142 YGL181W
          Length = 447

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%)

Query: 303 RYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLNGD 344
           +Y +QLR L DMGF D D NV AL    G++   ++ L + +
Sbjct: 155 KYSRQLRSLKDMGFNDVDNNVEALNICNGNINKTINILTSNE 196

>NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {ON} 
          Length = 403

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 28/44 (63%), Gaps = 2/44 (4%)

Query: 303 RYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALL--NGD 344
           +Y ++LR+L +MGF D D N  AL  A G + GA+D L   NGD
Sbjct: 166 KYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDILTQDNGD 209

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa]
          {ON} similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 1  MTIKIQVKS-GQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVES 59
          M I I  K   + +  + +  + ++ E KQ +AK  +      ++I+SGK+L+D  T+++
Sbjct: 1  MHITINFKDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDA 60

Query: 60 YKIADGHAI 68
           K+ DG  +
Sbjct: 61 CKLKDGDQV 69

>TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.142
           YGL181W
          Length = 563

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%)

Query: 303 RYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 340
           +Y +QL++LNDMGF + D N  AL  + G +  ALD L
Sbjct: 219 KYSRQLKELNDMGFTNTDNNAEALSISRGDINRALDLL 256

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 35/58 (60%)

Query: 11 QNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAI 68
          + +  + +E S ++ ++K ++A+         ++IYSGK+L+D QTVE  ++ +G  I
Sbjct: 11 KEKIPLDLEPSNTILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEECQLKEGDQI 68

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (56%)

Query: 11 QNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAI 68
          + +  + +E S ++ E K ++A+ S       +LIYSGK+L+D +TV    + DG  +
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 35/58 (60%)

Query: 11 QNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAI 68
          + +  + ++ + +V + KQ++A       +  +LI+SGK+L+D +T+E  K+ DG  +
Sbjct: 11 KEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECKLKDGDQV 68

>YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protein
           involved in Arf3p regulation and in transcription
           regulation; localizes to the nucleus and to endocytic
           patches; contains an N-terminal Zn-finger and ArfGAP
           homology domain, a C-terminal glutamine-rich region, and
           a UBA (ubiquitin associated) domain; gts1 mutations
           affect budding, cell size, heat tolerance, sporulation,
           life span, ultradian rhythms, endocytosis; expression
           oscillates in a pattern similar to metabolic
           oscillations
          Length = 396

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%)

Query: 303 RYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 340
           RY +QL +L DMGF D ++N+ AL  A G++  A+D L
Sbjct: 194 RYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYL 231

>Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]
           {ON} YGL181W (REAL)
          Length = 399

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%)

Query: 303 RYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 340
           RY +QL +L DMGF D ++N+ AL  A G++  A+D L
Sbjct: 196 RYSRQLLELRDMGFSDANKNLDALSSAHGNINRAIDYL 233

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 35/58 (60%)

Query: 11 QNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAI 68
          + ++ + +E+S S+  +K+ +++         +LI+SGK+LKD  +VES    DG+ +
Sbjct: 11 KEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCNFKDGNEV 68

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 33/58 (56%)

Query: 11 QNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAI 68
          + +  + +E S ++ E K ++A+ +       +LIYSGK+L+D +TV    + DG  +
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 414

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 303 RYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLNGDV 345
           R+  QLR L ++G+ D D NV AL  A G +  ALD +L  DV
Sbjct: 184 RHSHQLRNLKELGYLDTDSNVEALVLARGDINLALD-ILEADV 225

>TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.142
           YGL181W
          Length = 442

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%)

Query: 303 RYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 340
           RY ++LR L +MG+ D D N  AL  A G +  A+D L
Sbjct: 193 RYSRELRTLKEMGYDDIDHNAEALSHAHGDLNRAIDIL 230

>CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181w GTS1
          Length = 505

 Score = 37.4 bits (85), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%)

Query: 303 RYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 340
           +Y ++LRQL ++GF +  +N+ A+  + G V GALD L
Sbjct: 211 KYGRELRQLRELGFTNEQKNIDAITYSHGDVNGALDYL 248

>Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]
           {ON} YGL181W (REAL)
          Length = 401

 Score = 37.0 bits (84), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%)

Query: 303 RYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 340
           RY +QL +L DMGF D ++N+ AL  A G++  A+D L
Sbjct: 194 RYSRQLAELRDMGFNDKNKNLDALSSAHGNLSRAIDYL 231

>KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.480
          YEL037C
          Length = 214

 Score = 36.6 bits (83), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQR--LIYSGKILKDDQTVE 58
          M + I+    +++++++   + +V +LK  I K  ++        LIYSGK+L+DD T+ 
Sbjct: 1  MKLYIKDPRTRSKFQLNGTVNDTVRDLKHHIVKSHKLVCHTDEISLIYSGKLLQDDATLN 60

Query: 59 SYKIADGHAI 68
          S  + D   I
Sbjct: 61 SLHLKDNAQI 70

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 36.6 bits (83), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 33/58 (56%)

Query: 11 QNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAI 68
          + +  + + AS +V   K+++A+  E      +LIYSGK+L+D  ++E   + DG  +
Sbjct: 11 KQKISLDLPASSTVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSIEGCGLKDGDQV 68

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 33/58 (56%)

Query: 11 QNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAI 68
          + +  + +E S ++ E+K ++A+         +LIYSGK+L+D +TV    + DG  +
Sbjct: 11 KEKVPLDLEPSNTIFEVKSKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 36.2 bits (82), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 35/58 (60%)

Query: 11 QNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAI 68
          + +  +++E++ +V + K ++A+         +LIYSGK+L+D +T+E   + DG  +
Sbjct: 11 KEKIPLALESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLEDCGLKDGDQV 68

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 32/58 (55%)

Query: 11 QNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAI 68
          + +  + +E S ++ E K ++A+         +LIYSGK+L+D +TV    + DG  +
Sbjct: 11 KEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON}
          (10094..11308) [1215 nt, 405 aa]
          Length = 404

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%)

Query: 16 VSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAI 68
          + +E S +V + K++IA   +      +LIYSGK+L++D T+    + DG  +
Sbjct: 16 LDLEGSVTVLDAKKQIAVKKDCEDSQIKLIYSGKVLQNDSTIGDCGLKDGDQV 68

>KNAG0I00950 Chr9 (180436..180768) [333 bp, 110 aa] {ON} Anc_8.311
           YDR139C
          Length = 110

 Score = 32.3 bits (72), Expect = 0.52,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 38/106 (35%)

Query: 1   MTIKIQVKSGQNRWEVSVEASGS-----VGELKQE------IAKVSEIPAENQ------- 42
           M +K++  +G+   E+ VE   S     V EL +E      IA  ++IP E         
Sbjct: 1   MIVKVKTLTGK---EIPVELEASDKVYRVKELLEEKRRDPTIAAETDIPGETNVCVKWVP 57

Query: 43  --------------RLIYSGKILK---DDQTVESYKIADGHAIHLV 71
                         R+ Y+ K++    D+QT+ S K+ DG  +HLV
Sbjct: 58  VGLTCLTRSLFFLLRISYTNKLISHSDDEQTISSAKLVDGMQLHLV 103

>Suva_10.31 Chr10 complement(68008..68199) [192 bp, 64 aa] {ON}
          YLR167W (REAL)
          Length = 64

 Score = 30.8 bits (68), Expect = 0.62,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVES 59
          M I ++  +G+    + VE+S ++  +K +I     IP + QRLI++GK L  ++  ++
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLGMEELCQT 58

>Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W
           (REAL)
          Length = 396

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 303 RYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 340
           RY +QL +L DMG+ D  +N+ AL  A G++  ++D L
Sbjct: 194 RYSRQLIELRDMGYNDTAKNLDALSFAHGNINRSIDYL 231

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa]
          {ON} Anc_1.480 YEL037C
          Length = 368

 Score = 33.5 bits (75), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 29/48 (60%)

Query: 21 SGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAI 68
          S SV + K ++A+  E      +LIYSGK+L+D ++++   + DG  +
Sbjct: 21 SSSVLDAKVQLAQKKECEEGQIKLIYSGKVLQDSKSLQESGLKDGDQV 68

>TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa]
          {ON} Anc_1.480 YEL037C
          Length = 404

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 11 QNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADG-HAIH 69
          + +  + ++A  ++   K +IA       +  +LIYSGKILK+D T+ +  + D  H I 
Sbjct: 11 KEKIPLELDADSTIESAKGQIASEKNCDIDQIKLIYSGKILKNDATILNSGLKDNDHIIF 70

Query: 70 LV 71
          ++
Sbjct: 71 MI 72

>NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142
          Length = 396

 Score = 33.1 bits (74), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 285 FGAGAASPAPADNRPPEERYEQQLRQLNDMGF-FDFDRNVAALRRAGGSVQGALDAL 340
           +  G+    P D+R    +Y +QL +L DMG+  D  R   AL R  G +  +LD +
Sbjct: 180 YHGGSNRHHPHDSRHGRFKYSRQLNELRDMGYSTDTQRIKDALERTHGDINRSLDII 236

>Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {ON}
           complement(162130..163665) [1536 nt, 512 aa]
          Length = 511

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 303 RYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 340
           RY ++L +L +MGF D D N  A+  A G +  A+  L
Sbjct: 233 RYSRELNRLREMGFNDIDNNAEAMSLANGDISRAITIL 270

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 383

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%)

Query: 22 GSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAI 68
           ++   K+ IA+  +  A   +LIY+GKIL+D +TV    + +G  +
Sbjct: 21 ATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCNLKEGDQV 67

>Suva_2.300 Chr2 complement(528809..528920,529056..529204) [261
          bp, 86 aa] {ON} YDR139C (REAL)
          Length = 86

 Score = 30.8 bits (68), Expect = 1.2,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 1  MTIKIQVKSGQNRWEVSVEASGS--VGELKQEIAKVSEIPAENQRLIYSGKILKD 53
          M +K++  +G+   E+SVE   S  V  +K+ + +   IP   QRLI+ GK + D
Sbjct: 1  MIVKVKTLTGK---EISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIVD 52

>TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142
           YGL181W
          Length = 466

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 303 RYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 340
           +Y + ++ L  MG+ D D N  AL  A G +  A+D L
Sbjct: 227 KYSRHIKNLEQMGYTDIDNNAEALSIAHGDINQAIDIL 264

>ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar
          to uniprot|Q6Q546 Saccharomyces cerevisiae YNR032C-A
          HUB1
          Length = 73

 Score = 29.6 bits (65), Expect = 2.1,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 26/47 (55%)

Query: 24 VGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAIHL 70
          VG+ K+ ++     PA   +L+  G ILKD  +++ Y+I D   + L
Sbjct: 24 VGDFKKILSVQIGTPASKIQLVKGGSILKDHISLDDYEIHDNTFLEL 70

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 384

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 30/58 (51%)

Query: 11 QNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKIADGHAI 68
          + +  + ++ S SV + K  +A          +LIYSGK+L+D + ++   + DG  +
Sbjct: 11 KEKISLELDPSSSVKDAKVRLATEKSCEESQIKLIYSGKVLQDAKNLQESGLKDGDQV 68

>KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}
          Anc_1.480 YEL037C
          Length = 375

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 8  KSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKD 53
          K  +   +V +E   SV ++K+++A   +  AE  +LI+SGK+L+D
Sbjct: 10 KKNKETLDVDLEHE-SVKDVKEKLAAARDCDAEQIKLIFSGKVLQD 54

>ZYRO0G19096g Chr7 complement(1584121..1585731) [1611 bp, 536 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 536

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 20/38 (52%)

Query: 303 RYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL 340
           RY ++LR L D G+   D N  AL  A G V  A+  L
Sbjct: 210 RYSRELRILRDRGYPSIDNNAEALSLAKGDVSRAMAIL 247

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,187,448
Number of extensions: 915725
Number of successful extensions: 2936
Number of sequences better than 10.0: 152
Number of HSP's gapped: 2967
Number of HSP's successfully gapped: 250
Length of query: 345
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 235
Effective length of database: 40,868,139
Effective search space: 9604012665
Effective search space used: 9604012665
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)