Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ABL128W8.838ON47447419360.0
Ecym_46098.838ON52036010911e-144
SAKL0D01518g8.838ON5743687911e-98
Kwal_27.102728.838ON5513447351e-90
KLTH0C03916g8.838ON5703457344e-90
KLLA0D01617g8.838ON5623626081e-71
ZYRO0G14146g8.838ON5073565053e-57
TDEL0B005908.838ON5413514979e-56
Kpol_1068.108.838ON6173524807e-53
TPHA0I002308.838ON6143624464e-48
Suva_13.298.838ON5093554265e-46
Smik_13.208.838ON5103544222e-45
YML114C (TAF8)8.838ON5103464204e-45
Skud_13.278.838ON5143494171e-44
NCAS0B003108.838ON5643374085e-43
NDAI0E003008.838ON6644213216e-31
KAFR0A028208.838ON4533332972e-28
TBLA0D032508.838ON6832262923e-27
CAGL0B02299g8.838ON6432422658e-24
KNAG0G034108.838ON5262741848e-14
NDAI0I014106.150ON643113705.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL128W
         (474 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   750   0.0  
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   424   e-144
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   309   1e-98
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...   287   1e-90
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...   287   4e-90
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...   238   1e-71
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   199   3e-57
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   196   9e-56
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   189   7e-53
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...   176   4e-48
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...   168   5e-46
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...   167   2e-45
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...   166   4e-45
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...   165   1e-44
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   161   5e-43
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...   128   6e-31
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   119   2e-28
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...   117   3e-27
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...   106   8e-24
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...    75   8e-14
NDAI0I01410 Chr9 (338148..340079) [1932 bp, 643 aa] {ON} Anc_6.1...    32   5.0  

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/474 (79%), Positives = 376/474 (79%)

Query: 1   MTNGECNGIHNRAGAKEGIQLKKLPDLTEVTKSNPMQKLLAQAVGLHLKTMRSDVGITQL 60
           MTNGECNGIHNRAGAKEGIQLKKLPDLTEVTKSNPMQKLLAQAVGLHLKTMRSDVGITQL
Sbjct: 1   MTNGECNGIHNRAGAKEGIQLKKLPDLTEVTKSNPMQKLLAQAVGLHLKTMRSDVGITQL 60

Query: 61  GFENLVQFVELQLDDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQY 120
           GFENLVQFVELQLDDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQY
Sbjct: 61  GFENLVQFVELQLDDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQY 120

Query: 121 VRQQHAGAVRSIEEQSASLMGHWHQPMXXXXXXXXXHAEFFFKDVDILNLVPPTNNNNHY 180
           VRQQHAGAVRSIEEQSASLMGHWHQPM         HAEFFFKDVDILNLVPPTNNNNHY
Sbjct: 121 VRQQHAGAVRSIEEQSASLMGHWHQPMSEEELLSSSHAEFFFKDVDILNLVPPTNNNNHY 180

Query: 181 VPKWLPEFPPDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKKPRADD 240
           VPKWLPEFPPDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKKPRADD
Sbjct: 181 VPKWLPEFPPDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKKPRADD 240

Query: 241 AQLPQIISDGQQENLLIYGXXXXXXXXXXXXXXGFNIEDYARCRVELARRRVEEFEQQKL 300
           AQLPQIISDGQQENLLIYG              GFNIEDYARCRVELARRRVEEFEQQKL
Sbjct: 241 AQLPQIISDGQQENLLIYGPERRRLAPEPAPTRGFNIEDYARCRVELARRRVEEFEQQKL 300

Query: 301 QVQKNPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTKXXXXXXX 360
           QVQKNPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTK       
Sbjct: 301 QVQKNPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTKARELAAA 360

Query: 361 XXXXXXXXXSMRNNTDLTQQQHGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT 420
                    SMRNNTDLTQQQHGV                                   T
Sbjct: 361 YERERARQESMRNNTDLTQQQHGVLDLSALHDDPLLADLDSSDSDDDRQPPSPRKPPDPT 420

Query: 421 EXXXXXXXXXXXXXXXXXXXXXXXXVLDAAPEPLSVPPPIEKLGSPDTNAASAS 474
           E                        VLDAAPEPLSVPPPIEKLGSPDTNAASAS
Sbjct: 421 ESDAPSPPTADTATPAPPSPLANPPVLDAAPEPLSVPPPIEKLGSPDTNAASAS 474

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  424 bits (1091), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 204/360 (56%), Positives = 256/360 (71%), Gaps = 20/360 (5%)

Query: 14  GAKEGIQLKKLPDLTEVTKSNPMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQL 73
           GAKE IQLKKLP L EV K NPMQ LL+Q+V L LKTM+SD  IT+LGF N++QF+E+Q+
Sbjct: 14  GAKEFIQLKKLPGLQEVAKHNPMQILLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQM 73

Query: 74  DDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIE 133
           +DM QILHRFAN+QRRNE+S+KD++LFL G G+E +SLY+E+ +S+Y+++ +    ++IE
Sbjct: 74  NDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNIE 133

Query: 134 EQSASLMGHWHQPMXXXXXXXXXHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFPPDHT 193
            QS  L+  W +P+         HAEFFFKDVDILNLVPPTN NN YVP WLPEFPPDHT
Sbjct: 134 RQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVPTWLPEFPPDHT 193

Query: 194 YKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKK--PRADDAQLPQIISDGQ 251
           YKFT+IYN+PI+DERQMKR LFEE KLSEKALL+MLG+A  K     D+  + Q   + Q
Sbjct: 194 YKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKMLKVEDEETIAQTYKESQ 253

Query: 252 QENLLIYGXXXXXXXXX-----------------XXXXXGFNIEDYARCRVELARRRVEE 294
           +E  LIYG                               GFNI++YAR R+ LARR+VEE
Sbjct: 254 EETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARSRIGLARRKVEE 313

Query: 295 FEQQKLQVQKNPFIRAAAACSPYATT-RLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTK 353
           FE  KLQ QKNPFIRA++ CSPY    + +RKA EREF +LL RSY+GVL +IP+LR+ K
Sbjct: 314 FENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYVGVLKSIPKLRQLK 373

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  309 bits (791), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 162/368 (44%), Positives = 225/368 (61%), Gaps = 15/368 (4%)

Query: 1   MTNGECNGIHNRAGAKEGIQLKKLPDLTEV---TKSNPMQKLLAQAVGLHLKTMRSDVGI 57
           MT  E +     A +++ I+LKKLP L      +   PM K+L+QAV + LK M  DV +
Sbjct: 1   MTTEEASHKDAPAPSRKQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAM 60

Query: 58  TQLGFENLVQFVELQLDDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVR 117
           +Q  FENLVQ V   L  ML  LHRF ++QRR E+S KD+ L L G  +    L  E   
Sbjct: 61  SQFAFENLVQLVSENLSFMLTTLHRFVDIQRRREISKKDLLLLLKGYDLSNSELMRELES 120

Query: 118 SQYVRQQHAGAVRSIEEQSASLMGHWHQPMXXXXXXXXXHAEFFFKDVDILNLVPPTNNN 177
           SQY+   H   V  I ++S  L     +PM         H+EFFFKD+DIL+LVPPTN N
Sbjct: 121 SQYIVSNHPEKVNKIAQKSKELKSKLLKPMTEKELLNSAHSEFFFKDMDILDLVPPTNKN 180

Query: 178 NHYVPKWLPEFPPDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLG--TATKK 235
           N Y+PKWLPEFPPDHTY+FTS YN+P+ DERQ++RKL EE K SE+AL+++L    +T +
Sbjct: 181 NQYIPKWLPEFPPDHTYRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKHHDSTNQ 240

Query: 236 PRADDAQLPQ--IISDGQQENLLIYGXXXXXXXXXXXX--------XXGFNIEDYARCRV 285
              ++ ++ +  +  + Q+E  LI+G                       F++E+YAR RV
Sbjct: 241 DLGNNERVEKRSLYEETQEETFLIFGPERKKSHTTENSHELLRTLPLKNFSVEEYARNRV 300

Query: 286 ELARRRVEEFEQQKLQVQKNPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHA 345
           E+ARR+V E+EQ +L++QKNPFI+AA  CSP   + +SRKAI++E   +L RSYIG+L +
Sbjct: 301 EIARRKVLEYEQYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRS 360

Query: 346 IPRLRRTK 353
           +P+L   K
Sbjct: 361 VPKLNEVK 368

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score =  287 bits (735), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 146/344 (42%), Positives = 210/344 (61%), Gaps = 12/344 (3%)

Query: 19  IQLKKLPDLTEVTKSN---PMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDD 75
           +QLK LP L E+ K++   P++KLL +A+ + LK++ +D  I+QL FENL+  VE  L +
Sbjct: 19  VQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLSN 78

Query: 76  MLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIEEQ 135
           ML  LH+ AN+QRR+ +S KD+ L + G  +    L  E  RS+YVR +H   ++ +EE 
Sbjct: 79  MLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEED 138

Query: 136 SASLMGHWHQPMXXXXXXXXXHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFPPDHTYK 195
           S  +    H P+         H EFF  D D+L LVPP+  +  +VP+WLP+FPPDHTY+
Sbjct: 139 SKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDHTYR 198

Query: 196 FTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKKPRADDAQLPQIISDGQQENL 255
           FT+ YN+PITDER MKRKL EE+ LSEKAL+H+   + ++  +       I  + QQE  
Sbjct: 199 FTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPIDSDTIYEEAQQETQ 258

Query: 256 LIYGXXXXXXXXXXXX---------XXGFNIEDYARCRVELARRRVEEFEQQKLQVQKNP 306
           L++G                        F++E+YAR RVE+ARRRV E+E+ +LQ+QK  
Sbjct: 259 LLFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQLQLQKGA 318

Query: 307 FIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLR 350
           FI+AA   SP++  R S K +E+E   LLHRS IG+L + P L+
Sbjct: 319 FIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLK 362

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score =  287 bits (734), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 151/345 (43%), Positives = 213/345 (61%), Gaps = 13/345 (3%)

Query: 18  GIQLKKLPDLTEVTKS---NPMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLD 74
           G+QL+ LP+L E+ ++   +P++KLL +AV + LK + S+V I+Q  FENL+  VE  L 
Sbjct: 18  GVQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLS 77

Query: 75  DMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIEE 134
           +ML  LH+  N+QRR+ +S KD+ L + G  +    L  E  RSQYVR  +   VR + E
Sbjct: 78  NMLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLERVRKVRE 137

Query: 135 QSASLMGHWHQPMXXXXXXXXXHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFPPDHTY 194
           +S  +      P+         H EFF +D +IL LVPPT  N  YVP+WLPEFPPDHTY
Sbjct: 138 ESEVVEAKEKTPLSEKELLESKHLEFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTY 197

Query: 195 KFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKKPRADDAQLPQIISDGQQEN 254
           +FTS +N+PITDER MKRKL EE+ LSEKAL+H+   + ++  ++ A   +I  + QQ+ 
Sbjct: 198 RFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPSEGADSDEIFKESQQDT 257

Query: 255 LLIYGXXXXXXXXXXXXXX---------GFNIEDYARCRVELARRRVEEFEQQKLQVQKN 305
            LI+G                        +N+E+YAR RVE+ARR+VEE+E+ +L +QK 
Sbjct: 258 QLIFGPAKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIARRKVEEYERHQLLLQKG 317

Query: 306 PFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLR 350
            FI+AA   SP+A  R + K +E+E   LLHRSYIG+L + P LR
Sbjct: 318 AFIKAAHLLSPFAKKR-NCKQVEKEVRTLLHRSYIGLLKSAPLLR 361

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score =  238 bits (608), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 138/362 (38%), Positives = 202/362 (55%), Gaps = 27/362 (7%)

Query: 19  IQLKKLPDLTEVTKSNPMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDDMLQ 78
           ++L KLP+L EV  +NPM++L AQAV L LKT+  +V I+QL F++L     LQLDD+LQ
Sbjct: 21  VRLDKLPNLNEVPHANPMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVSLLQLDDLLQ 80

Query: 79  ILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIEEQSAS 138
            L +   VQRR ++S  D+ L+  G G++ + L  +   S +V  +      ++ E    
Sbjct: 81  SLKKITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALNETVLK 140

Query: 139 LMGHWHQPMXXXXXXXXXHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFPPDHTYKFTS 198
           +   + + +         H+EFF +DVDILNL+P +N +N YVP WLPE PPDHTYKFTS
Sbjct: 141 VKQQFMKELEEKELLSSKHSEFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDHTYKFTS 200

Query: 199 IYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKKP-----------RADDAQLPQII 247
           +Y +PITDER MK+KL EE +LSEKALL+ML     +             A++A L + I
Sbjct: 201 LYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANNAALSEHI 260

Query: 248 SDGQQENLLIYGXXXXXXXXXX---------------XXXXGFNIEDYARCRVELARRRV 292
            + Q E  LI+                               FN+ +Y + R  + +RR 
Sbjct: 261 KESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPVKNFNVLEYCKKRDAIVKRRA 320

Query: 293 EEFEQQKLQVQKNPFIRAAAACSPYAT-TRLSRKAIEREFGVLLHRSYIGVLHAIPRLRR 351
           E  E Q    ++NPFIR A  CSPY   +  SRK++E +   +L RSY+G++ +IPR++ 
Sbjct: 321 ERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQLKTMLRRSYLGLIDSIPRVKE 380

Query: 352 TK 353
            +
Sbjct: 381 VR 382

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  199 bits (505), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 123/356 (34%), Positives = 194/356 (54%), Gaps = 38/356 (10%)

Query: 19  IQLKKLPDLTEVTKSN---PMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDD 75
           IQ+ KLP L E+   +    + K+LA++V L LK M  +  ITQ  F+ L+Q V+ QL+D
Sbjct: 5   IQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPM--NAQITQFAFDRLLQLVDGQLND 62

Query: 76  MLQILHRFANVQRRNEVSLKDVRLFLHG-----CGVEEESLYEEYVRSQYVRQ-QHAGAV 129
           M+  LHR +N+QRR  ++  D+ + + G       +E +S   E+   +Y ++  H  ++
Sbjct: 63  MISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSL 122

Query: 130 RSIEEQSASLMGHWHQPMXXXXXXXXXHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFP 189
           R ++    S + H   P            E   ++V  + LVPPTN    ++PKWLP+FP
Sbjct: 123 RDLQ----SSLAHEMVPFEDQ--------EAVRQNVSTV-LVPPTNPLQDFLPKWLPDFP 169

Query: 190 PDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKKPRADDAQLPQIISD 249
           PDHTYKFT  Y+ PITDE  ++R++ EE+K SE AL H+  +  K P  D     Q  S+
Sbjct: 170 PDHTYKFTPQYSHPITDETTIRRQIVEEAKQSELALSHL--SQKKNPTDDIVNRSQYDSE 227

Query: 250 -GQQENLLIYGXXXXXXXX-----------XXXXXXGFNIEDYARCRVELARRRVEEFEQ 297
             +QE L IYG                          F++E+YA  R+E+AR++V EFE+
Sbjct: 228 LAEQETLAIYGSQLKKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFEE 287

Query: 298 QKLQVQKNPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTK 353
           ++LQ Q++PF++ +         + ++K + REF + L RS+I ++ +IP L R K
Sbjct: 288 RQLQSQQDPFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELERNK 343

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  196 bits (497), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 188/351 (53%), Gaps = 34/351 (9%)

Query: 19  IQLKKLPDLTEVTKSN---PMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDD 75
           IQL  LP L E+        + K+L++AV L LK M++D  I++  FE+L+  ++ QL+D
Sbjct: 10  IQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKAD--ISKFAFEHLMILIDDQLND 67

Query: 76  MLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIEEQ 135
           M+  LHRF+NVQRR  ++  DV LFL G  +    L +++  SQY  + +     S+   
Sbjct: 68  MIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLH-- 125

Query: 136 SASLMGHWHQPMXXXXXXXXXHAEFFFKDVDILN-LVPPTNNNNHYVPKWLPEFPPDHTY 194
             SL   +   +                  D++N LV P N    Y+PKW+P FPPDHTY
Sbjct: 126 --SLKETFTDAVVDEDNGSE----------DVINELVRPNNPLIRYIPKWMPAFPPDHTY 173

Query: 195 KFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGT---ATKKPRADDAQLPQIISDGQ 251
           KFT  YNQPITDE  ++R++ +E K SE ALLH+L      T    AD A   + +   +
Sbjct: 174 KFTPQYNQPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSDADGASYDEALV--R 231

Query: 252 QENLLIYGXXXXXXXXXXXX---------XXGFNIEDYARCRVELARRRVEEFEQQKLQV 302
           +E   IYG                        F+IE+YAR RVE+AR++V E+E++++++
Sbjct: 232 EETAAIYGNEQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMKL 291

Query: 303 QKNPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTK 353
           Q+NPFI+ +      ++ +  R+   RE   +L RS   ++ +IP L+ TK
Sbjct: 292 QRNPFIKYSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTK 342

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  189 bits (480), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 117/352 (33%), Positives = 188/352 (53%), Gaps = 26/352 (7%)

Query: 15  AKEGIQLKKLPDLTEVT--KSNP-MQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVEL 71
           A + IQL +LP LTE    ++ P ++K+LA+AV L LK+M  D  IT+  FE+L+  V  
Sbjct: 5   ATKYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVG 64

Query: 72  QLDDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRS 131
           Q+DDM+  LHR +++QRRN V+  D+ ++L G  +  E L E+  +SQY+ + +     S
Sbjct: 65  QIDDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYES 124

Query: 132 IEE--QSASLMGHWHQPMXXXXXXXXXHAEFFFKDVDIL---NLVPPTNNNNHYVPKWLP 186
           + +   + +     +Q +           +   KD        LVP +N     +P WLP
Sbjct: 125 LTKIATTTTRTLSTYQKL-----------DLTHKDTSTAQTSKLVPISNPLQKLIPSWLP 173

Query: 187 EFPPDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKKPRADDAQLPQI 246
           +FPPD+TYKFT  YN PITDE  ++RK+ EE K SEKALL++L    +   + D +    
Sbjct: 174 DFPPDYTYKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISRDLKFSSS 233

Query: 247 -ISDGQQENLLIYGXXXXXXX------XXXXXXXGFNIEDYARCRVELARRRVEEFEQQK 299
            +    +E L  Y                       N+E+YAR RVE+ R++V  +E+++
Sbjct: 234 EMELATEETLATYSAITLRNKHLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQ 293

Query: 300 LQVQKNPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRR 351
           LQ+Q+NPF++ +   S     ++S+     E    L RS +  +H+IP+ ++
Sbjct: 294 LQIQRNPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQ 345

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score =  176 bits (446), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 110/362 (30%), Positives = 183/362 (50%), Gaps = 32/362 (8%)

Query: 16  KEGIQLKKLPDLTEVTKSN---PMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQ 72
           K+ +QL KLP LTE    +   PM+ +LA+A+ L LK M  D  IT+  F +L   V+ Q
Sbjct: 43  KKYVQLTKLPTLTEFKYEDTKGPMEVILAKAIALQLKLMNRDTTITKFAFTHLTSLVDEQ 102

Query: 73  LDDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSI 132
           L DM+  + + A +QRR EV+ KD+ L+L G  ++   L   + +S+Y+++++ G V   
Sbjct: 103 LSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEV--- 159

Query: 133 EEQSASLMGHWHQPMXXXXXXXXXHAEFFFKD--VDILNLVPPTNNNNHYVPKWLPEFPP 190
                +L+                  +    D  ++ L LVP TN   + +P WLP FPP
Sbjct: 160 -----TLLNRLATDTNEVLTVFKKTDKTLKDDSTLETLKLVPITNTLENIIPDWLPSFPP 214

Query: 191 DHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLG----TATK-----KPRADDA 241
           D+TYKFT  +N+ ITD   +++K+  E K SEKALLH+L     T +K     K  +DD 
Sbjct: 215 DYTYKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFDSDDM 274

Query: 242 QLPQIISDG----------QQENLLIYGXXXXXXXXXXXXXXGFNIEDYARCRVELARRR 291
              ++  D           ++                      F+IE Y   R+ + R +
Sbjct: 275 DTAKLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNK 334

Query: 292 VEEFEQQKLQVQKNPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRR 351
           V+++E ++L++Q +PF++  A  S     ++SR+ I      +L RS++ ++++IP L +
Sbjct: 335 VKQYEDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTLNQ 394

Query: 352 TK 353
            K
Sbjct: 395 NK 396

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score =  168 bits (426), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 110/355 (30%), Positives = 182/355 (51%), Gaps = 28/355 (7%)

Query: 13  AGAKEG-IQLKKLPDLTEVTK---SNPMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQF 68
           +GA +  +QL  LPDLTEV+      P+ ++L ++V   L ++  ++ I+    + +V  
Sbjct: 10  SGASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSL--NICISNFALDEMVNL 67

Query: 69  VELQLDDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGA 128
           V +Q+D M + LH  A +QRR++VS  D++L      +   SL+++   S++++ +H+  
Sbjct: 68  VAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVE 127

Query: 129 VRSIEEQSASLMGHWHQPMXXXXXXXXXHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEF 188
              +  +S+S     H              +      +I  L+PP+N     +P WLP F
Sbjct: 128 YEKLV-KSSSFTAVSHIEDDEEDEINNIEEQ----QNEINVLLPPSNPLEKLIPSWLPNF 182

Query: 189 PPDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHM--------LGTATKKPRADD 240
           PPDHTYKFT  +N PITD + +KR++ +ES  SE+ALL++          + T  PR  D
Sbjct: 183 PPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRLPD 242

Query: 241 AQLPQIISDGQQENLLIYGXX--XXXXXXXXXXXXGFNIEDYARCRVELARRRVEEFEQQ 298
           A      SD   E L I+G                  NIE YA+ R+ELAR RV +FE  
Sbjct: 243 A------SDA-SERLEIWGNTLHERKPAIIAKSFNEKNIEQYAKYRIELARERVSKFEVN 295

Query: 299 KLQVQKNPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTK 353
           +L+  KNPF++ + +   +     S K I+R   + L +S    +H +P++++ K
Sbjct: 296 QLKRTKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLK 350

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score =  167 bits (422), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 105/354 (29%), Positives = 183/354 (51%), Gaps = 21/354 (5%)

Query: 13  AGAKEG-----IQLKKLPDLTEVTK---SNPMQKLLAQAVGLHLKTMRSDVGITQLGFEN 64
           +G++ G     +QL++LPDLTE++      P+ ++L + V   L ++  ++ I+    + 
Sbjct: 6   SGSESGTQHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSL--NICISNFALDE 63

Query: 65  LVQFVELQLDDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQ 124
           LV  V +Q+D M + LH    +QRR+E S  D++L      V+  SLY+++  S++++  
Sbjct: 64  LVNLVAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSN 123

Query: 125 HAGAV-RSIEEQSASLMGHWHQPMXXXXXXXXXHAEFFFKDVDILNLVPPTNNNNHYVPK 183
           HA    + +   S   + H  +           + E    ++++L  +PP+N     +P 
Sbjct: 124 HAVEYGKLVRLSSFPALAHNEE----DEEDELSNIEEQQSEINVL--LPPSNPLEKLIPS 177

Query: 184 WLPEFPPDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKKPRADDAQL 243
           WLP FPPDHTYKFT  +N PITD + +K+++ +ES+ SEKALL++    +    A     
Sbjct: 178 WLPNFPPDHTYKFTPEFNHPITDLKTIKKEIVKESEESEKALLNLNKRLSHLSSASHTSP 237

Query: 244 PQII--SDGQQENLLIYGXXXXXX--XXXXXXXXGFNIEDYARCRVELARRRVEEFEQQK 299
           P ++  +D  ++ L I+G                  NIE YA+ RVELAR RV +FE  +
Sbjct: 238 PPVLDDADATEQQLEIWGNALQERKPTITATSLNESNIEQYAKYRVELARERVAKFELNQ 297

Query: 300 LQVQKNPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTK 353
           L+  KNPF++ +           S K I+    +   +S    +H +P++++ K
Sbjct: 298 LKRTKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLK 351

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score =  166 bits (420), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 106/346 (30%), Positives = 184/346 (53%), Gaps = 22/346 (6%)

Query: 19  IQLKKLPDLTEVTK---SNPMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDD 75
           +QL+ LPDLTE++      P+ ++L + V   L ++  ++ I+    + LV  V +Q+D 
Sbjct: 17  VQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSL--NICISNFALDELVNLVTVQMDG 74

Query: 76  MLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIEEQ 135
           M + LH    +QRR++ S  D++L L    ++  SLY+++  S++++ +H+     +   
Sbjct: 75  MFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKLMSW 134

Query: 136 SASLMGHWHQPMXXXXXXXXXHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFPPDHTYK 195
           S SL    H            + E    ++++L  +PP+N     +P WLP FPPDHTYK
Sbjct: 135 S-SLAALPHN--EEDEEDELNNIEEQQNEINVL--LPPSNPLEKQIPSWLPNFPPDHTYK 189

Query: 196 FTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKKPRADDAQLPQIISDGQ--QE 253
           FT  +N PITD + +K+++ +ES+ SEKALL++  + +    A +   P  + D    ++
Sbjct: 190 FTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDDEDAIEQ 249

Query: 254 NLLIYGXXXXXXXXXXXXXX--GFNIEDYARCRVELARRRVEEFEQQKLQVQKNPFIRAA 311
            L I+G                  NIE YA+ RVELAR RV +FE  +L+  KNPF++ +
Sbjct: 250 QLEIWGNALEERKPTITEKSFNENNIEQYAKYRVELARERVTKFEVNQLKRTKNPFLKIS 309

Query: 312 AAC----SPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTK 353
                  SP+ + +  +K IE +F     +S    +H +P++++ K
Sbjct: 310 ETLYLPESPHQSHKTIQKTIELQF----RKSMTLFMHNLPKVQKLK 351

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score =  165 bits (417), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 108/349 (30%), Positives = 174/349 (49%), Gaps = 28/349 (8%)

Query: 19  IQLKKLPDLTEVTK---SNPMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDD 75
           +QLK LPDLTE++      P+ ++L + V   L ++  D+ I+    + LV  V +Q+D 
Sbjct: 17  VQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSL--DICISNFALDELVNLVAVQMDG 74

Query: 76  MLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIEEQ 135
           M + LH  A +QRR+  +  D++L      ++  SLY++   S++++  H     S+E +
Sbjct: 75  MFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNH-----SVEYE 129

Query: 136 SASLMGHWHQPMXXXXXXXXXHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFPPDHTYK 195
                  +                   +  +I  L+PP+N     +P WLP FPPDHTY+
Sbjct: 130 KLVSSSSFSASSHNEEDEEDELNNIEEQQNEISVLLPPSNPLEKLMPSWLPNFPPDHTYR 189

Query: 196 FTSIYNQPITDERQMKRKLFEESKLSEKALLHM--------LGTATKKPR-ADDAQLPQI 246
           FT  +N PITD + +KR++ +ESK SEKALL++        L +    PR  DDA     
Sbjct: 190 FTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHAPPPRLPDDA----- 244

Query: 247 ISDGQQENLLIYGXXXXXXXXXXXXXX--GFNIEDYARCRVELARRRVEEFEQQKLQVQK 304
             D  ++ L I+G                  NIE YA+ RVELAR RV +FE  +L+  K
Sbjct: 245 --DAGEQQLEIWGNALQEEKRTAISKSFNENNIEQYAKYRVELARERVSKFEVNQLKRTK 302

Query: 305 NPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTK 353
           NPF+R +       +     +AI+R   +   +S +   H +P++++ K
Sbjct: 303 NPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLK 351

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  161 bits (408), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 101/337 (29%), Positives = 170/337 (50%), Gaps = 32/337 (9%)

Query: 36  MQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDDMLQILHRFANVQRRNEVSLK 95
           ++KLL +++ L LK +  ++ ++QL F  L   V  QLD ++  LHR + +QRRN  +  
Sbjct: 48  VRKLLNKSIALQLKPL--NLELSQLAFNELSLLVNDQLDFLISELHRMSVIQRRNAAAKT 105

Query: 96  DVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIEEQSASLMGHWHQPMXXXXXXXX 155
           D+ L L G  +    L+ +   S +++ ++     ++ + S+++                
Sbjct: 106 DIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTIFD------SSDTMANP 159

Query: 156 XHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFPPDHTYKFTSIYNQPITDERQMKRKLF 215
            H        +IL  + P N     +P WLP FPPDHTYKFT  +N+PITD+  +K+KL 
Sbjct: 160 GHDSMVNNPSNIL--IKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIKQKLI 217

Query: 216 EESKLSEKALLHMLGTATKKPRADDAQLPQIISD-GQQENLLIYGXXXXXXXXXX----- 269
           EE K SEK+LL++L   T++   ++ +     S+  ++EN+ IYG               
Sbjct: 218 EEGKKSEKSLLNLLNDITEQSSIENEETSNFDSELAREENIAIYGYDAMSRKKRKPPHLI 277

Query: 270 -------------XXXXGFNIEDYARCRVELARRRVEEFEQQKLQVQKNPFIRAAAACSP 316
                             FN+ +YA  RVEL R+RVEEFE ++L+ +KNPF+R +   + 
Sbjct: 278 SIHDTEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRMIN- 336

Query: 317 YATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTK 353
               ++SR  ++ E    L RSY  +    P+L++ +
Sbjct: 337 --DKKVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQER 371

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score =  128 bits (321), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 112/421 (26%), Positives = 175/421 (41%), Gaps = 108/421 (25%)

Query: 36  MQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDDMLQILHRFANVQRRNEVSLK 95
           ++KLL +++ + LK  +  V  ++L F  L   V+ QL+ ++  LHR + +QRRN ++  
Sbjct: 30  IEKLLQKSIAIQLKAFK--VDFSKLAFNQLTLLVDDQLNSLITELHRLSLLQRRNSMAKV 87

Query: 96  DVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGA----VRSIEEQSASLMGHWHQPMXXXX 151
           D+ L++ G  +    L  +Y  S+Y++++ +G     +R + E+      H    M    
Sbjct: 88  DLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRTHI---MESST 144

Query: 152 XXXXXHAEFFFKDV----DILN-LVPPTNN-NNHYVPKWLPEFPPDHTYKFTSIYNQPIT 205
                     F+++    D  N L+ PTN      +  WLP FPPDHTYKFT  +N PIT
Sbjct: 145 SDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQFNNPIT 204

Query: 206 DERQMKRKLFEESKLSEKALLHML--------GTAT------------------------ 233
           DE+ +K+KL EE   SEKALL+ L        GT+                         
Sbjct: 205 DEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPITDTDEEE 264

Query: 234 -------KKPRADDAQLPQII--SDGQQENLLIYGXXXXXXXXXXXXXXGFNI------- 277
                  +K + D   +P+ I  +   +E L IYG                NI       
Sbjct: 265 KQAKNEKEKEQEDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKPNIISIHDEK 324

Query: 278 ----------------EDYARCRVELARRRVEEFEQQKLQVQKNPFI------------- 308
                             Y+  RVEL R++VE FE +KL+++KNPF+             
Sbjct: 325 IVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSKLVCLEKEDY 384

Query: 309 ------------RAAAACSPYATTRLS----RKAIEREFGVLLHRSYIGVLHAIPRLRRT 352
                       R     +     RLS    R  I  E    L RS+  +L+  P+L++ 
Sbjct: 385 YDYDNDEDDLEERKNYNNNNDNDNRLSPIRKRAQINNEIISNLKRSFYSILNNYPKLKKA 444

Query: 353 K 353
           K
Sbjct: 445 K 445

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  119 bits (297), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 85/333 (25%), Positives = 154/333 (46%), Gaps = 43/333 (12%)

Query: 29  EVTKSNPMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDDMLQILHRFANVQR 88
           ++T +  +  LL ++V + LK +     +    F+ L+  +++QL+D+++ L R + +QR
Sbjct: 19  QITGNPQLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQR 78

Query: 89  RNEVSLK-DVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIEEQSASLMGHWHQPM 147
           RN  + K D+ L L G  + E  L  E   S ++++ ++   + + E S     H++Q  
Sbjct: 79  RNSNATKSDILLLLKGFNLSESELNTELEISNHIKRLYSEDEKKLSEDSI----HYNQ-- 132

Query: 148 XXXXXXXXXHAEFFFK-DVDILNLVPPTNNNNHYVPKWLPEFPPDHTYKFTSIYNQPITD 206
                    H +F    +     L+ PTN     +P W P  PPDHTYKFT  YN  I D
Sbjct: 133 ---------HTDFVGPVETSSFQLLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFIND 183

Query: 207 ERQMKRKLFEESKLSEKALLHMLGTATKKPRADDAQLPQIISDGQQENLLIYGXXXXXXX 266
            + +K+K F+ESK  + AL +++         +D    + +   + E+  ++G       
Sbjct: 184 PKIIKQKRFDESKTVKTALFNLINKIESNEERNDLHYDETL--AKLESQALFGTVEEKMN 241

Query: 267 XXXXXXXG----------FNIEDYARCRVELARRRVEEFEQQKLQVQKNPFIRAAAACSP 316
                             F+IE+Y+  RV +AR +V +FE + L ++ NPFI      + 
Sbjct: 242 TNKKVYKSLNSIIVPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINLINDQTD 301

Query: 317 YATTRLSRKAIEREFGVLLHRSYIGVLHAIPRL 349
             +               L+RS+  ++++IP L
Sbjct: 302 VKS--------------YLNRSFQLMINSIPEL 320

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score =  117 bits (292), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 115/226 (50%), Gaps = 23/226 (10%)

Query: 21  LKKLPDLTEV---TKSNPMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDDML 77
           LK LPDL +     +S+ + +LLA+++ L LK M  +  I+ + F  L+  V+LQL+DM+
Sbjct: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101

Query: 78  QILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIEEQSA 137
             L R +  QRR  ++  D+ L+L    +    L      S +++ +       + E   
Sbjct: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYE--- 158

Query: 138 SLMGHWHQPMXXXXXXXXXHAEFFFKDVDILN----------LVPPTNNNNHYVPKWLPE 187
            L+  ++                 +   D+LN          +VPP+N     +P+WLP 
Sbjct: 159 -LLRDYNTETNHNFKNPN------YSTSDLLNNKSSESSSSRIVPPSNTILRSMPEWLPS 211

Query: 188 FPPDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTAT 233
            PPDHTYKFT +YN+PITDE  MK+ L  E KL+E AL+ +L  +T
Sbjct: 212 LPPDHTYKFTPLYNEPITDETVMKKILVNEGKLAESALIKLLEAST 257

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 27/35 (77%)

Query: 275 FNIEDYARCRVELARRRVEEFEQQKLQVQKNPFIR 309
           FN+E+YAR +V+  R +V  +E+++LQ QKNPF +
Sbjct: 356 FNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWK 390

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score =  106 bits (265), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 118/242 (48%), Gaps = 36/242 (14%)

Query: 18  GIQLKKLPDLTEVTKSNPMQ----KLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQL 73
           G+Q  +  D+ E+  SN M     +LL +AVG+ L+T+  DV +T++  + LV F E QL
Sbjct: 12  GVQENRDVDIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQL 71

Query: 74  DDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVR--- 130
           + ++  LHR + +QRR  +++ D+ +++ G  +    LY     S+++R+ +        
Sbjct: 72  NALVDGLHRISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVVF 131

Query: 131 ---SIEEQSASLMGHWH-------QPMXXXXXXX----------XXHA--EFFFKDVDIL 168
              +I+    S +G  +       +P                    HA  + F  D    
Sbjct: 132 KDINIDNPMESALGRINIQNKENIEPTDNDVDIDEDDDYELIELQQHAMEQLFKTDT--- 188

Query: 169 NLVPPTNNNNHYVPKWLPEFPPDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHM 228
                   N  Y P WLP+FPPDHTYK+T  Y   +  E ++++KL EE +LSEKAL+ +
Sbjct: 189 ----GRGRNLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKL 244

Query: 229 LG 230
           + 
Sbjct: 245 MS 246

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 29/37 (78%)

Query: 275 FNIEDYARCRVELARRRVEEFEQQKLQVQKNPFIRAA 311
           F++E YAR R+E+ARR+V +FE ++L ++ NP +R A
Sbjct: 398 FDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLA 434

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score = 75.5 bits (184), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 111/274 (40%), Gaps = 45/274 (16%)

Query: 76  MLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIEEQ 135
           M+  LHR A VQRR   +  DV L L G  +  E + E+   S+ +        R    Q
Sbjct: 81  MVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQMYLSKKIGYNRMQVPREQTVQ 140

Query: 136 SASLMGHWHQPMXXXXXXXXXHAEFFFKDVDILNLVPPTNNNNHY---------VPKWLP 186
                G + +                FK V+   L+    + +           +P WLP
Sbjct: 141 LQDATGSYDR----------------FKLVENQQLIASGLSGSDMSQELPIAEKIPAWLP 184

Query: 187 EFPPDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHML-----GTATKKPRADDA 241
           + PP+HTYKFT+ YN+ + DE+ +K K+ +ES   E +L +++        TK       
Sbjct: 185 KLPPNHTYKFTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNLVRNCDRDADTKVDERARE 244

Query: 242 QLPQIISDGQQENLLIYGXXX----------XXXXXXXXXXXGFNIEDYARCRVELARRR 291
             P+ +     E + +YG                         F+++ Y+  RV+LAR  
Sbjct: 245 TPPEELKRIDDEIVALYGPLEEIAERHEGPRTKRRTPLYLKKSFDVQAYSLGRVKLARNA 304

Query: 292 VEEFEQQKLQVQKNPFIRAAAACSPYATTRLSRK 325
           V+ FE +     +NPF+     CS  A    S+K
Sbjct: 305 VQRFEWETKYRPRNPFL-----CSHRAVPENSKK 333

>NDAI0I01410 Chr9 (338148..340079) [1932 bp, 643 aa] {ON} Anc_6.150
           YBR238C
          Length = 643

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 54/113 (47%), Gaps = 16/113 (14%)

Query: 9   IHN--RAGAKEGIQLKKLPDLTEVTKSNPMQKLLAQAVGLHLKTMRSD-----VGITQLG 61
           +HN  R   ++ +QL+K PD    + S  M+  L  +    L+ + SD     + I   G
Sbjct: 169 LHNGLRINRRDRVQLRKKPDYDSNSFSKEMEIFLCNS----LRRIASDLIENKIKIYPYG 224

Query: 62  FENLVQ-FVELQLDDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYE 113
             +L+  F+EL+LDD    L + A     NE +LKDV L     GV    LYE
Sbjct: 225 AMHLLTAFIELKLDDEAIKLWKIA---VENE-ALKDVFLEPSVIGVMLPKLYE 273

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,404,971
Number of extensions: 1456111
Number of successful extensions: 4192
Number of sequences better than 10.0: 24
Number of HSP's gapped: 4233
Number of HSP's successfully gapped: 33
Length of query: 474
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 361
Effective length of database: 40,524,141
Effective search space: 14629214901
Effective search space used: 14629214901
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)