Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ABL127W8.839ON72870737190.0
Ecym_46108.839ON75165626260.0
SAKL0D01496g8.839ON68864023700.0
Kwal_27.102638.839ON74364323280.0
KLTH0C03894g8.839ON74564322650.0
KLLA0D01595g8.839ON71964821260.0
TDEL0B005808.839ON71363620020.0
NCAS0C004208.839ON72564719880.0
ZYRO0G14168g8.839ON76464419640.0
KAFR0B039108.839ON72460619460.0
CAGL0M02959g8.839ON75874819080.0
TPHA0I002408.839ON73266518860.0
TBLA0D032608.839ON76863618780.0
Kpol_1068.98.839ON74560418590.0
YMR277W (FCP1)8.839ON73265918340.0
Skud_13.4498.839ON73466018060.0
Smik_13.4908.839ON73265318030.0
Suva_13.4658.839ON73265317920.0
NDAI0K004208.839ON77854017950.0
KNAG0J002808.839ON74266617530.0
NDAI0C032305.94ON103482970.006
KAFR0E021405.94ON95182970.007
Kpol_1050.635.94ON105869960.007
TPHA0E030705.202ON494121920.020
NDAI0D018605.202ON51451900.038
NCAS0A068005.202ON47351880.066
SAKL0G12870g5.202ON39981870.070
ADR369C7.46ON82791870.078
Smik_12.825.202ON39245870.079
KLLA0E15621g5.94ON89169870.091
Ecym_20665.94ON88083870.097
YLR019W (PSR2)5.202ON39745840.15
Kpol_1010.615.94ON93280850.17
Kpol_348.82.530ON422103840.19
Skud_12.875.202ON39245830.21
TBLA0C060905.202ON484121830.21
ZYRO0B15026g5.94ON1162120840.23
KAFR0A065604.156ON55590830.25
TPHA0H010705.94ON101563830.26
Ecym_50527.46ON87393800.54
ZYRO0B10428g5.202ON48240790.63
KNAG0E005705.94ON98192800.63
TPHA0A051105.94ON106587790.75
Skud_8.492.530ON447103780.80
YLL010C (PSR1)5.202ON42742771.0
Smik_12.535.202ON41451771.2
KNAG0C058502.530ON443103771.2
Suva_10.655.202ON41551771.3
TBLA0I014602.530ON393193761.3
KLTH0C01584g5.94ON913162771.5
Suva_10.995.202ON38542751.8
TPHA0N006705.202ON45241742.7
KLLA0F15620g5.202ON41460742.9
KLLA0E23101g8.527ON480110724.3
SAKL0G15620g5.94ON87993734.5
CAGL0L03410g1.276ON73177716.9
YPR196WsingletonON47036708.1
TDEL0D029504.156ON66391709.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL127W
         (728 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...  1437   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...  1016   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   917   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   901   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   877   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   823   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   775   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   770   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   761   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   754   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   739   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   731   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   728   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   720   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...   711   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...   700   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...   699   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...   694   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   696   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   679   0.0  
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    42   0.006
KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.9...    42   0.007
Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON} (138...    42   0.007
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    40   0.020
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     39   0.038
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    39   0.066
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    38   0.070
ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}...    38   0.078
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    38   0.079
KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]...    38   0.091
Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}...    38   0.097
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    37   0.15 
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    37   0.17 
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...    37   0.19 
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    37   0.21 
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    37   0.21 
ZYRO0B15026g Chr2 complement(1222480..1225968) [3489 bp, 1162 aa...    37   0.23 
KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa] ...    37   0.25 
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    37   0.26 
Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar t...    35   0.54 
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    35   0.63 
KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94 ...    35   0.63 
TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON} Anc_...    35   0.75 
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...    35   0.80 
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    34   1.0  
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    34   1.2  
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...    34   1.2  
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    34   1.3  
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...    34   1.3  
KLTH0C01584g Chr3 complement(139563..142304) [2742 bp, 913 aa] {...    34   1.5  
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    33   1.8  
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    33   2.7  
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    33   2.9  
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    32   4.3  
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    33   4.5  
CAGL0L03410g Chr12 (389484..391679) [2196 bp, 731 aa] {ON} simil...    32   6.9  
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    32   8.1  
TDEL0D02950 Chr4 complement(556701..558692) [1992 bp, 663 aa] {O...    32   9.5  

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score = 1437 bits (3719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 695/707 (98%), Positives = 695/707 (98%)

Query: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAGKARKQ 60
           MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAGKARKQ
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAGKARKQ 60

Query: 61  RVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVED 120
           RVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVED
Sbjct: 61  RVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVED 120

Query: 121 EAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIHCG 180
           EAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIHCG
Sbjct: 121 EAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIHCG 180

Query: 181 VDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRPGLKE 240
           VDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRPGLKE
Sbjct: 181 VDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRPGLKE 240

Query: 241 FFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLERLFPM 300
           FFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLERLFPM
Sbjct: 241 FFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLERLFPM 300

Query: 301 DQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNRKKPK 360
           DQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNRKKPK
Sbjct: 301 DQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNRKKPK 360

Query: 361 QXXXXXXXXXXXXKKLKEKINEEVKRQEDQMHRLTDEKLPDTRDIAKKLEHNASLEVQQQ 420
           Q            KKLKEKINEEVKRQEDQMHRLTDEKLPDTRDIAKKLEHNASLEVQQQ
Sbjct: 361 QEEELLTDILDTEKKLKEKINEEVKRQEDQMHRLTDEKLPDTRDIAKKLEHNASLEVQQQ 420

Query: 421 NRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDPIPDIKILMP 480
           NRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDPIPDIKILMP
Sbjct: 421 NRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDPIPDIKILMP 480

Query: 481 KLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLITRTPGTMK 540
           KLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLITRTPGTMK
Sbjct: 481 KLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLITRTPGTMK 540

Query: 541 ARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENFKRDLAEAQKK 600
           ARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENFKRDLAEAQKK
Sbjct: 541 ARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENFKRDLAEAQKK 600

Query: 601 VDPPAQDSRSSLLLLDGNGSWLDYDDDEMDEFLNEESDNEEDTEQMAPASKAPRPNGFPS 660
           VDPPAQDSRSSLLLLDGNGSWLDYDDDEMDEFLNEESDNEEDTEQMAPASKAPRPNGFPS
Sbjct: 601 VDPPAQDSRSSLLLLDGNGSWLDYDDDEMDEFLNEESDNEEDTEQMAPASKAPRPNGFPS 660

Query: 661 GGERPAAVQSQDKPELPEKESNGKRPYQPDDAVSASKVKLQRTDAFS 707
           GGERPAAVQSQDKPELPEKESNGKRPYQPDDAVSASKVKLQRTDAFS
Sbjct: 661 GGERPAAVQSQDKPELPEKESNGKRPYQPDDAVSASKVKLQRTDAFS 707

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score = 1016 bits (2626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/656 (74%), Positives = 558/656 (85%), Gaps = 17/656 (2%)

Query: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAG-KARK 59
           MSTPIRLPD+LPYPIT+AQL VS GD VE+GQRL AYKYWD   ++T+PG+E AG K+++
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAGGKSKR 60

Query: 60  QRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVE 119
           QR+DLVGTFDSPV+G VVSL++ +GDEFVNSQ  V EI+Q C HDVTYGGLCVQCGQ VE
Sbjct: 61  QRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTVE 120

Query: 120 DEAGAADGVE-QAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIH 178
           DE  +   ++ QAKLT+SHTN +IR+SE+QA +L +SAQ +LREARKLVLVVDLDQTVIH
Sbjct: 121 DEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTVIH 180

Query: 179 CGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRPGL 238
           CGVDPTIGEWSKDP+NPNYE+LKDV+SFSL EEPVLPPFYMGPKPPTRKCWYYVKLRPGL
Sbjct: 181 CGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKLRPGL 240

Query: 239 KEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLERLF 298
           ++FF+ IAPHFELHIYTMATR YALEIAKIIDPDG LFGDRILSRDENGSLTQKSLERLF
Sbjct: 241 QDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSLERLF 300

Query: 299 PMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNRKK 358
           PMDQSMVV+IDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLP QQNSMLHLGRRNRKK
Sbjct: 301 PMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRRNRKK 360

Query: 359 PKQXXXXXXXXXXXXKKLKEKINEEVKRQEDQMHRLTDEKLPD----TRDIAKKLEHNAS 414
            KQ            KKLK KI+EEVKRQE++M +L++EK+PD      DIAKKLEHNAS
Sbjct: 361 LKQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSEEKIPDHTTSKEDIAKKLEHNAS 420

Query: 415 LEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDPI-P 473
           LEVQQQNRPLAELQKH+ NERLL DDDDELPHL +ILL+VHSAYYDQL++   G   + P
Sbjct: 421 LEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATELSP 480

Query: 474 DIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLIT 533
           DIK L+P LKE VF+GC FVFSGLIPLHTNI+RADIVLWTN FGA TT N+DYNTTHLIT
Sbjct: 481 DIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHLIT 540

Query: 534 RTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENFKRD 593
           +TPGTMKARLA SFN  IKIVHPDWIFEC+V W+RV+E PYELIVEEPV +EYLENFK++
Sbjct: 541 KTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLENFKKE 600

Query: 594 LAEAQK---KVDPPAQDSR-----SSLLLLDGNGSWLDYDDDEMDEFLNEESDNEE 641
           L E +K    VD      +      +++LL G+ SWLD +DDEMDEFLN +SD+E+
Sbjct: 601 LEETEKSKNSVDANISSQKYETFNDAMILLGGSDSWLD-NDDEMDEFLN-DSDSED 654

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/640 (68%), Positives = 529/640 (82%), Gaps = 20/640 (3%)

Query: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAGKARKQ 60
           M+T ++LPD+LPYPITIAQL  STGD ++KGQRL AYKYW+  DV+T+P +  + K +KQ
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDT-STKPKKQ 59

Query: 61  RVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVED 120
           RVDL+GTFDSPV G +VS ++ +GDEFVNS   V EI+QAC HDVTYGGLCV CG++VE+
Sbjct: 60  RVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEE 119

Query: 121 -EAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIHC 179
             + +A    Q KLT+SHTNT+I++SERQAA++ ++AQ +LR+ +KLVLVVDLDQTVIHC
Sbjct: 120 YSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQLRKLKKLVLVVDLDQTVIHC 179

Query: 180 GVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRPGLK 239
           GVDPTIGEWS+DP NPNYEALKD++SF+L EEP+LPPFYMGPKPP RKCWYYVKLRPGLK
Sbjct: 180 GVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLRPGLK 239

Query: 240 EFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLERLFP 299
           EFF KIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGS+T KSLERLFP
Sbjct: 240 EFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLFP 299

Query: 300 MDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNRKKP 359
           MDQSMVV+IDDRGDVWNWCENLIKVVPY FFVG+GDINSNFLP QQNSMLHLGRR+RKK 
Sbjct: 300 MDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRHRKKA 359

Query: 360 KQXXXXXXXXXXXXKKLKEKINEEVKRQEDQMHRLTDEKLPD----TRDIAKKLEHNASL 415
           ++            KKL+EKI+EEVKRQE+++ ++T+EK P+      D+AKKLEH+ASL
Sbjct: 360 EE-EELLTDILDTEKKLQEKIDEEVKRQEEKLSKMTEEKQPEDTNSKEDLAKKLEHSASL 418

Query: 416 EVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDPIPDI 475
           EVQQQNRPLAELQKH+ N++LL DDDDELPHL  ILL+VH  YY+ L +++S     P+I
Sbjct: 419 EVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKHSSP----PNI 474

Query: 476 KILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLITRT 535
           K LMP+LK+ VF  C FVFSGLIPL T++ +ADI LWT+MFGA TTA++D  TTH+IT+T
Sbjct: 475 KNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKT 534

Query: 536 PGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENFKRDL- 594
           PGT KARLAK+FNP IK+VHPDWIFECLV W+RV+E  YEL++E+PV EE L++FK+ L 
Sbjct: 535 PGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSEEELDDFKKKLE 594

Query: 595 -----AEAQKKVDPPAQDSRSSLLLLDGNGSWLDYDDDEM 629
                A+ Q++VD  + D    + LL GN SWLD DDDEM
Sbjct: 595 NEKKDAQIQEEVDRVSSD---EINLLAGNDSWLDNDDDEM 631

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/643 (67%), Positives = 517/643 (80%), Gaps = 17/643 (2%)

Query: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAGKARKQ 60
           M+TPIRLP +LP+PITIA+L VS G++V KGQRL  YKYW+L DVITAP EE + K  K+
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNEEASKK--KR 58

Query: 61  RVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVE- 119
           RVDL+GTFDSP+ GT+VSL VRVGDEFVN    + E+RQ C H+VTYG LCV CG+AV+ 
Sbjct: 59  RVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVDE 118

Query: 120 -DEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIH 178
            D   +  GV   KLTV+H NT+I+VSERQAAS+ ++AQ +LRE +KLVLVVDLDQTVIH
Sbjct: 119 DDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTVIH 178

Query: 179 CGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRPGL 238
           CGVDPTI EW+ DP+NPNY+ALK+V++FSLDE+P+LPPFYMGP+PP R+C YYVKLRPGL
Sbjct: 179 CGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRRCQYYVKLRPGL 238

Query: 239 KEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLERLF 298
           +EFF K+APHFELHIYTMATRAYALEIAKIIDP   LFGDRILSRDENGSLT KSLERLF
Sbjct: 239 QEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSLERLF 298

Query: 299 PMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNRKK 358
           PMDQSMVV+IDDRGDVW+WCENLIKVVPY+FFVG+GDINSNFLP QQNSMLH+GRR+RKK
Sbjct: 299 PMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRRHRKK 358

Query: 359 PKQXXXXXXXXXXXXKKLKEKINEEVKRQEDQMHRLTDEKLPD----TRDIAKKLEHNAS 414
            ++            KKL+EKI++EVK+QE++ +++++E  PD      D+ KKLEHNAS
Sbjct: 359 AEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFNKISEENQPDRSMSKEDLTKKLEHNAS 417

Query: 415 LEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDPIPD 474
           LEVQQQNRPLAELQKHM N++LL DDDDELPHL  ILL VH  YY++L +     +  PD
Sbjct: 418 LEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAK----TEVFPD 473

Query: 475 IKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLITR 534
           IK+LMP++K  VF  C FVFSGLIPL TNI  ADIVLWTNMFGA T++++D NTTH+IT+
Sbjct: 474 IKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVITK 533

Query: 535 TPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENFKRDL 594
           TPGT KARLAKS+NP IKIVHPDWIFECLV W R +E PYELI+E+ V  + LE F+R+L
Sbjct: 534 TPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQRNL 593

Query: 595 AEAQ----KKVDPPAQDSRSSLLLLDGNGSWLDYDDDEMDEFL 633
            + Q       +   Q++   L LL GN  WLD DDDEMDEFL
Sbjct: 594 KKRQMAEKAARESLQQETGEELNLLAGNDMWLDNDDDEMDEFL 636

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/643 (66%), Positives = 518/643 (80%), Gaps = 17/643 (2%)

Query: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAGKARKQ 60
           M+TPIRLP +LP+P+TIA+L VSTGD+V+KGQRL  YKYW+L D+ITAP EE   K R  
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEEAPKKKR-- 58

Query: 61  RVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVE- 119
           RVDL+GTFDSPV GT+VSL++ +GDEFVN    + E+ Q C H+VTYGGLCV CG+ VE 
Sbjct: 59  RVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVEE 118

Query: 120 -DEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIH 178
            D+  + +G+  +KLTV+H NT+I+VSERQAA++ ++AQ  LRE +KLVLVVDLDQTVIH
Sbjct: 119 DDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTVIH 178

Query: 179 CGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRPGL 238
           CGVDPTI EW+ DP+NPNY+ALK+V++FSLDE+P+LPPFYMGP+PP RKC YYVKLRPGL
Sbjct: 179 CGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRKCQYYVKLRPGL 238

Query: 239 KEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLERLF 298
           +EFF KIAPHFELHIYTMATRAYALEIAKIIDP G+LFGDRILSRDENGSLT KSLERLF
Sbjct: 239 QEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSLERLF 298

Query: 299 PMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNRKK 358
           PMDQSMVV+IDDRGDVW+WCENLIKVVPY+FFVG+GDINSNFLP QQNSMLHLGRRNRKK
Sbjct: 299 PMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRRNRKK 358

Query: 359 PKQXXXXXXXXXXXXKKLKEKINEEVKRQEDQMHRLTDEKLPD----TRDIAKKLEHNAS 414
            ++            KKL+EKI++EVK+QE++ +++ +E  P+      D+ KKLEHNAS
Sbjct: 359 AEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFNKINEENQPERPISKEDLTKKLEHNAS 417

Query: 415 LEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDPIPD 474
           LEVQQQNRPLAELQKHM N++LL DDDDELPHL NILL VH  YYD+L    + +   PD
Sbjct: 418 LEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKL----AEQGQPPD 473

Query: 475 IKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLITR 534
           IK LMP++K  VF+ C FVFSGLIPL TN+ +ADIVLWT+MFGA+T+ ++D  TTH+IT+
Sbjct: 474 IKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVITK 533

Query: 535 TPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENFKRDL 594
           TPGT KARLAK++NP IK++HPDWIFECLV W RV E PYEL  E+ V  E LE FK+ L
Sbjct: 534 TPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFKKRL 593

Query: 595 AEAQKK----VDPPAQDSRSSLLLLDGNGSWLDYDDDEMDEFL 633
            + ++      +   Q++   L LL GN  WLD DDDEMDEFL
Sbjct: 594 DKKKQSEKALSESIQQEATQELNLLTGNDLWLDNDDDEMDEFL 636

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/648 (62%), Positives = 487/648 (75%), Gaps = 36/648 (5%)

Query: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAGKARKQ 60
           + T +++   LPYPIT+AQL V  GD VEKGQRL AY+YWD  DV+    E    K +KQ
Sbjct: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEE----KTKKQ 58

Query: 61  RVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVED 120
           RVD V TFDSPV+GTV      V DEF ++   V+ IRQ C HD+TYGGLCVQCG  V++
Sbjct: 59  RVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVDE 118

Query: 121 EAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIHCG 180
           E  + +      LT+SH NT+I+VSE+QA +L +S+  +LRE +KLVLVVDLDQTVIHCG
Sbjct: 119 EDNSKN------LTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCG 172

Query: 181 VDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRPGLKE 240
           VDPTIGEW +DP NPNY+AL+DV+SF+L++EP++P FY GPKPP RK WYYVKLRPGLKE
Sbjct: 173 VDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLKE 232

Query: 241 FFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLERLFPM 300
           FF  ++PHFE+HIYTMATR+YA EIAKIIDP G+LFGDRILSRDENGSLT KSLERLFPM
Sbjct: 233 FFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFPM 292

Query: 301 DQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNRKKPK 360
           DQSMVVVIDDRGDVWNW ENLIKVVPY FFVGIGDINSNFLP QQNS+LHLGR +R+K +
Sbjct: 293 DQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRK-Q 351

Query: 361 QXXXXXXXXXXXXKKLKEKINEEVKRQEDQMHRLTDEKL------PDTRDIAKKLEHNAS 414
           +            KKLKEKI+EEVKRQE+ +  + D+        P+  DI+KKLEH+AS
Sbjct: 352 EEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHSAS 411

Query: 415 LEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDPIPD 474
           LEVQQQNRPLAELQKH+ N+ LL DDDDELPHL  ILL+VH  Y++Q   Y       PD
Sbjct: 412 LEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQ---YTEAPKNPPD 468

Query: 475 IKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLITR 534
           IK L+P++K  VF+GC FVFSGLIPL T++ +ADIVLWT+MFGA+T+++++Y TTH+IT 
Sbjct: 469 IKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKTTHIITT 528

Query: 535 TPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENFKRDL 594
           T  T KARLAKSFNP IKIVHPDW+FECLV WERV+ESPYEL++++PV E+ ++ FK  L
Sbjct: 529 TSRTFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPVDEDKVKEFKEKL 588

Query: 595 AEAQKKVDPPAQDSR-------------SSLLLLDGNGSWLDYDDDEM 629
               KK+  P+                     LL GN SWLD DDDEM
Sbjct: 589 ---DKKISNPSSSVNPFEDGNEDEEVLGDEFHLLAGNDSWLDNDDDEM 633

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/636 (59%), Positives = 478/636 (75%), Gaps = 23/636 (3%)

Query: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAGKARKQ 60
           M+TP+  P+ LPYPITI QL    G  VEKGQRL A+K+W +V++ ++P E E G  +K 
Sbjct: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGHRKKT 60

Query: 61  RVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVED 120
             + +  F++P  G ++S +V VGDE V   + + EI + C HD+ YGGLC  CG+ V D
Sbjct: 61  VRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEV-D 119

Query: 121 EAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIHCG 180
           E+   +G     L +SHT+ +++VS ++A  +  + + +LRE++KLVLVVDLDQTVIHCG
Sbjct: 120 ESEQFNG----NLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIHCG 175

Query: 181 VDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRPGLKE 240
           VDPTIGEW +D +NPNYEALKDVQSF+LDEEP+LP  YMGPKPP RKCWYYVK+RPGLKE
Sbjct: 176 VDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGLKE 235

Query: 241 FFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLERLFPM 300
           FF K+AP FE+HIYTMATRAYALEIAKIIDPDG LFGDRILSRDENGS+TQKSLERLFP 
Sbjct: 236 FFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLFPT 295

Query: 301 DQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNRKKPK 360
           DQSMVVVIDDRGDVWNWC NLIKVVPY+FFVG+GDINSNFLP QQN+ML LGR  RKK +
Sbjct: 296 DQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKKTQ 355

Query: 361 QXXXXXXXXXXXXKKLKEKINEEVKRQEDQM-HRLTDEK---LPDTRD-IAKKLEHNASL 415
           +            KKL+EKI+EEVKRQE+++ H++   +    P+++D +AKKLE++ASL
Sbjct: 356 ESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPESKDQLAKKLEYSASL 415

Query: 416 EVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDP--IP 473
           EVQQQNRPLA LQKHM N+RLL DDDDEL +L  IL KVH  YY  L     G+D     
Sbjct: 416 EVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTL-----GQDSEKKA 470

Query: 474 DIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLIT 533
           DIK L+P +K  VFE C FVFSGLIPL TNI RADIVLWTNMFGA ++  +D +TTH+IT
Sbjct: 471 DIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVIT 530

Query: 534 RTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENFKRD 593
           RTPGT KAR+AK+FN  IK+VHPDW+FECLV W+ V+E PYELIVE+   +E L ++K+ 
Sbjct: 531 RTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQK 590

Query: 594 LAE-----AQKKVDPPAQDSRSSLL-LLDGNGSWLD 623
           LA      A+++++   + +++  + L  G  SWL+
Sbjct: 591 LARRSSALAEQEMELAMESAKNGTINLFAGGTSWLN 626

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/647 (58%), Positives = 476/647 (73%), Gaps = 23/647 (3%)

Query: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAGK---- 56
           MST I  P  LPYPITI QL    GD V+KG RLLAYK+W +VDV ++P + +       
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSPDDNDVSSPPTA 60

Query: 57  ARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQ 116
            +K   + +  F+SP  G ++S +V +GDE  +  + + EI + C HDV YGGLC  CG+
Sbjct: 61  GKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGE 120

Query: 117 AVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTV 176
            V+++   A G   A LT+SHT+T++++S R+A  +G + + +LR+ +KLVLVVDLDQTV
Sbjct: 121 EVDEDDNDASG-SGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQTV 179

Query: 177 IHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRP 236
           IHCGVDPTIGEW  DP NPN+E LKDV+ FSL+EEP+LP  YMGPKPP RKCWYYVK+RP
Sbjct: 180 IHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKVRP 239

Query: 237 GLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLER 296
           GLKEF  KIAP FE+HIYTMATRAYA EIAKIIDP+G LFGDRILSRDENGS+T KSLER
Sbjct: 240 GLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSLER 299

Query: 297 LFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNR 356
           LFP DQSMV+VIDDRGDVWNW  NLIKVVPY+FFVG+GDINSNFLP QQ +ML LGRR+R
Sbjct: 300 LFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRRSR 359

Query: 357 KKPKQXXXXXXXXXXXXKKLKEKINEEVKRQEDQM-HRLTDEKLPDT------RDIAKKL 409
           +K K             KKLKEKI++EVKRQE+++ H+    + P T       +I+KK+
Sbjct: 360 EKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISKKI 419

Query: 410 EHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGE 469
           E++ASLEVQQQNRPLA LQKH  ++RLL DDDDEL HL + L+++H  YY+ L++   GE
Sbjct: 420 EYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKK--DGE 477

Query: 470 DPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTT 529
               DIK++MP +K+ V + CRFVFSGLIPL T+I+RADIV+WTN FGA +T+++D  TT
Sbjct: 478 LK-ADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTT 536

Query: 530 HLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLEN 589
           H+IT+TPGT KARLAKSFNP IKI+HPDW+FECL  W+ V+E PYELIVE+PV E  LE 
Sbjct: 537 HVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEE 596

Query: 590 FKRDLAE------AQKKVDPPAQDSRSSLLLLDGNGSWLDYDDDEMD 630
           FK+ LA+      A + + P    + + L L  G  SWL  DDDE D
Sbjct: 597 FKKKLAKRQLLATANENLSPANGTNSAELELFSGGMSWL--DDDEGD 641

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/644 (58%), Positives = 476/644 (73%), Gaps = 31/644 (4%)

Query: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEE----AGK 56
           M+TP+  P+SLPYPITI QL    G TV+KGQRL AYK+W +V++ ++P E +    A  
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60

Query: 57  ARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQ 116
           ++K   + +  F+SP  G +VS +V  GDE  ++++ + EI + C HDV YGGLC  CG+
Sbjct: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120

Query: 117 AVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTV 176
            V++     D +E A L +SHT+T+++VS ++A  +    + +LR+++KLVLVVDLDQTV
Sbjct: 121 EVDEN----DQME-ANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTV 175

Query: 177 IHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRP 236
           IHCGVDPTIGEW KDP+NPNYE LKDVQ FSL+EEP++PP YMGP+ P RKCWY+VK+RP
Sbjct: 176 IHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRP 235

Query: 237 GLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLER 296
           GL+EFFA++AP +E+HIYTMATR YALEIAKIIDPDG LFGDRILSRDENGSLTQKSLER
Sbjct: 236 GLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLER 295

Query: 297 LFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNR 356
           LFP DQSMV+VIDDRGDVWNWC NLIKVVPY+FFVG+GDINSNFLP QQ+ +L LGRR  
Sbjct: 296 LFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTH 355

Query: 357 KKPKQXXXXXXXXXXXXKKLKEKINEEVKRQEDQM-HRLTDEKLP----DTRDIAKKLEH 411
           KKP++            K+L+EKI+EEVKRQE+++ H+LT    P        + KKLE+
Sbjct: 356 KKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKKLEY 415

Query: 412 NASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDP 471
           +ASLEVQQQNRPLA LQKHM N+RLL DDDDEL +L + L K+H  YY  L   + G + 
Sbjct: 416 SASLEVQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHRKYYKLL---DEGNEN 472

Query: 472 IPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHL 531
             DI+ L+P +K  VF+ C FVFSGLIPL TNI RADIVLWT MFGA T++ +D NTTH+
Sbjct: 473 SADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHV 532

Query: 532 ITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENFK 591
           IT+TPGT KAR+AK FN  +K+VHPDW+FECLV W  V+E PYELI+++P  EE +++FK
Sbjct: 533 ITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFK 592

Query: 592 RD-----LAEAQKK-------VDPPAQDSRSSLLLLDGNGSWLD 623
           R      L E Q++       +   AQD  S+L L  G  SWL+
Sbjct: 593 RKIEQRHLIEEQRREQFESEALMKTAQD--STLNLFAGGTSWLN 634

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  754 bits (1946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/606 (59%), Positives = 460/606 (75%), Gaps = 16/606 (2%)

Query: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEE-------E 53
           M+TP+  P+ LPYPITI +L    G  +EKG RL AYK+W +V++ ++P +        +
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60

Query: 54  AGKARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQ 113
           A   +K+  + +  FD+P  GT++S ++ VGDE  ++ + + EI++ C HD+ YGGLC Q
Sbjct: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120

Query: 114 CGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLD 173
           CG+ V++   +  G   +  TVSHT+T++++S ++A  +G+  + +LR  +KLVLVVDLD
Sbjct: 121 CGKEVDESEQSQFG---SNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLD 177

Query: 174 QTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVK 233
           QTVIHCGVDPTIGEW  DPNNPNY+ LKDVQ F+L+EEPVLP  YMGPKP  RKCWYYVK
Sbjct: 178 QTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVK 237

Query: 234 LRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKS 293
           +RPGLKEFF K+AP FE+HIYTMATRAYALEI KIIDP G+LFG+RILSRDENGSLT KS
Sbjct: 238 VRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKS 297

Query: 294 LERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGR 353
           LERLFP DQSMV++IDDRGDVWNW  NLIKVVPY FFVG+GDINSNFLP QQ +ML LGR
Sbjct: 298 LERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGR 357

Query: 354 RNRKKPKQXXXXXXXXXXXXKKLKEKINEEVKRQEDQM-HRL--TDEKLPD--TRDIAKK 408
           R+R+K K+            KKL+EKI+EEVKRQE  + H++  T+E + +    +  KK
Sbjct: 358 RSREKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNETKEEWTKK 417

Query: 409 LEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSG 468
           LEH+AS+EVQQQNRPLA LQ+H+ N+RLL DDDDEL  L + L KVH+ YY  L+   S 
Sbjct: 418 LEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILEN-KSL 476

Query: 469 EDPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNT 528
           ++   DIK++MPKLK++VFEGC FVFSGLIPLHT+I RADIV+WT+MFGA +++ ++  T
Sbjct: 477 DESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVT 536

Query: 529 THLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLE 588
           TH+IT+TPGT KARLAKSFN  IKIVHPDW+FECL+ W  V+E PY LIVEEP+ +  L+
Sbjct: 537 THVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELK 596

Query: 589 NFKRDL 594
            F+ DL
Sbjct: 597 KFREDL 602

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/748 (52%), Positives = 511/748 (68%), Gaps = 55/748 (7%)

Query: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEE-------E 53
           MSTP+  P  LPYPIT+ +L V  G  VEKGQRL AYK+W +V++  +P +        E
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60

Query: 54  AGKARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQ 113
             K++++  + +  +++P  G ++S +V   DE       V EI++ C HD+ YGGLC  
Sbjct: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120

Query: 114 CGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLD 173
           CG+ V DE    D    A LT+SHT+T++RVS ++A  L +    +L+  +KLVLVVDLD
Sbjct: 121 CGKEV-DEYDQVD----ANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLD 175

Query: 174 QTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVK 233
           QTVIHCGVDPTIGEW  DP+NPNYE LKDV+ FSL+EEP+LP  YMGPKPP R CWYYVK
Sbjct: 176 QTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVK 235

Query: 234 LRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKS 293
           +RPGLKEFF KIAP +E+HIYTMATRAYALEIAKIIDPD  LFGDRILSRDENGSLTQKS
Sbjct: 236 IRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKS 295

Query: 294 LERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGR 353
           L RLFP DQSMVVVIDDRGDVWNWC NLIKVVPY+FFVG+GDINSNFLP QQ +ML LGR
Sbjct: 296 LTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGR 355

Query: 354 RNRKKPKQXXXXXXXXXXXXKKLKEKINEEVKRQEDQM-HRL-TDEKLPDTRD---IAKK 408
           R R+K K+            KKL+EKI+EEVKRQE+++ H++ T E+  D      IAKK
Sbjct: 356 RTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQESKEKIAKK 415

Query: 409 LEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSG 468
           LE +ASLEVQQQNRPLA+LQKH+ ++RLL DDDDEL +L + L  +H  +Y  L+  ++ 
Sbjct: 416 LEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLE--DAS 473

Query: 469 EDPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNT 528
           +    DI +L+PKLK+ VF+ C FVFSGLIPL T+I+RADIV+WT++FGA +T+++D +T
Sbjct: 474 DQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHT 533

Query: 529 THLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYL- 587
           TH++T+TPGT KARLAK+FNP IK+VHPDWIFECL  W+R++E PY LIVE+PV E+ L 
Sbjct: 534 THVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDELI 593

Query: 588 ----------ENFKRDLAEAQKKVDPPAQDSRSSLLLLDGNGSWLDYDDDEMD------- 630
                     +  +    E +++++  A     ++ L  G+ SWL+ D+DE++       
Sbjct: 594 EFKKKLEQKKKKLEELEIEEEEELNERANQMEPTMPLFGGDTSWLNDDEDEVEFGSDDDN 653

Query: 631 ----EFLNEESDNEEDTEQMAPASKAPRPNGFPSGGE----RPAAVQSQDKPELPEKESN 682
                 ++E++DN         +S++   N  P   E     P+  Q+++  ++P    N
Sbjct: 654 SDEDSLISEDTDN--GLAANGNSSESSITNKVPEATEDVLNNPSDTQNEED-QIPNGNGN 710

Query: 683 GKRPYQPDDAVS------ASKVKLQRTD 704
              P +P D VS      ASK +L   D
Sbjct: 711 -HLPKRPIDDVSENAHEMASKKQLTSKD 737

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/665 (55%), Positives = 467/665 (70%), Gaps = 43/665 (6%)

Query: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGE--------- 51
           M+TP++ PD +PYPITI++L    G  + KG RL AYK+W LV++  +P E         
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60

Query: 52  -EEAGKARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGL 110
            E++ K  ++ +D    FD+P  GT++  +V VGDE V   R V E+++ C HD+ Y G+
Sbjct: 61  GEQSKKTIRESIDF---FDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGI 117

Query: 111 CVQCGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVV 170
           C  CG+ V++    +     A LT+SHT+T+++VS ++A ++GQ+ + +L  ++KL+LVV
Sbjct: 118 CTMCGKEVDERDQVS-----ANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVV 172

Query: 171 DLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWY 230
           DLDQTVIHCGVDPTI EW  DP+NPNYE L++V+SF L+EE +LPP YMGPKPP  KC Y
Sbjct: 173 DLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSY 232

Query: 231 YVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLT 290
           YVK+RPGLKEFF K+AP +E+HIYTMATRAYA EIAKIIDPDG LFG+RILSRDENGSLT
Sbjct: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLT 292

Query: 291 QKSLERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLH 350
            KSLERLFP DQSMVV+IDDRGDVWNW  NLIKV PY+FFVGIGDINSNFLP QQ +ML 
Sbjct: 293 HKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQ 352

Query: 351 LGRRNRKKPKQXXXXXXXX--XXXXKKLKEKINEEVKRQE-DQMHR---LTDEKLPDTR- 403
           +GRRN    K+              KKL+EKI++EVKRQE D  H+   L +E +   R 
Sbjct: 353 MGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRN 412

Query: 404 -DIAKKLEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQL 462
            DI KK+E +ASLEVQQQNRPLAELQKHM N++LL DDDDEL +L  IL  V S +Y  L
Sbjct: 413 GDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKAL 472

Query: 463 QRYNSGEDPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTA 522
           +  N   D    I+ LMPKLK +VF+ C FVFSGLIPL T+I++ADIVLWT MFGAS+T+
Sbjct: 473 ELKNGNSDDTS-IQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTS 531

Query: 523 NLDYNTTHLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPV 582
           N+  NTTH+IT+TPGT+KAR+AKSFNP+IK+VHPDW+FECL  W+ V+E  +EL V++  
Sbjct: 532 NITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVA 591

Query: 583 GEEYLENFKRDLAEAQKKVDPPAQDSRSSLL--------------LLDGNGSWLDYDDDE 628
            E  LE FK++L +  K     A +    L               L  G  SWL   DDE
Sbjct: 592 SERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL--VDDE 649

Query: 629 MDEFL 633
           +++ L
Sbjct: 650 LEDVL 654

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/636 (55%), Positives = 449/636 (70%), Gaps = 64/636 (10%)

Query: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAP----------- 49
           MSTP+  P  LP+PITI QL    G  VEKGQRL AYK+W +V++  +P           
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 50  --------GEEEAGKARKQRVDL---VGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIR 98
                     E    A  Q+  +   +  F+SP  G ++  +V  GDE ++  + + +I+
Sbjct: 61  DLSGNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120

Query: 99  QACPHDVTYGGLCVQCGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQL 158
           + C HD+ Y G+C QCG+ V+D       +  A L++SHT+T++++S ++A  + QS+  
Sbjct: 121 RPCNHDIVYAGICTQCGKEVDDS-----DIMDASLSISHTDTNLKISRKEARDIDQSSMS 175

Query: 159 KLREARKLVLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFY 218
           +L++ +KL+LVVDLDQTVIHCGVDPTIGEW  DP NPNYE LKDV+SFSLDEEP+LPP Y
Sbjct: 176 RLKKIKKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSY 235

Query: 219 MGPKPPTRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGD 278
           MGP+PP RKCWYYVK+RPGLKEFFAKIAP +E+HIYTMATRAYALEIAKIIDPDG LFG 
Sbjct: 236 MGPRPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGS 295

Query: 279 RILSRDENGSLTQKSLERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINS 338
           RILSRDENGSLTQKSLERLFP DQSMV++IDDRGDVWNWC NLIKV+PY+FFVGIGDINS
Sbjct: 296 RILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINS 355

Query: 339 NFLPIQQNSMLHLGRRNRKKPK----------------------QXXXXXXXXXXXXKKL 376
           NFLP QQ++ML LG R+ KK                        +            KKL
Sbjct: 356 NFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKL 415

Query: 377 KEKINEEVKRQEDQMHRLTDEKLPDTRDI---------AKKLEHNASLEVQQQNRPLAEL 427
           ++KI+EEV+RQE    +L  +++P  + I         +KK+E +ASLEVQQQNRPLA L
Sbjct: 416 QKKIDEEVRRQE---KKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATL 472

Query: 428 QKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDPIPDIKILMPKLKETVF 487
           Q+H +N+RLL DDDDEL +L +IL +VH  +Y+QL   +  ++    I+ LMP+LK +VF
Sbjct: 473 QRHRQNQRLLIDDDDELFYLKDILTEVHDTFYEQL---DEDKNESVSIQTLMPRLKFSVF 529

Query: 488 EGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLITRTPGTMKARLAKSF 547
            G  FVFSGLIPL T+I RADIVLWTNMFGA++TA++D NTTH+IT+T GT KARLAK+F
Sbjct: 530 SGYNFVFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAF 589

Query: 548 NPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVG 583
           NP IK+VHPDWIFECLV W+R+ E PYELI+E+P  
Sbjct: 590 NPEIKVVHPDWIFECLVSWKRMPEKPYELIIEQPAS 625

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/604 (58%), Positives = 440/604 (72%), Gaps = 20/604 (3%)

Query: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAG----K 56
           MSTP+  P  LPYPITI++L  S G  VEKGQRL AYK+W +V++  +P E + G     
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60

Query: 57  ARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQ 116
           ++K   + +  FDSP  G +VS +V VGDE V   + + EI + C HD+ Y G+C  CG+
Sbjct: 61  SKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGK 120

Query: 117 AVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTV 176
            V++    +D V  A LT+SHT+T+++VS R+A  +GQ  + +L   +KL+LVVDLDQTV
Sbjct: 121 EVDE----SDQV-SANLTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVVDLDQTV 175

Query: 177 IHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRP 236
           IHCGVDPTI EW  DP NPN+E L+DV+SF L+EEP+LPP YMGPKPPT KCWYYVK+RP
Sbjct: 176 IHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRP 235

Query: 237 GLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLER 296
           GLKEFF +++  +E+HIYTMATR+YA EIAKIIDPDG LF DRILSR+ENGSLT KSLER
Sbjct: 236 GLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLER 295

Query: 297 LFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNR 356
           LFP DQSMVVVIDDRGDVWNWC NLIKV PY+FFVGIGDINSNFLP QQ +ML LGRRN 
Sbjct: 296 LFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNH 355

Query: 357 KKPKQXXXXXXXXXXXXKKLKEKINEEVKRQEDQMHR----LTDEKLPDTR--DIAKKLE 410
           KK +             KKL+EKI+EEVKRQE+ +      L +E     R  DI KK+E
Sbjct: 356 KKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKIE 415

Query: 411 HNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGED 470
            +ASLEVQQQNRPLAELQKHM N++LL DDDDEL +L +IL  V   YY++L+      D
Sbjct: 416 FSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELKT-----D 470

Query: 471 PIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTH 530
               I+ LMPKLK+ V EGC FVFSGLIPL TNI++ADIVLWTNMFGA ++A++  +TTH
Sbjct: 471 KEIQIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTH 530

Query: 531 LITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENF 590
           +IT+TP T KA++AK+F   IK++HPDW+FECL+ W+ + E PYE  +     ++ L  F
Sbjct: 531 VITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELNEF 590

Query: 591 KRDL 594
           K  L
Sbjct: 591 KEAL 594

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/659 (53%), Positives = 461/659 (69%), Gaps = 40/659 (6%)

Query: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEE------- 53
           M+T IR P  LPYPI I +L  S G  + +G RLL YK+W LV+  +  G+++       
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60

Query: 54  AGKA--------RKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDV 105
            G A         KQ  + +  F+SP  G ++S +V VGDE   + + + EI++ C HD+
Sbjct: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 106 TYGGLCVQCGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARK 165
            YGGLC QCG+ V     +AD  +   L V   +  +++SE +A   G++ +  LR  +K
Sbjct: 121 VYGGLCTQCGKEV-----SADAFDGVPLDVV-GDVDLQISETEAIRTGKALKEHLRRDKK 174

Query: 166 LVLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPK--- 222
           L+LVVDLDQT+IHCGVDPTI EW  DPNNPN+E L+DV+SF+LDEE VLP  YM      
Sbjct: 175 LILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSM 234

Query: 223 ---PPTRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDR 279
              PP RKCWYYVK+RPGLKEFFAK+AP FE+HIYTMATRAYAL+IAKI+DP G+LFGDR
Sbjct: 235 LRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDR 294

Query: 280 ILSRDENGSLTQKSLERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSN 339
           ILSRDENGSLT KSL +LFP DQSMVVVIDDRGDVWNWC NLIKVVPY+FFVG+GDINSN
Sbjct: 295 ILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSN 354

Query: 340 FLPIQQNSMLHLGRRNRKKPKQXXXXXXXXXXXXKKLKEKINEEVKRQEDQM-HRLTDEK 398
           FLP Q   ML LGR+ R+K ++            KKL+EKI++EVKRQE+++ H+L   +
Sbjct: 355 FLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAE 414

Query: 399 LP----DTRDIAKKLEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKV 454
            P       ++ KKLE++ASLEVQQQNRPLA+LQKH+ +++LL DDDDEL +L   L  +
Sbjct: 415 EPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNI 474

Query: 455 HSAYYDQLQRYNSGEDPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTN 514
           H  YYD L + N   +P P++  ++P LK+ VF+ C FVFSGLIPL T+I+R+DIV+WT+
Sbjct: 475 HKTYYDMLSQQN---EPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTS 531

Query: 515 MFGASTTANLDYNTTHLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPY 574
            FGA++T ++DY TTHLIT+ P T KARLAK FNP IKIVHPDWIFECLV W++V+E PY
Sbjct: 532 TFGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPY 591

Query: 575 ELIVEEPVGEEYLENFKRDLAEAQKKVDPPAQD-----SRSSLLLLDGNGSWLDYDDDE 628
            LIV+ P+ +E L+NF+  L + Q+ ++   +      S+ +L L     SWL+ DDDE
Sbjct: 592 TLIVDSPISDEELQNFQTQLQKRQEYLEETQEQQHMLTSQENLNLFAAGTSWLNNDDDE 650

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/660 (52%), Positives = 460/660 (69%), Gaps = 41/660 (6%)

Query: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAGKA--- 57
           M+T IR P+ LPYPI I +L  S G  + +G RL+ YK+W LV+  +    ++  +    
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60

Query: 58  -------------RKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHD 104
                         KQ  + +  F+SP  G ++S +V VGDE   + + + EI++ C HD
Sbjct: 61  PGGGAGSGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120

Query: 105 VTYGGLCVQCGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREAR 164
           + YGGLC QCG+ V   A A DGV    L V   +  +++SE +A   G++ +  LR  +
Sbjct: 121 IVYGGLCTQCGKEVS--ADAFDGV---PLDVV-GDMDLQISETEAIRSGEALKEHLRRDK 174

Query: 165 KLVLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPK-- 222
           KL+LVVDLDQT+IHCGVDPTI EW  DPNNPN+E L+DV+SF+LDEE VLP  YM     
Sbjct: 175 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGS 234

Query: 223 ----PPTRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGD 278
               PP RKCWYYVK+RPGLKEFF K+AP FE+HIYTMATRAYA++IAKI+DP G+LFGD
Sbjct: 235 VLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGD 294

Query: 279 RILSRDENGSLTQKSLERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINS 338
           RILSRDENGSLT KSL +LFP DQSMVVVIDDRGDVWNWC NLIKVVPY+FFVG+GDINS
Sbjct: 295 RILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINS 354

Query: 339 NFLPIQQNSMLHLGRRNRKKPKQXXXXXXXXXXXXKKLKEKINEEVKRQEDQM-HRLTDE 397
           NFLP Q   ML LGR+ R+K ++            KKL+EKI++EVKRQE+++ H+L   
Sbjct: 355 NFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATA 414

Query: 398 KLPDTR----DIAKKLEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLK 453
           + P       ++ KKLE++ASLEVQQQNRPLA+LQKH+ +++LL DDDDEL +L   L  
Sbjct: 415 EEPSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSN 474

Query: 454 VHSAYYDQLQRYNSGEDPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWT 513
           +H+ YY  + + N   +P P++  ++P LK+ VF+ C FVFSGLIPL T+I+R+DIV+WT
Sbjct: 475 IHNTYYQMISQSN---EPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWT 531

Query: 514 NMFGASTTANLDYNTTHLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESP 573
           + FGA++T+++DY TTHLIT+ P T KARLAK FNP IKI+HPDWIFECLV W++V+E P
Sbjct: 532 STFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKP 591

Query: 574 YELIVEEPVGEEYLENFKRDLAEAQKKVDPPAQDS-----RSSLLLLDGNGSWLDYDDDE 628
           Y LIV+ P+ +E L+NF++ L + Q+ ++   Q       + +L L     SWL+ DDDE
Sbjct: 592 YTLIVDSPISDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLNLFAAGTSWLNNDDDE 651

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/653 (54%), Positives = 457/653 (69%), Gaps = 40/653 (6%)

Query: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEE------- 53
           M+T IR P+ LPYPI I +L  S G  + +G RLL YK+W LV+  +  G ++       
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60

Query: 54  AGKA--------RKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDV 105
            G A         KQ  + +  F+SP  G ++S +V VGDE   + + + EI++ C HD+
Sbjct: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 106 TYGGLCVQCGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARK 165
            YGGLC QCG+ V   A A DGV    L V   +  +++SE +A   G++ +  LR  +K
Sbjct: 121 VYGGLCTQCGKEVS--ADAFDGV---PLDVV-GDMDLQISETEAIRTGKALKEHLRRDKK 174

Query: 166 LVLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPK--- 222
           L+LVVDLDQT+IHCGVDPTI EW  DPNNPN+E L+DV+SF+LDEE VLP  YM      
Sbjct: 175 LILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSV 234

Query: 223 ---PPTRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDR 279
              PP RKCWYYVK+RPGLKEFFAK+AP FE+HIYTMATRAYAL+IAKI+DP GKLFGDR
Sbjct: 235 LRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDR 294

Query: 280 ILSRDENGSLTQKSLERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSN 339
           ILSRDENGSLT KSL +LFP DQSMVVVIDDRGDVWNWC NLIKVVPY+FFVG+GDINSN
Sbjct: 295 ILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSN 354

Query: 340 FLPIQQNSMLHLGRRNRKKPKQXXXXXXXXXXXXKKLKEKINEEVKRQEDQM-HRLTDEK 398
           FLP Q   ML LGR+ R+K ++            KKL+EKI++EVKRQE+++ H+L   +
Sbjct: 355 FLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAE 414

Query: 399 LP----DTRDIAKKLEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKV 454
            P       ++ KKLE++ASLEVQQQNRPLA+LQKH+ +++LL DDDDEL +L   L  +
Sbjct: 415 EPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNI 474

Query: 455 HSAYYDQLQRYNSGEDPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTN 514
           H  YY  L + N   +P P++  ++P LK+ VF+ C FVFSGLIPL T+I+R+DIV+WT+
Sbjct: 475 HMTYYQMLSQEN---EPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTS 531

Query: 515 MFGASTTANLDYNTTHLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPY 574
            FGA++T+++D+ TTHLIT+ P T KARLAK FNP IKIVHPDWIFECLV W++V+E PY
Sbjct: 532 TFGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPY 591

Query: 575 ELIVEEPVGEEYLENFKRDLAEAQKKVDPPAQD-----SRSSLLLLDGNGSWL 622
            LIV+ P+ +E L+NF+  L + Q+ ++   +      S+ +L L     SWL
Sbjct: 592 TLIVDSPISDEELQNFQSQLQKRQEYLEENQEQQHMLTSQENLNLFATGTSWL 644

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/653 (53%), Positives = 456/653 (69%), Gaps = 39/653 (5%)

Query: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVD--------------VI 46
           M+T IR P+ LPYPI I +L  S G  +++G RLL YK+W LV+                
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSDAGDDDNDHDSSP 60

Query: 47  TAPGEEEAGKARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVT 106
              G        KQ  + +  F+SP  G ++S +V VGDE   + + + EI++ C HD+ 
Sbjct: 61  GGGGGGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120

Query: 107 YGGLCVQCGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKL 166
           YGGLC QCG+ V   A A DGV    L V   +  +++SE +A   G++ +  LR  +KL
Sbjct: 121 YGGLCTQCGKEVS--ADAFDGV---PLDVV-GDMDLQISETEAIRTGRALKEHLRRDKKL 174

Query: 167 VLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMG-----P 221
           +LVVDLDQT+IHCGVDPTI EW  DPNNPN+E L+DV+SF+LDEE VLP  YM      P
Sbjct: 175 ILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVP 234

Query: 222 KPP-TRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRI 280
           KPP  RKCWYYVK+RPGLKEFFAK+AP FE+HIYTMATRAYAL+IAKI+DP G+LFGDRI
Sbjct: 235 KPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRI 294

Query: 281 LSRDENGSLTQKSLERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNF 340
           LSRDENGSLT KSL +LFP DQSMVVVIDDRGDVWNWC NLIKVVPY+FFVG+GDINSNF
Sbjct: 295 LSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNF 354

Query: 341 LPIQQNSMLHLGRRNRKKPKQXXXXXXXXXXXXKKLKEKINEEVKRQEDQM-HRLTDEKL 399
           LP Q   ML LGR+ R+K ++            KKL+EKI+ EVKRQE+Q+ H+L   + 
Sbjct: 355 LPKQSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEE 414

Query: 400 PDT----RDIAKKLEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVH 455
           P       ++ KKLE++ASLEVQQQNRPLA+LQKH+ +++LL DDDDEL +L + LL +H
Sbjct: 415 PSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTLLNIH 474

Query: 456 SAYYDQLQRYNSGEDPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNM 515
             YY  L +    E   P++  ++P LK+ VF+ C FVFSGLIPL T+I+R+DIV+WT+ 
Sbjct: 475 KTYYQMLSQPGEIE---PNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTST 531

Query: 516 FGASTTANLDYNTTHLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYE 575
           FGA++T++++Y TTHLIT+ PGT KARLAK FNP IK+VHPDWIFECLV W++V+E PY 
Sbjct: 532 FGATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYT 591

Query: 576 LIVEEPVGEEYLENFKRDLAEAQKKVDPPAQDS-----RSSLLLLDGNGSWLD 623
           LIV+ P+ ++ L++F++ L + Q+ +D   +       + ++ L     SWL+
Sbjct: 592 LIVDSPISDDELQSFQKQLQKKQEYLDEHHEQQHMLMPQENINLFAAGTSWLN 644

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/540 (61%), Positives = 419/540 (77%), Gaps = 15/540 (2%)

Query: 68  FDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVEDEAGAADG 127
           FD P  G + S  V  GD+ V   +P+ EI++ C HDV YGGLC  CG+ V++     D 
Sbjct: 116 FDCPYDGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDE--NDIDD 173

Query: 128 VEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIHCGVDPTIGE 187
           +    LT+SHT+T++++S R+A  +GQS + +LR+ +KL+LVVDLDQTVIHCGVDPTIGE
Sbjct: 174 LSGPNLTISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVDPTIGE 233

Query: 188 WSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRPGLKEFFAKIAP 247
           W +DP NPN+E LKDV+ F+L+EEP+LP  YMGPKPP RKCWYYVK+RPGLK+FF K+AP
Sbjct: 234 WKRDPTNPNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAP 293

Query: 248 HFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLERLFPMDQSMVVV 307
            FE+HIYTMATRAYA EIAKIIDP G LFG+RILSRDENGSLT KSLERLFP DQSMV++
Sbjct: 294 LFEMHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVII 353

Query: 308 IDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNRK-----KPKQX 362
           IDDRGDVWNW  NLIKV+PY+FFVG+GDINSNFLP QQ +ML LGRR+ +       K+ 
Sbjct: 354 IDDRGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKEN 413

Query: 363 XXXXXXXXXXXKKLKEKINEEVKRQEDQM-HRL-TDEKLPDT-----RDIAKKLEHNASL 415
                      K L+ KINEEVKRQE+++ H+L T E+ P T      +I+KK+E++ASL
Sbjct: 414 DDLLTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASL 473

Query: 416 EVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDPI-PD 474
           EVQQ+NRPLA LQKH  ++RLL DDD+EL HL + L K+HS YY+ LQ+ N  +D I PD
Sbjct: 474 EVQQKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPD 533

Query: 475 IKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLITR 534
           IK +MP++K+TV + C FVFSGLIPL TNI+++DIV+WTNMFGA +TA++D NTTH+IT+
Sbjct: 534 IKYIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITK 593

Query: 535 TPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENFKRDL 594
           TPGT KARLAKS++P IKIVHPDW+FECL+ W+ VEE PYEL+VE+ V ++ L +F R L
Sbjct: 594 TPGTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKL 653

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/666 (54%), Positives = 457/666 (68%), Gaps = 47/666 (7%)

Query: 3   TPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAGK------ 56
           TP+     LPYP+T+ +L    GD V +G RL AYK+W +V++       E         
Sbjct: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66

Query: 57  ARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQ 116
           A+K   + V  F+SP  GTVVS DV  GDE      P+  +R+ C HDV Y GLC  CG+
Sbjct: 67  AKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGR 126

Query: 117 AVED----EAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDL 172
            V++     A AA G     LTVSH +T++++S  +A  L    Q +LR A+KLVLVVDL
Sbjct: 127 EVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQKLVLVVDL 186

Query: 173 DQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPT-RKCWYY 231
           DQTV+HCGVDPTIGEW +DP NPNYEAL+DVQSF+L+EEP+LP  Y+G K P  RKCWYY
Sbjct: 187 DQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYY 246

Query: 232 VKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQ 291
           VK+RPGLK+FF ++AP FE+HIYTMATRAYALEIAKIIDPD  LFGDRILSRDENGSLT 
Sbjct: 247 VKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTH 306

Query: 292 KSLERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHL 351
           KSLERLFP DQSMV VIDDRGDVWNWC NLIKVVPY+FFVG+GDINSNFLP QQ +ML +
Sbjct: 307 KSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQM 366

Query: 352 GRRNRKKPK-----------QXXXXXXXXXXXXKKLKEKINEEVKRQEDQMHRLT----D 396
           GRR++   +           +            K+L+EKI++EVKRQE ++++      +
Sbjct: 367 GRRSKLNERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE 426

Query: 397 EKLP--DTRDIAKKLEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKV 454
           ++ P     +  KKLE +AS+EVQQ+NRPLA LQKH+ N++LL D+DDEL +L + L  +
Sbjct: 427 QQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLADL 486

Query: 455 HSAYYDQLQRYNSGEDPI-PDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWT 513
           H  YY  L+     E+P   +I+ +M +LK  VF+ C FVFSGLIPL+TN++ ADIV+WT
Sbjct: 487 HKRYYSTLK-----ENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWT 541

Query: 514 NMFGASTTANLDYNTTHLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESP 573
           N FGA+TT +LD  TTHLIT+TPGT KARLAK+FNP IKIVHPDWIFECL+ WERV+  P
Sbjct: 542 NKFGATTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKP 601

Query: 574 YELIVEEPVGEEYLENFKRDLAEAQKKVDPPAQDSRSSLL-----------LLDGNGSWL 622
           Y LIVE+PV E  +  FK  L   +++ +   Q SR++LL           L  G  SWL
Sbjct: 602 YLLIVEDPVSEAQVREFKEKLTRQKERAE--RQTSRTALLPANKPAEPDIDLFAGGISWL 659

Query: 623 DYDDDE 628
           + +DDE
Sbjct: 660 NDEDDE 665

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 4/82 (4%)

Query: 514 NMFGASTTANLDYNTTHLITRT---PGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVE 570
           N  G + T  ++  TTHLI      P  +  +     N  IK V+P W+ +C    + ++
Sbjct: 158 NSLGGTITHVINNKTTHLIAIAIDDPAIIAIKEKGQNNTIIKSVYPTWLVQCFKERKYID 217

Query: 571 ESPYELIVEEPVGEEYLENFKR 592
           ESP+ LI E+    E+L++  R
Sbjct: 218 ESPH-LITEDQNNSEHLDDIWR 238

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 8/90 (8%)

Query: 473 PDIKILMPKLKETVFEGCRFVFSGLIPLHTNI---ERADIVLWTNMFGASTTANLDYNTT 529
           P+  +L    K+ +F+      S LI  +TN    +R+ I   T M G  +T  L    T
Sbjct: 343 PNTNLLFEPFKKKIFKS-----SELILTYTNYFGRQRSYIQRLTEMLGGISTTELSKRNT 397

Query: 530 HLITRTPGTMKARLAKSFNPAIKIVHPDWI 559
           HL++R P   K   AK +    ++++  W+
Sbjct: 398 HLVSRMPVGKKFFQAKKWKDRCQVINHLWL 427

>KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.94
           YHR154W
          Length = 951

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 45/82 (54%), Gaps = 4/82 (4%)

Query: 500 LHTNIERADIVLWTNM---FGASTTANLDYNTTHLITRTPG-TMKARLAKSFNPAIKIVH 555
           L  + E ++ +L+T +    G +   N++  TTH+IT  P  +    L ++   +IK ++
Sbjct: 133 LKPSFEASEYLLYTELIHSMGGTCVENINNKTTHIITTNPKESCFEILKRNGTTSIKYIY 192

Query: 556 PDWIFECLVGWERVEESPYELI 577
           P W+  C+   + ++ES +E++
Sbjct: 193 PTWLIHCVKESQLIDESEHEIV 214

>Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON}
           (138268..141444) [3177 nt, 1059 aa]
          Length = 1058

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 497 LIPLHTNI---ERADIVLWTNMFGASTTANLDYNTTHLITRTPGTMKARLAKSFNPAIKI 553
           LI  +TN+   +R  I   TN  G  TTA L +    L+   P  MK + A+ +   + I
Sbjct: 349 LILTYTNLFGPQRTYIKTLTNALGGVTTATLSHINNCLVYGIPEGMKYKTAEKWGDKLII 408

Query: 554 VHPDWIFEC 562
           V P+W+ EC
Sbjct: 409 VGPNWLEEC 417

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 48/121 (39%), Gaps = 28/121 (23%)

Query: 161 REARKLVLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMG 220
           R  RK  L++DLD+T++H                    + K V S           F + 
Sbjct: 319 RFGRKKCLILDLDETLVHS-------------------SFKYVDS---------ADFVIP 350

Query: 221 PKPPTRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRI 280
                +    YV  RPG+ EF  +++  +E+ ++T +   Y   +  I+DP   +   R+
Sbjct: 351 VTIDNQTHHVYVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANTIIHHRL 410

Query: 281 L 281
            
Sbjct: 411 F 411

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 231 YVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRIL 281
           YV  RPG+ EF  K+   FE+ I+T +   Y   +   +DP GK    R+ 
Sbjct: 381 YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHHRLF 431

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 38.5 bits (88), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%)

Query: 231 YVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRIL 281
           YV  RPG++EF  ++   FE+ ++T +   Y   +  I+DP  +L   R+ 
Sbjct: 340 YVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQLIHHRLF 390

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 38.1 bits (87), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 8/81 (9%)

Query: 231 YVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDG----KLFGDRILSRDEN 286
           YV  RPG+ EF  ++   +E+ ++T +   Y   +  I+DP G    +LF D   + D N
Sbjct: 267 YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHRLFRDSCYNYDGN 326

Query: 287 --GSLTQ--KSLERLFPMDQS 303
              +L+Q  + L  L  +D S
Sbjct: 327 YIKNLSQIGRPLSDLIILDNS 347

>ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR346W
           (REV1)
          Length = 827

 Score = 38.1 bits (87), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 39/91 (42%), Gaps = 10/91 (10%)

Query: 486 VFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLD--YNTTHLITRTPGTMKARL 543
           +F GCR   +G    HT+ +R ++     M G +    L    + TH++       K RL
Sbjct: 43  IFRGCRVHVNG----HTDPDREELRREIVMHGGTFVHYLARPSDVTHIVAEHVPVAKRRL 98

Query: 544 AKSFNPAIKIVHPDWIFECLVGWERVEESPY 574
                 A K+V P W+  CL   E V   PY
Sbjct: 99  WH----ACKVVRPAWVSACLCSGELVPWKPY 125

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 38.1 bits (87), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%)

Query: 231 YVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKL 275
           YV  RPG+ EF +++   +E+ ++T +   YA  +   +DP+G +
Sbjct: 260 YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]
           {ON} some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 891

 Score = 38.1 bits (87), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 513 TNMFGASTTANLDYNTTHLITRTPGTMKARLAKSFNPAIKI-VHPDWIFECLVGWERVEE 571
            ++FG +    L    TH+IT     +  +  + F+    I + P+W+ +CL G E ++E
Sbjct: 146 VSVFGGTCMDYLSTKATHIITWDKNDVAIKAMQKFHKYTVIYLMPNWLVDCLCGLEYIKE 205

Query: 572 SPYELIVEE 580
             Y + V E
Sbjct: 206 DEYLINVNE 214

>Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}
           similar to Ashbya gossypii ADL145C
          Length = 880

 Score = 38.1 bits (87), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 37/83 (44%), Gaps = 5/83 (6%)

Query: 507 ADIVLWTNMFGASTTANLDY---NTTHLITRTPGTMKARLAKSFNP-AIKIVHPDWIFEC 562
           A+  L+T+M        +DY     TH+IT  P      + K FN   +  V   W+ EC
Sbjct: 134 AEYELYTSMLTYMGGCCMDYLSTKVTHIITSDPKDQAVLVLKRFNKFEVLTVSSAWLAEC 193

Query: 563 LVGWERVEESPYELIVEEPVGEE 585
            V  E V E+ Y L+  E   EE
Sbjct: 194 FVRQEYVSEAAY-LVGSEMSNEE 215

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%)

Query: 231 YVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKL 275
           YV  RPG+ EF  +++  +E+ ++T +   YA  +   +DP+G +
Sbjct: 265 YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 5/80 (6%)

Query: 502 TNIERADIVLWT---NMFGASTTANLDYNTTHLITRTPG--TMKARLAKSFNPAIKIVHP 556
           T   R + +L++   N  G S +  +   TTHLI+  P    + A +A   +  IK V+P
Sbjct: 133 TVFNRTENILYSELINALGGSVSDMISNKTTHLISSDPTDPALIAIVASDCHSRIKQVYP 192

Query: 557 DWIFECLVGWERVEESPYEL 576
            W+ +C +  + V+E  + L
Sbjct: 193 AWLCQCFLEVKYVDEKNFIL 212

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 43/103 (41%), Gaps = 22/103 (21%)

Query: 160 LREARKLVLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYM 219
           L   RK  LV+DLD+T+IH     T       PN+ N +A      F +     L     
Sbjct: 187 LHSGRKKKLVLDLDETLIHSISRST-------PNSNNAQAHLVEVKFPISGISTL----- 234

Query: 220 GPKPPTRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYA 262
                     YYV  RP    F +K+   ++L I+T + + YA
Sbjct: 235 ----------YYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYA 267

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%)

Query: 231 YVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKL 275
           YV  RPG+ EF  +++  +E+ ++T +   YA  +   +DP+G +
Sbjct: 260 YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 50/121 (41%), Gaps = 27/121 (22%)

Query: 161 REARKLVLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMG 220
           ++  K  L++DLD+T++H           K  NNP++               +LP     
Sbjct: 308 KDKHKKCLILDLDETLVHSSF--------KFINNPDF---------------ILPIEIED 344

Query: 221 PKPPTRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRI 280
            +        YV  RPG+  F  ++   +E+ I+T +   YA  +  ++D D  L   R+
Sbjct: 345 GQIHN----VYVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLINHRL 400

Query: 281 L 281
            
Sbjct: 401 F 401

>ZYRO0B15026g Chr2 complement(1222480..1225968) [3489 bp, 1162 aa]
           {ON} weakly similar to uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 1162

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 48/120 (40%), Gaps = 16/120 (13%)

Query: 446 HLGNILLKVHSAYYDQLQRYNSGEDPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNI- 504
           HLGN++   +     Q +         P  K++    K  + E      + LI  +TN  
Sbjct: 314 HLGNLIWVFYMWSLCQFRP--------PTEKLIFSPFKRKLLET-----NQLITAYTNFF 360

Query: 505 --ERADIVLWTNMFGASTTANLDYNTTHLITRTPGTMKARLAKSFNPAIKIVHPDWIFEC 562
             +R  I    N  G  TT+ L    THL+ R P   K   AK++     I +  W+ EC
Sbjct: 361 GQQRFYIQRLVNALGGFTTSELSRRNTHLLCRFPFGKKFETAKNWGDKCVITNYLWLEEC 420

>KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa]
           {ON} Anc_4.156 YLR330W
          Length = 555

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 36/90 (40%), Gaps = 2/90 (2%)

Query: 476 KILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGAS-TTANLDYNTTHLITR 534
           KI +   K T   G       L P+  NI    I     + GA     ++  +TTH I  
Sbjct: 160 KIKLHTHKMTDMSGITVCLGSLDPM-LNISEEQIEKCLQVIGAKPLQKHVSIDTTHFICN 218

Query: 535 TPGTMKARLAKSFNPAIKIVHPDWIFECLV 564
                 A L ++ N  I IV P+WI  C V
Sbjct: 219 DEEEEDAELIRAKNSNIPIVRPEWIRACAV 248

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 2/63 (3%)

Query: 514 NMFGASTTANLDYNTTHLITRTPG--TMKARLAKSFNPAIKIVHPDWIFECLVGWERVEE 571
           N  G +T  ++   TTHLIT  P    + A +A      I  V+P W+ +C      V E
Sbjct: 145 NALGGTTVDHISTLTTHLITNDPTDQAVIATIASEQKQNISFVYPTWLCQCFKSMTLVNE 204

Query: 572 SPY 574
           S +
Sbjct: 205 SDH 207

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 42/98 (42%), Gaps = 8/98 (8%)

Query: 476 KILMPKLKETVFEGCRFVFSGLIPLHTNI---ERADIVLWTNMFGASTTANLDYNTTHLI 532
           KI +   K+ +FE      S LI  +TN    +R  I   T + G   + +L    THLI
Sbjct: 331 KIFLKPFKKKIFER-----SQLILAYTNYFGPQRYYIQRLTRLMGGIASTDLSKKNTHLI 385

Query: 533 TRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVE 570
             +P   K   A      +   +  W+ +C +  E+++
Sbjct: 386 FGSPHGKKYDFAMRRPNILVTTNHSWLEDCYISGEKLD 423

>Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar to
           Ashbya gossypii ADR369C
          Length = 873

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 39/93 (41%), Gaps = 6/93 (6%)

Query: 486 VFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLITRTPGTMKARLAK 545
           VFEGC+   +G         R +IVL    F    T   D   TH++ +     K    +
Sbjct: 90  VFEGCKVYINGRTDPDREQLRKEIVLHGGQFVQYLTKKSD--VTHIVAQNLSAAKCIEFR 147

Query: 546 SFNPAIKIVHPDWIFECLVGWERVEESPYELIV 578
           +F    K+V P WI  C+   + +    Y +IV
Sbjct: 148 NF----KVVQPGWIGACVRIGKMLSWREYSVIV 176

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 231 YVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIID 270
           YV  RPG+ EF  K+   FE+ I+T +   Y   +  I+D
Sbjct: 350 YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILD 389

>KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94
           YHR154W
          Length = 981

 Score = 35.4 bits (80), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 3/92 (3%)

Query: 472 IPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHL 531
           +P  KI+   LK++V      + S     +  ++R+ I   T   G  +T +L    THL
Sbjct: 334 LPSSKIIWGPLKQSVVRSDELILS--FTNYFGLQRSYIQRITERLGGVSTTSLTKRNTHL 391

Query: 532 ITRTPGTMKARLAKSFNPA-IKIVHPDWIFEC 562
           ++R     K  LAK +     ++V+  W+ EC
Sbjct: 392 VSRMAIGKKFELAKQWGGQRCRVVNHLWLEEC 423

>TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON}
           Anc_5.94 YHR154W
          Length = 1065

 Score = 35.0 bits (79), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 39/87 (44%), Gaps = 3/87 (3%)

Query: 492 FVFSGLIPLHTNI---ERADIVLWTNMFGASTTANLDYNTTHLITRTPGTMKARLAKSFN 548
           F  + LI  +T I   +R  I       G  +T  L    THLI   P   K   A+S  
Sbjct: 347 FNVNELILTYTTIYGQQRHYIKNLVTALGGKSTPTLSKRNTHLIFGVPYGKKYNYARSKL 406

Query: 549 PAIKIVHPDWIFECLVGWERVEESPYE 575
             I +V+  W+ +C++   RV E+ +E
Sbjct: 407 NKINVVNIKWLEQCVLLKSRVPENLFE 433

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 44/103 (42%), Gaps = 22/103 (21%)

Query: 160 LREARKLVLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYM 219
           L   +K  LV+DLD+T+IH     T         N +   L +V+ F +   P L     
Sbjct: 246 LNTQKKKKLVIDLDETLIHSASRSTTHS------NSSQGHLVEVK-FGISGIPTL----- 293

Query: 220 GPKPPTRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYA 262
                     Y++  RP    F  K++  ++L I+T + + YA
Sbjct: 294 ----------YFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYA 326

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%)

Query: 231 YVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPD 272
           YV  RPG++EF  ++   FE+ ++T +   Y   +  I+D D
Sbjct: 295 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD 336

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 231 YVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRIL 281
           YV  RPG++EF  ++   FE+ ++T +   Y   +  I+D D K+   R+ 
Sbjct: 282 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDAD-KVIHHRLF 331

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 45/103 (43%), Gaps = 22/103 (21%)

Query: 160 LREARKLVLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYM 219
           L   +K  LV+DLD+T+IH     ++   +  PN+     ++    FS+     L     
Sbjct: 244 LNREKKKTLVMDLDETLIH-----SVSRGTTHPNSSQGHIVE--VKFSISGVSTL----- 291

Query: 220 GPKPPTRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYA 262
                     YYV  RP    F  K++  +++ I+T + + YA
Sbjct: 292 ----------YYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYA 324

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 231 YVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRIL 281
           YV  RPG++EF  ++   FE+ ++T +   Y   +  I+D D K+   R+ 
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD-KVIHHRLF 332

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 81/193 (41%), Gaps = 35/193 (18%)

Query: 158 LKLREARKLVLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPF 217
           LK  + +KL+L  DLD+T+IH     ++          NY  L +V+  +    P   P 
Sbjct: 187 LKTNKRKKLIL--DLDETLIH-----SMSRNISSSTISNYH-LIEVKFPTPTSAPTSAP- 237

Query: 218 YMGPKPPTRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYA------LEIAKIIDP 271
             GP  P     YYV  RP    F   ++  ++L I+T + + YA      LE +   + 
Sbjct: 238 --GPSLPLSSL-YYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNF 294

Query: 272 DGKLFGDRILSRDENGSL---------TQKSLERLFPMDQ---SMVVVIDDRGDVWNWCE 319
             +L+ +  + RD  G +          Q +L  L  +D    S  + +D+   V  W  
Sbjct: 295 QKRLYRNHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGWIS 354

Query: 320 N-----LIKVVPY 327
           +     L+ ++P+
Sbjct: 355 DPTDTELLTLLPF 367

>KLTH0C01584g Chr3 complement(139563..142304) [2742 bp, 913 aa] {ON}
           some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 913

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 65/162 (40%), Gaps = 23/162 (14%)

Query: 472 IPDIKILMPKLKETVFEGCRFVFSGLIPLHTNI---ERADIVLWTNMFGASTTANLDYNT 528
           +P  K+L+  L+  VF   + + S     +TN    +R  I       G  +T  L    
Sbjct: 326 LPQFKLLLSPLRPPVFNKGQLILS-----YTNYLGQQRYYIQKLVEALGGVSTTELTKKN 380

Query: 529 THLITRTPGTMKARLAKSFNPAIKIVHPDWIFEC--------LVGWERVEESPYELIVEE 580
           THL+T  P   K   A  +    KI +  W+ +C         VG  R  E P    +  
Sbjct: 381 THLLTCLPLGQKYEAALRWEGTCKIANHLWLEDCYRKQTQVPFVG-TRYNEIPAPGGLST 439

Query: 581 PVGEEYLENFKRDLAEA--QKKVDPPAQDSRSSLLLLDGNGS 620
            +G+  LE    DL +    ++ D P+Q+     +LL G  S
Sbjct: 440 KLGQMPLEINDEDLTDTILPQEADMPSQNH----ILLRGQDS 477

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 25/42 (59%)

Query: 231 YVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPD 272
           YV  RPG+ EF  +++  +E+ ++T +   YA  +   +DP+
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPN 294

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%)

Query: 231 YVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDP 271
           YV  RPG+ EF   +   +E+ ++T +   Y   +  I+DP
Sbjct: 320 YVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDP 360

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 231 YVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDG----KLFGDRILSRDEN 286
           YV  RPG+ EF  +I   +E+ ++T +   Y   +  I+D D     +LF D   + + N
Sbjct: 282 YVIKRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKDKTIHHRLFRDSCYNYEGN 341

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 225 TRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDP-----DGKLFGDR 279
           T++  +    RPG+  F   ++ ++E+ +++     YA +IA+ +DP        LF + 
Sbjct: 211 TQQSGWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDPIHAFITYNLFKEH 270

Query: 280 ILSRDENGSLTQKSLERLFPMDQSMVVVID-DRGDVWNWCENLIKVVPYD 328
            L +D    +  K L +L   D   V++ID D        EN I + P+D
Sbjct: 271 CLYKD---GVHIKDLSKL-NRDLGKVLIIDTDENSFKLQPENAIYLEPWD 316

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 8/93 (8%)

Query: 473 PDIKILMPKLKETVFEGCRFVFSGLIPLHTNI---ERADIVLWTNMFGASTTANLDYNTT 529
           P  K+L+  L+  +F     + S     +TN    +R  I       G ++T  L    T
Sbjct: 327 PSSKLLLSPLRPKIFHKNELLLS-----YTNYLGQQRFYIQKLVEALGGASTTELSKKNT 381

Query: 530 HLITRTPGTMKARLAKSFNPAIKIVHPDWIFEC 562
           H+++  P   K + A  ++   K+V+  W+ EC
Sbjct: 382 HVLSCMPYGQKYQAAVRWSDTCKVVNHLWLEEC 414

>CAGL0L03410g Chr12 (389484..391679) [2196 bp, 731 aa] {ON} similar
           to uniprot|P47027 Saccharomyces cerevisiae YJL090c DPB11
           involved in DNA replication and S-phase checkpoint
          Length = 731

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 3/77 (3%)

Query: 531 LITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENF 590
            IT  P  ++   A+  N  I ++H  WI +C      ++  PY L+ E  +  E ++  
Sbjct: 170 FITDEPNGVRVDAARKEN--IPVIHYKWILDCYKRNATLQYDPYYLL-EFAMHIEDIKEI 226

Query: 591 KRDLAEAQKKVDPPAQD 607
            RD  +    +D PAQ+
Sbjct: 227 GRDSCDCWDDLDDPAQN 243

>YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative
           maltose-responsive transcription factor
          Length = 470

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 263 LEIAKIIDPDGKLFGDRILSRDENGSLTQKSLERLF 298
           LE+ K+    GK F D + +   NGS T+ SL+R++
Sbjct: 272 LEVIKVFTVPGKYFYDALATNSVNGSYTEDSLKRIW 307

>TDEL0D02950 Chr4 complement(556701..558692) [1992 bp, 663 aa] {ON}
           Anc_4.156 YLR330W
          Length = 663

 Score = 31.6 bits (70), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 36/91 (39%), Gaps = 13/91 (14%)

Query: 476 KILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTAN-LDYNTTHLITR 534
           K+ M   K T   G       L PL  NI  A I    +  GA      +  +TTH +T 
Sbjct: 160 KVKMHTHKMTDMSGITVCLGPLDPL-LNISGAQIAQSLSQMGARPLQRRVAIDTTHFVTN 218

Query: 535 T------PGTMKARLAKSFNPAIKIVHPDWI 559
                  P  MKA+     N  I IV P+W+
Sbjct: 219 DAENDDDPELMKAK-----NSNIPIVRPEWV 244

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,252,541
Number of extensions: 3714798
Number of successful extensions: 18874
Number of sequences better than 10.0: 171
Number of HSP's gapped: 19433
Number of HSP's successfully gapped: 174
Length of query: 728
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 611
Effective length of database: 40,065,477
Effective search space: 24480006447
Effective search space used: 24480006447
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)