Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ABL126W8.840ON62462433970.0
Ecym_46118.840ON63062720570.0
SAKL0D01474g8.840ON62462919640.0
KLTH0C03872g8.840ON62162219180.0
Kwal_27.102588.840ON62062318640.0
YMR278W (PGM3)8.840ON62262918340.0
Suva_13.4668.840ON62262618330.0
TDEL0B005708.840ON63063018260.0
Smik_13.4918.840ON62262618180.0
CAGL0M02981g8.840ON61762517870.0
KAFR0B039208.840ON62462117840.0
KNAG0J002708.840ON62562317810.0
Skud_13.4508.840ON62262917540.0
NCAS0C004108.840ON62562317520.0
ZYRO0G14190g8.840ON61062017470.0
Kpol_1068.88.840ON63262917450.0
NDAI0K004108.840ON62662717350.0
TPHA0I002508.840ON62962817190.0
KLLA0D01573g8.840ON60762816850.0
TBLA0B032508.840ON64363716890.0
SAKL0E03630g2.445ON5715731323e-07
Kpol_1033.542.445ON5704841181e-05
TBLA0I013802.445ON5714901162e-05
NCAS0F014702.445ON5693751118e-05
TBLA0B090102.445ON5694861111e-04
KNAG0E009406.11ON5383161055e-04
Kwal_26.76282.445ON5705301046e-04
KNAG0E023902.445ON5694591046e-04
Smik_11.1122.445ON5705731020.001
TPHA0G029002.445ON5694791020.001
Kpol_1032.26.11ON53987990.003
Smik_13.2912.445ON569375970.004
YMR105C (PGM2)2.445ON569378970.005
Suva_13.2822.445ON569386950.007
KLLA0B12694g2.445ON568372950.007
NDAI0H023502.445ON569376950.007
NCAS0F002006.11ON54955930.014
Skud_13.2632.445ON569378920.016
CAGL0B03597g6.11ON54059900.028
KAFR0D030102.445ON569393890.038
TDEL0G046006.11ON52827870.061
NDAI0K028906.11ON56130870.073
TBLA0G009806.11ON55828860.079
KAFR0L003406.11ON54027860.088
Skud_5.316.11ON55752840.15
Smik_5.296.11ON55527830.18
YEL058W (PCM1)6.11ON55727830.19
Suva_5.106.11ON55327830.20
ZYRO0F00506g6.11ON55023820.24
SAKL0E00902g6.11ON54441820.26
ACR015W6.11ON55240810.35
TPHA0P009602.195ON58454790.69
Kwal_56.223556.11ON54125780.72
KLLA0D00858g6.11ON54118780.72
KLTH0C11506g6.11ON54420780.89
TPHA0M002106.11ON54586770.93
Suva_12.2364.379ON76298771.1
Kwal_27.116118.442ON156170761.7
Smik_16.1105.145ON82585742.7
Suva_7.4905.145ON83972733.2
YLR438W (CAR2)4.317ON42466723.9
Smik_12.5344.317ON42466724.0
Suva_10.5554.317ON42466724.1
Ecym_30146.11ON55118724.3
Skud_12.5304.317ON42466706.1
Skud_10.3674.379ON76294707.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL126W
         (624 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...  1313   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   796   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   761   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   743   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   722   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...   711   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...   710   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   707   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...   704   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   692   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   691   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   690   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...   680   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   679   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   677   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   676   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   672   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   666   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   653   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   655   0.0  
SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {...    55   3e-07
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    50   1e-05
TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {O...    49   2e-05
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    47   8e-05
TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa] ...    47   1e-04
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    45   5e-04
Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C...    45   6e-04
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    45   6e-04
Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127...    44   0.001
TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON}               44   0.001
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    43   0.003
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    42   0.004
YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON} ...    42   0.005
Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {...    41   0.007
KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} high...    41   0.007
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    41   0.007
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    40   0.014
Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {...    40   0.016
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    39   0.028
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    39   0.038
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    38   0.061
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    38   0.073
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    38   0.079
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    38   0.088
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    37   0.15 
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    37   0.18 
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    37   0.19 
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    37   0.20 
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    36   0.24 
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    36   0.26 
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    36   0.35 
TPHA0P00960 Chr16 complement(194351..196105) [1755 bp, 584 aa] {...    35   0.69 
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    35   0.72 
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    35   0.72 
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    35   0.89 
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    34   0.93 
Suva_12.236 Chr12 complement(377999..380287) [2289 bp, 762 aa] {...    34   1.1  
Kwal_27.11611 s27 (875218..879903) [4686 bp, 1561 aa] {ON} YIR01...    34   1.7  
Smik_16.110 Chr16 (204253..206730) [2478 bp, 825 aa] {ON} YGR196...    33   2.7  
Suva_7.490 Chr7 complement(846128..848647) [2520 bp, 839 aa] {ON...    33   3.2  
YLR438W Chr12 (1012501..1013775) [1275 bp, 424 aa] {ON}  CAR2L-o...    32   3.9  
Smik_12.534 Chr12 (941490..942764) [1275 bp, 424 aa] {ON} YLR438...    32   4.0  
Suva_10.555 Chr10 (967287..968561) [1275 bp, 424 aa] {ON} YLR438...    32   4.1  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    32   4.3  
Skud_12.530 Chr12 (946371..947645) [1275 bp, 424 aa] {ON} YLR438...    32   6.1  
Skud_10.367 Chr10 complement(656888..659176) [2289 bp, 762 aa] {...    32   7.6  

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 1313 bits (3397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/624 (100%), Positives = 624/624 (100%)

Query: 1   MKENTDAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLR 60
           MKENTDAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLR
Sbjct: 1   MKENTDAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLR 60

Query: 61  ARMEAGFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQL 120
           ARMEAGFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQL
Sbjct: 61  ARMEAGFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQL 120

Query: 121 DYDIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYA 180
           DYDIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYA
Sbjct: 121 DYDIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYA 180

Query: 181 NGCQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQT 240
           NGCQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQT
Sbjct: 181 NGCQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQT 240

Query: 241 MLVKQSNLKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPT 300
           MLVKQSNLKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPT
Sbjct: 241 MLVKQSNLKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPT 300

Query: 301 VSFPNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFA 360
           VSFPNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFA
Sbjct: 301 VSFPNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFA 360

Query: 361 QAEMQSYFKEPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELEL 420
           QAEMQSYFKEPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELEL
Sbjct: 361 QAEMQSYFKEPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELEL 420

Query: 421 EGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQEVLQECYEKYGY 480
           EGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQEVLQECYEKYGY
Sbjct: 421 EGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQEVLQECYEKYGY 480

Query: 481 FVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTAT 540
           FVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTAT
Sbjct: 481 FVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTAT 540

Query: 541 NIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRASHL 600
           NIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRASHL
Sbjct: 541 NIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRASHL 600

Query: 601 SHLAWDVLKREWFRPTETGLQTNF 624
           SHLAWDVLKREWFRPTETGLQTNF
Sbjct: 601 SHLAWDVLKREWFRPTETGLQTNF 624

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/627 (60%), Positives = 468/627 (74%), Gaps = 5/627 (0%)

Query: 1   MKENTDAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLR 60
           +++  + +P  L+D + +W  +DKN +T  EI  LV +  W+ELR RL  RI+FGTAGLR
Sbjct: 6   VRDMNELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLR 65

Query: 61  ARMEAGFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQL 120
           ARMEAGF+RMNTLTVIQASQGLA YIKSQFP++LKVV+GHDHR++S+ FAE  IAAFLQL
Sbjct: 66  ARMEAGFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQL 125

Query: 121 DYDIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYA 180
            +++YYLNYVP   D + +VHTPMVPF ++N+EGG  SCG+MITASHNPKMDNGYKVYY+
Sbjct: 126 GFEVYYLNYVPSNKDVESYVHTPMVPFTVSNIEGG-ASCGIMITASHNPKMDNGYKVYYS 184

Query: 181 NGCQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQT 240
           NGCQI PPHD+ I   IDANL PW +AWD++ LIE+A  + +LHDV++E+++ Y   IQ+
Sbjct: 185 NGCQITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQS 244

Query: 241 MLVKQSNLKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPT 300
            LV  ++L   G  WFVYTPMHGVGYE F   V + L ++ED+ Y+VV  QK+PDPEF T
Sbjct: 245 SLVTTNSLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTT 304

Query: 301 VSFPNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFA 360
           VSFPNPEE GAL++A+++A  +G  +VLANDPDADRFS AVK   +W QLTGNQ+G LFA
Sbjct: 305 VSFPNPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKDGNKWKQLTGNQLGYLFA 364

Query: 361 QAEMQSYFKEPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELEL 420
             +++  F     ++K LAML S VSSQ++ KMA+ EGF  VETLTGFKWL NRA +LE 
Sbjct: 365 VGQLEK-FSNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLEN 423

Query: 421 EGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQEVLQECYEKYGY 480
           +G+YVPFAYEEAIGYMFS V HDKDG++AA  FLQM   WKK  K+  +VL   YEKYG 
Sbjct: 424 DGFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKTPLDVLNAGYEKYGN 483

Query: 481 FVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTAT 540
           FV+YNGYY     ++  +VF Y RN       PYPS IG EF V   RDLTVGYQSDT  
Sbjct: 484 FVEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGN 543

Query: 541 NIPDLPVDHNSQMITCVLKPVKME---TDCESVRFTARGSGTEPKLKVYIESCAANHQRA 597
           +IP+LPV   S MITCVLKP+  E   T  + VRFT RGSGTEPKLKVYIES A + + A
Sbjct: 544 HIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYA 603

Query: 598 SHLSHLAWDVLKREWFRPTETGLQTNF 624
           + L+ L WDVLKREWFRP  TGLQT F
Sbjct: 604 TKLAKLTWDVLKREWFRPEVTGLQTKF 630

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/629 (59%), Positives = 457/629 (72%), Gaps = 10/629 (1%)

Query: 1   MKENTDAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLR 60
           M ++   VP  LK+S+  WLT+DKN ET+ E+  LV    W+EL  RL  RI+FGTAGLR
Sbjct: 1   MSDSYTTVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLR 60

Query: 61  ARMEAGFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQL 120
           +RMEAGFSRMNTLTV+QASQGLA YIKSQFP++L V++GHDHR+HS EFA  T+ AFLQL
Sbjct: 61  SRMEAGFSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQL 120

Query: 121 DYDIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYA 180
            + +YYLN     S E  FVHTPMVPF IN +     S G+MITASHNPKMDNGYKVYY+
Sbjct: 121 GFKVYYLNLSSKDSTE-TFVHTPMVPFTINQLNA---SAGIMITASHNPKMDNGYKVYYS 176

Query: 181 NGCQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQT 240
           NGCQIIPPHD LI   ID NL PW +AWD   +I+ AI+SG L DV++++  KY  ++  
Sbjct: 177 NGCQIIPPHDRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSD 236

Query: 241 MLVKQSNLKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPT 300
            LV+   L     PWFVYTPMHGVG+E F++     LG++E K Y+ VPEQ+ PDP FPT
Sbjct: 237 ELVRVPMLD-CDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPT 295

Query: 301 VSFPNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFA 360
           VSFPNPEE+GALD+++ +A+   I +V+ANDPDADRFSVAVK    W+QLTGN+IG LFA
Sbjct: 296 VSFPNPEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGDRWSQLTGNEIGFLFA 355

Query: 361 QAEMQSYFKEPKLDRKQ--LAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRAREL 418
             + Q Y K  +  +KQ  LAM+ S VSSQ+++ +AE E F   +TLTGFKWLGNRA EL
Sbjct: 356 YYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFEL 415

Query: 419 ELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEW-KKVAKSSQEVLQECYEK 477
           E +GYYVPFAYEEAIGYMF +V HDKDGI+AA VFLQM  EW  K   +  +VL E + K
Sbjct: 416 ETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGK 475

Query: 478 YGYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSD 537
           YG F +YNGYYI    ++TKEVFDY R +YTP+G  YP  IG EF V   RDLT GYQSD
Sbjct: 476 YGVFKEYNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSD 535

Query: 538 TATNIPDLPVDHNSQMITCVLKPV--KMETDCESVRFTARGSGTEPKLKVYIESCAANHQ 595
           T  N+P+LPVD +SQMIT  L+P   K  T  E VRFT RGSGTEPKLKVYIE+ + + +
Sbjct: 536 TIDNVPNLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEK 595

Query: 596 RASHLSHLAWDVLKREWFRPTETGLQTNF 624
           RA HL+   W VL+REWFRP  TGL+T F
Sbjct: 596 RAQHLARETWQVLRREWFRPERTGLETKF 624

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/622 (58%), Positives = 461/622 (74%), Gaps = 14/622 (2%)

Query: 8   VPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEAGF 67
           VP  LK  +  WL +DKN +T+ +I +LV +  W ELR RL  RITFGTAGLR+RMEAGF
Sbjct: 9   VPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRMEAGF 68

Query: 68  SRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIYYL 127
           +RMNTLTV+QASQGLA+YI S FPD+L VV+GHDHRF+S++FAE TI AFLQL + +Y L
Sbjct: 69  NRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKVYDL 128

Query: 128 NYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQIIP 187
            +    S +DV VHTPMVPF I+++     S G+MITASHNPKMDNGYKVYY+NGCQIIP
Sbjct: 129 GFTEDAS-QDVVVHTPMVPFGIDHLRA---SGGIMITASHNPKMDNGYKVYYSNGCQIIP 184

Query: 188 PHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQSN 247
           PHD+ I + I ANLEPW RAWD  A+  EA++S  L D +K ++ +Y D+++  LV  +N
Sbjct: 185 PHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVI-TN 243

Query: 248 LKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPE 307
           +     PWFVYTP+HGVG+E F++ ++S   + + +DY+ V EQKYPDP FPTVSFPNPE
Sbjct: 244 VNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPE 303

Query: 308 ERGALDMAMKVADANGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSY 367
           E+GALD A+++A+ + IT VL NDPDADRFSVA K++G+W QLTGN+IG LFAQ + ++Y
Sbjct: 304 EKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETY 363

Query: 368 FKEPKLDR--KQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELELEGYYV 425
             E    +    LAM+ S VSSQ+++KMAE EGF   +TLTGFKWLGNRARELE  GY+V
Sbjct: 364 RLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGYFV 423

Query: 426 PFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQEVLQECYEKYGYFVDYN 485
           PFAYEEAIGYMFS VVHDKDGI+AA VFLQM + WK  A +  +VLQ  Y+KYG F +YN
Sbjct: 424 PFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQALTPFDVLQRAYQKYGVFKEYN 483

Query: 486 GYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATNIPDL 545
           GYYI    ++T +VF   R+ ++      P+HIG EF VE   DLT GYQS+T  + P L
Sbjct: 484 GYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQSNTPDSEPRL 539

Query: 546 PVDHNSQMITCVLKPVK---METDCESVRFTARGSGTEPKLKVYIESCAANHQRASHLSH 602
           PVD +SQMIT  L P      +   ESVRFTARGSGTEPKLKVYIE+ +++ + AS L+ 
Sbjct: 540 PVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVSSSEELASALAK 599

Query: 603 LAWDVLKREWFRPTETGLQTNF 624
            AWDVL+REWF+P +TGL TNF
Sbjct: 600 KAWDVLRREWFKPEQTGLATNF 621

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/623 (57%), Positives = 439/623 (70%), Gaps = 16/623 (2%)

Query: 8   VPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEAGF 67
           +P+ LK S+  W   DKN ET++EI +LV+   W+EL KRL  RI+FGTAGLR++MEAGF
Sbjct: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67

Query: 68  SRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIYYL 127
           SRMNTLTV+QASQGLA+YI  +FP++  V +GHDHRF+SR+FAE T  AFLQL + +Y L
Sbjct: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127

Query: 128 NYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQIIP 187
            +      +D FVHTPMVPFAI+ +     S GVMITASHNPKMDNGYKVYY+NGCQIIP
Sbjct: 128 GF-NADPKKDAFVHTPMVPFAIDRLGA---SAGVMITASHNPKMDNGYKVYYSNGCQIIP 183

Query: 188 PHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQSN 247
           PHD LI + I  NL PW RAWD KA+I EA + G   D++K M+  Y   I   LV  S+
Sbjct: 184 PHDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLV-SSD 242

Query: 248 LKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPE 307
           +     PWFVYTP+HGVG+E F+   + VLG+ E +DY  V E K PDP FPTVSFPNPE
Sbjct: 243 IGDRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPE 302

Query: 308 ERGALDMAMKVADANGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSY 367
           E GALD+A+ +AD NGI+ VL NDPDADRFS AVK+ G+W QLTGN+IG LFAQ   + Y
Sbjct: 303 EAGALDLAIALADKNGISFVLGNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWEKY 362

Query: 368 FKEP---KLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELELEGYY 424
            KE    KL+   LA++ S VSSQ+++K+A  E F   +TLTGFKWLGNRAR+LE  GYY
Sbjct: 363 QKESSEFKLENP-LALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYY 421

Query: 425 VPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQEVLQECYEKYGYFVDY 484
           VPFAYEEAIG+MFS +VHDKDG++AA VFLQM + WKK A S  +VLQ  + KYG F +Y
Sbjct: 422 VPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALSPIDVLQSAFGKYGVFKEY 481

Query: 485 NGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATNIPD 544
           NGYY     ++T  +F   R+ Y      YP HIG +F+V    DLT G+QSDTA N P 
Sbjct: 482 NGYYTVPDLSLTDRIFSDIRSSY----DSYPKHIGNQFDVVSFTDLTKGFQSDTADNTPR 537

Query: 545 LPVDHNSQMITCVLKPVKMETD---CESVRFTARGSGTEPKLKVYIESCAANHQRASHLS 601
           LPVD +SQMI   L P          E VRFTARGSGTEPKLKVYIE+ +    RAS L+
Sbjct: 538 LPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLA 597

Query: 602 HLAWDVLKREWFRPTETGLQTNF 624
              W+VL+ EWF+P ETGL T F
Sbjct: 598 RTTWNVLRDEWFKPKETGLSTKF 620

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/629 (56%), Positives = 438/629 (69%), Gaps = 23/629 (3%)

Query: 6   DAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEA 65
           + VPS LKD +  W   D+N +T  E+  L     W+EL KR   RI FGTAGLR++M+A
Sbjct: 7   ETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQMQA 66

Query: 66  GFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIY 125
           GFSRMNTL VIQASQGLA Y++ QFPD+L  V+GHDHRFHS+EFA AT AAFL   + ++
Sbjct: 67  GFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFKVH 126

Query: 126 YLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQI 185
           YLN       +  FVHTP+VPFA++ ++    S GVMITASHNPKMDNGYKVYY+NGCQI
Sbjct: 127 YLN------PDHEFVHTPLVPFAVDKLKA---SVGVMITASHNPKMDNGYKVYYSNGCQI 177

Query: 186 IPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQ 245
           IPPHD  I   IDANLEPW   WD   ++ +A+K GKL   R+EML+ Y + +   LV+ 
Sbjct: 178 IPPHDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEI 237

Query: 246 SNLKF--AGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSF 303
           + LK      PWFVYTPMHGVG++ F   V   L + E KDY+ VPEQ+ PDP FPTV F
Sbjct: 238 NPLKLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGF 297

Query: 304 PNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVK--YHGEWNQLTGNQIGILFAQ 361
           PNPEE+GALD+ + +A+ + I +++ANDPDADRFSVAVK    GEW QLTGN+IG LFA 
Sbjct: 298 PNPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAF 357

Query: 362 AEMQSYFKEPKLDRK-----QLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRAR 416
            E Q Y     +D++      LAML S VSSQ+++KMAE EGF   +TLTGFKW+GNRA 
Sbjct: 358 YEYQKY---KSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAI 414

Query: 417 ELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAK-SSQEVLQECY 475
            LE +GYYVPF +EEAIGYMF  + HDKDGI+A+ VFLQ   +WK         VL+  +
Sbjct: 415 LLEKKGYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGF 474

Query: 476 EKYGYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQ 535
           +KYG F +YNGYY+   P VTK++FDY RN YTP G  YPS IG E EV Y RDLT GYQ
Sbjct: 475 KKYGVFKEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQ 534

Query: 536 SDTATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQ 595
           SDT  + P LPVD  SQMIT   +P    ++ E +RFT RGSGTEPKLKVYIE+CA   Q
Sbjct: 535 SDTINHKPTLPVDPTSQMITVSARPSN-GSENEHIRFTIRGSGTEPKLKVYIEACANEEQ 593

Query: 596 RASHLSHLAWDVLKREWFRPTETGLQTNF 624
           RAS L+ L W+VL+REWFRP E  + T F
Sbjct: 594 RASFLAKLTWNVLRREWFRPDEMNIVTKF 622

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/626 (56%), Positives = 435/626 (69%), Gaps = 17/626 (2%)

Query: 6   DAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEA 65
           + VPS LK  +  W   D+N ET  E+  L  N  WDEL KR   RI FGTAGLR+ M+A
Sbjct: 7   ETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSEMQA 66

Query: 66  GFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIY 125
           GFSRMNTL +IQA+QGLA YIK QFPD+L VV+GHDHRFHS+EFA AT  AFL   + ++
Sbjct: 67  GFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGFKVH 126

Query: 126 YLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQI 185
           YLN       +  FVHTP+VPFA++ ++    S GVMITASHNPKMDNGYKVYY+NGCQI
Sbjct: 127 YLN------PDHEFVHTPLVPFAVDKLKA---SVGVMITASHNPKMDNGYKVYYSNGCQI 177

Query: 186 IPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQ 245
           IPPHD  I   ID NLEPW   W    ++ +A+K GKL   R+EML  Y   +   LV+ 
Sbjct: 178 IPPHDHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVET 237

Query: 246 SNLKF--AGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSF 303
           + LK      PWFVYTPMHGVG+  F   V   + + E +DY+ VPEQ+ PDP FPTV F
Sbjct: 238 NPLKLEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGF 297

Query: 304 PNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVK--YHGEWNQLTGNQIGILFAQ 361
           PNPEE+GALD+ M++A+ + I +++ANDPDADRFS+AVK     +W QLTGN+IG LFA 
Sbjct: 298 PNPEEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAF 357

Query: 362 AEMQSY-FKEPKLDRKQ-LAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELE 419
            E Q Y  K+ +  R   LAML+S VSSQ+++KMAE EGFL  +TLTGFKW+GNRA  LE
Sbjct: 358 FEFQRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILE 417

Query: 420 LEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAK-SSQEVLQECYEKY 478
            EGYYVPF +EEAIGYMF  + HDKDGI+AA V LQ   +WK  +     ++L+  ++KY
Sbjct: 418 KEGYYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKY 477

Query: 479 GYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDT 538
           G F +YNGYY+  +P VT E+F+Y RN YTP G PYP  IG E EV Y RDLT GYQSDT
Sbjct: 478 GVFKEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDT 537

Query: 539 ATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRAS 598
             + P LPVD  SQMIT   KP     + E +RFT RGSGTEPKLKVYIE+CA N +RAS
Sbjct: 538 PDHKPVLPVDPTSQMITLSGKPSDGNGN-EHIRFTIRGSGTEPKLKVYIEACADNEKRAS 596

Query: 599 HLSHLAWDVLKREWFRPTETGLQTNF 624
           +L+ L WDVL+R WFRP    + T+F
Sbjct: 597 YLAKLTWDVLRRGWFRPEIMNITTDF 622

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/630 (56%), Positives = 439/630 (69%), Gaps = 17/630 (2%)

Query: 2   KENTDAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRA 61
           KE  ++VP+ L   +  WL+ D N +T+ EI  L     W EL KRL  RI FGTAGLR+
Sbjct: 11  KEVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRS 70

Query: 62  RMEAGFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLD 121
           RMEAGFSRMNTL V+QA+QGLA++IK QFPD L  V+GHDHRF+S+EFA AT+A FLQ  
Sbjct: 71  RMEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAG 130

Query: 122 YDIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYAN 181
           + + +LN      D D FVHTP+VPF +N V     S GVMITASHNPKMDNGYKVYY+N
Sbjct: 131 FKVIFLN------DGDKFVHTPIVPFTVNEVGA---SVGVMITASHNPKMDNGYKVYYSN 181

Query: 182 GCQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTM 241
           GCQIIPPHD  I + I+ NL  W +AW    L++E + +  L    +EM+++Y   +   
Sbjct: 182 GCQIIPPHDSEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQS 241

Query: 242 LVKQSNLKF--AGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFP 299
           LV ++ +     G PWFVYTP+HGVGY+ F++     + +   +DY+ V EQ+ PDP FP
Sbjct: 242 LVDRTTISAEKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFP 301

Query: 300 TVSFPNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVKYH--GEWNQLTGNQIGI 357
           TV FPNPEE+GALDMA+ VAD NGI++VLANDPDADRFS AVK +  G W QLTGN+IG 
Sbjct: 302 TVPFPNPEEKGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGA 361

Query: 358 LFAQAEMQSYFK--EPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRA 415
           LFA  E Q Y K  E   ++  LAML S VSSQL+ KMAE E F  ++TLTGFKW+GNR 
Sbjct: 362 LFAFYEFQKYQKKNEEYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRT 421

Query: 416 RELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSS-QEVLQEC 474
            +LE   YYVPF +EEAIGYMF  + HDKDGI+AA+VFLQM  +W   +K +   VL++ 
Sbjct: 422 LDLEAMNYYVPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDI 481

Query: 475 YEKYGYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGY 534
           +EKYG F +YNGYY  + P V KEVFD+ RN+Y+    PYPS IG E +V   RDLT+GY
Sbjct: 482 FEKYGVFKEYNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGY 541

Query: 535 QSDTATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANH 594
           QSDT    PDLPVD NSQMIT   K V      ESVRFT RGSGTEPKLKVYIE+C+ + 
Sbjct: 542 QSDTVNQRPDLPVDPNSQMITAWTK-VNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSE 600

Query: 595 QRASHLSHLAWDVLKREWFRPTETGLQTNF 624
           +RAS L+ L W VLKREWFRP  TGL T F
Sbjct: 601 ERASELAQLTWRVLKREWFRPDVTGLTTTF 630

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/626 (55%), Positives = 440/626 (70%), Gaps = 17/626 (2%)

Query: 6   DAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEA 65
           +AVPS+LK+++  W   D+N ET  E+  L     W+EL +R   RI FGTAGLR++M+A
Sbjct: 7   EAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQA 66

Query: 66  GFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIY 125
           GF+RMNTL +IQASQGLA Y K QFP++L  V+GHDHRFHS+EFA AT  AFL   + ++
Sbjct: 67  GFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKVH 126

Query: 126 YLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQI 185
           YLN       +  FVHTP+VPFA++ ++    S GVM+TASHNPKMDNGYKVYY+NGCQI
Sbjct: 127 YLN------PDHEFVHTPLVPFAVDKLKA---SVGVMVTASHNPKMDNGYKVYYSNGCQI 177

Query: 186 IPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQ 245
           IPPHD  I   ID NLEPW   W+   ++ + +K GKL   R+E+L+ Y   +   LV  
Sbjct: 178 IPPHDHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGT 237

Query: 246 SNLKF--AGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSF 303
             LKF     PWFVYTPMHGVG++ F   V   + + E KDY+ VPEQ+ PDP FPTV+F
Sbjct: 238 DPLKFEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAF 297

Query: 304 PNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVK--YHGEWNQLTGNQIGILFAQ 361
           PNPEE+GALD+ + +A+ +GI +++ANDPDADRFSVA+K    GEW QLTGN+IG LFA 
Sbjct: 298 PNPEEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAI 357

Query: 362 AEMQSYFKEPKLDRKQ--LAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELE 419
            E Q +    K  +    LAML+S VSSQ+++KMAE EGF   ETLTGFKW+GNRA  LE
Sbjct: 358 FEFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLE 417

Query: 420 LEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAK-SSQEVLQECYEKY 478
            EGYYVPF +EEAIGYMF  + HDKDG++A+ VFLQ   +WK         +L++ ++KY
Sbjct: 418 KEGYYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKY 477

Query: 479 GYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDT 538
           G F +YNGYYI S+P VT E+FDY RN YTP G  YPS IG E EV   RDLT+GYQSDT
Sbjct: 478 GVFKEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDT 537

Query: 539 ATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRAS 598
           + + P LP+D +SQMIT   KP     + E +RFT RGSGTEPK+KVYIE+CA   QRA+
Sbjct: 538 SNHKPTLPIDPSSQMITVSAKPSD-GNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRAT 596

Query: 599 HLSHLAWDVLKREWFRPTETGLQTNF 624
            L+ L W+VLKREWFRP +  + T+F
Sbjct: 597 FLAKLTWNVLKREWFRPEKMDIVTHF 622

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/625 (53%), Positives = 432/625 (69%), Gaps = 13/625 (2%)

Query: 4   NTDAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARM 63
           +T  +P  L+ ++  WL  DKN ET++E+ +L ++  WDEL KR   RI FGTAGLRARM
Sbjct: 2   STTDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARM 61

Query: 64  EAGFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYD 123
           EAG +R+N L ++QASQGLA YIK +FP +L  V+GHDHR+HS+EFA+ T A F++  + 
Sbjct: 62  EAGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFK 121

Query: 124 IYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGC 183
           +YYLN        D FVHTPMVP++++++     S GVMITASHNPKMDNGYKVYY NGC
Sbjct: 122 VYYLN------PHDEFVHTPMVPYSVDHLNA---SVGVMITASHNPKMDNGYKVYYTNGC 172

Query: 184 QIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLV 243
           QIIPPHD  I   I+ NLEPW+  W+   ++  A   GK+  VRK ML  Y +S+   L+
Sbjct: 173 QIIPPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLI 232

Query: 244 KQSNLKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSF 303
           ++        PWFVYTPMHGVG++ F   +   L ++++ DYI VPEQK PDP F TVSF
Sbjct: 233 QRDFAAPDEKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSF 292

Query: 304 PNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVK--YHGEWNQLTGNQIGILFAQ 361
           PNPEE+GAL++A+ +A+ANGI +VLANDP+ADRFSVAV+     EW QLTGN+IG+LFA 
Sbjct: 293 PNPEEKGALNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAF 352

Query: 362 AEMQSYFK--EPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELE 419
            E + Y K  +  +  K LAML S VS+Q++++MAE+EGFL  +TLTGFKW+GN A +LE
Sbjct: 353 YEFKMYQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLE 412

Query: 420 LEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQEVLQECYEKYG 479
            +GY+VPF YEEAIGYMF  + HDKDG++AA VFLQ    W + + +  +++ ECY+KYG
Sbjct: 413 EKGYFVPFGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNPIDIIHECYDKYG 472

Query: 480 YFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTA 539
              +YNGYYI S P+ T +VF+  R+ YT  G  +P  IG  F V   RDLT+G+ S TA
Sbjct: 473 VSAEYNGYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTA 532

Query: 540 TNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRASH 599
              P LPVD NSQMIT    P       ESVRFT RGSGTEPKLKVYIE  ++   RA  
Sbjct: 533 DKKPLLPVDKNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARI 592

Query: 600 LSHLAWDVLKREWFRPTETGLQTNF 624
           L+   W+ LK EWF+P+  GL T+F
Sbjct: 593 LAKSLWETLKHEWFKPSSNGLSTDF 617

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/621 (55%), Positives = 435/621 (70%), Gaps = 15/621 (2%)

Query: 8   VPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEAGF 67
           VP  LK S   WL +D+N ET+ EI  ++    W EL  RL  RI FGTAGLR RMEAGF
Sbjct: 15  VPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEAGF 74

Query: 68  SRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIYYL 127
           +RMN+L ++Q SQGLA+YI  +FP +L VV+GHDHR+HS+EFA+ T+A FL   + ++YL
Sbjct: 75  TRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVFYL 134

Query: 128 NYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQIIP 187
           N       E+ FVHTP+VP++++ +    ++CGVMITASHNPK DNGYKVYY+NGCQIIP
Sbjct: 135 N------TENEFVHTPLVPYSVDKLR---SACGVMITASHNPKDDNGYKVYYSNGCQIIP 185

Query: 188 PHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKY-KDSIQTMLVKQS 246
           PHD+ I   I+ NL PW++ W+ K L     ++G L     +M   Y +D  + +    S
Sbjct: 186 PHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGS 245

Query: 247 NLKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNP 306
            +   G PWFVYTPMHGVG++ F +    VLG+ E+ DY  VPEQ  PDP FPTVSFPNP
Sbjct: 246 PMLKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNP 305

Query: 307 EERGALDMAMKVADANGITVVLANDPDADRFSVAV--KYHGEWNQLTGNQIGILFAQAEM 364
           EE+GALDMA+++A+  G+T+++ANDPDADRFS AV  K   EW QL+GN+IG LFA  ++
Sbjct: 306 EEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKL 365

Query: 365 QSYFKEPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELELEGYY 424
           Q + KE    RK LAML S VSSQ+L+KMA+ EGF   ETLTGFKW+GNRA +LE +GY 
Sbjct: 366 QEH-KEKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYD 424

Query: 425 VPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKV-AKSSQEVLQECYEKYGYFVD 483
           V F YEEAIGYMF  + HDKDGI A+ VFL M  +W ++      +VL  C+EKYG F +
Sbjct: 425 VCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSE 484

Query: 484 YNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATNIP 543
           YNGYY    PA+ + VF Y R+EY P  +PYP  +G EF +   RDLT+GYQSDT    P
Sbjct: 485 YNGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKP 544

Query: 544 DLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRASHLSHL 603
            LPVD +SQMIT  LKP +     E +RFT RGSGTEPKLKVYIES AAN + A++L+HL
Sbjct: 545 TLPVDASSQMITATLKPERT-VGHEEIRFTIRGSGTEPKLKVYIESHAANKEAAANLAHL 603

Query: 604 AWDVLKREWFRPTETGLQTNF 624
            W+VL+REWFRP  TGL+T+F
Sbjct: 604 TWNVLRREWFRPEITGLKTSF 624

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/623 (54%), Positives = 433/623 (69%), Gaps = 17/623 (2%)

Query: 9   PSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEAGFS 68
           P  L+  ++EWL  DKN ET+ E+ +L     W EL  R   RI FGTAGLR+RMEAG +
Sbjct: 13  PEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRMEAGTN 72

Query: 69  RMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIYYLN 128
           R+N+L ++QA+QGLARYI SQFP +   V+GHDHRFHS+EFA  T A FL+  + + YLN
Sbjct: 73  RLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFKVLYLN 132

Query: 129 YVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQIIPP 188
              PG   D  VHTP+VPF ++++     S GVMITASHNPKMDNGYKVY+ANGCQIIPP
Sbjct: 133 ---PG---DTLVHTPLVPFTVDHLNA---SVGVMITASHNPKMDNGYKVYFANGCQIIPP 183

Query: 189 HDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLV-KQSN 247
           HD  I R ID NLEPW  +WD   +I+ A K  ++  V+ +M Q Y  + +  L+  +  
Sbjct: 184 HDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKV 243

Query: 248 LKFAG-GPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNP 306
           L+  G GPWFVYTPMHGVG E F      VLGI+E++DY+ VPEQK+PDP FPTVSFPNP
Sbjct: 244 LRNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNP 303

Query: 307 EERGALDMAMKVADANGITVVLANDPDADRFSVAV--KYHGEWNQLTGNQIGILFAQAEM 364
           EE+GALD A+++A  NGI +V+ANDPDADRFS+AV       W QLTGN+IG LFA  + 
Sbjct: 304 EEKGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQF 363

Query: 365 QSYFKEPKLDRKQ--LAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELELEG 422
           + Y     + +K+  L +L S VSSQ+++KMAE EGF   +TLTGFKW+GNRAR+LE +G
Sbjct: 364 EMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKG 423

Query: 423 YYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVA-KSSQEVLQECYEKYGYF 481
           ++ PF YEEAIGYMF+Q+ HDKDGI+A+ +FL   Y W   A K   ++L++ Y+KYG F
Sbjct: 424 FFAPFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVF 483

Query: 482 VDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATN 541
            +YNGYYI   P + KE FDY RN+  P G  YP  IG EF+V   RDLT+G+QSDT+ +
Sbjct: 484 KEYNGYYIVDNPKIMKETFDYIRNDRKP-GTQYPEAIGSEFQVVSFRDLTLGFQSDTSDH 542

Query: 542 IPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRASHLS 601
           IP LPVD NSQMIT   KP     + + VRFT RGSGTEPKLKVYIE+C+ +   A  L+
Sbjct: 543 IPTLPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLA 602

Query: 602 HLAWDVLKREWFRPTETGLQTNF 624
              WD L+  WFRP  TGL T+F
Sbjct: 603 KQMWDTLQEVWFRPQTTGLVTDF 625

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/629 (54%), Positives = 428/629 (68%), Gaps = 25/629 (3%)

Query: 7   AVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEAG 66
            +PS LK  +  W   D++ ET  E+  L     WDEL KR   RI FGTAGLR++M+AG
Sbjct: 8   TIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQAG 67

Query: 67  FSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIYY 126
           FSRMN L +IQASQGLA YI+ QFP++L  V+GHDHRFHS++FA AT  AFL   + ++Y
Sbjct: 68  FSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHY 127

Query: 127 LNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQII 186
           LN   PG +   FVHTP+VPFA++ +     S GVMITASHNPKMDNGYKVYY+NGCQII
Sbjct: 128 LN---PGQE---FVHTPLVPFAVDELNA---SVGVMITASHNPKMDNGYKVYYSNGCQII 178

Query: 187 PPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQS 246
           PPHD+ I   ID NLEPW  AW+   ++ + +K GKL   R+EML+ Y + I   LV+ +
Sbjct: 179 PPHDQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETT 238

Query: 247 NLKFA--GGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFP 304
            LK      PWFVYTPMHGVG++ F   V   + + E KDY+ VPEQ+ PDP FPTV FP
Sbjct: 239 PLKLEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFP 298

Query: 305 NPEERGALDMAMKVADANGITVVLANDPDADRFSVAVK--YHGEWNQLTGNQIG------ 356
           NPEE+GAL++ M++A+ + I++++ANDPDADRFSVA+K    G W QLTGN+IG      
Sbjct: 299 NPEEKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGFLFAFF 358

Query: 357 ILFAQAEMQSYFKEPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRAR 416
                  M   F++       LAML+S VSSQ++++MAE EGF   +TLTGFKW+GNRA 
Sbjct: 359 EFEKFKSMDEQFQQ----THPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAI 414

Query: 417 ELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAK-SSQEVLQECY 475
            LE EGYYVPF +EEAIGYMF  + HDKDGI+A+ VFLQ   +WK         VL+  +
Sbjct: 415 ILEKEGYYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGF 474

Query: 476 EKYGYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQ 535
           +KYG F +YNGYYI   P VTKE+F Y R+ YTP   PYP +IG E  V   RDLT GYQ
Sbjct: 475 KKYGVFKEYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQ 534

Query: 536 SDTATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQ 595
           SDT  + P LPVD  SQMIT   +P     + E +RFT RGSGTEPKLKVYIE+ A   +
Sbjct: 535 SDTLDHKPTLPVDPTSQMITVFARPNDSNGN-EHIRFTIRGSGTEPKLKVYIETRANEER 593

Query: 596 RASHLSHLAWDVLKREWFRPTETGLQTNF 624
           RAS L+ L WDVL+REWFRP +T + TNF
Sbjct: 594 RASFLAKLTWDVLRREWFRPEKTNITTNF 622

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/623 (53%), Positives = 437/623 (70%), Gaps = 16/623 (2%)

Query: 9   PSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEAGFS 68
           P +L++ +  WL  D+N ET+ E+ +L  N  W EL +R   RI FGTAGLR+RMEAGFS
Sbjct: 12  PENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRMEAGFS 71

Query: 69  RMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIYYLN 128
           RMN+L ++Q++QGLA YIK QFP++L  V+GHDHRFHS+EFA  T + FL+  + ++YL 
Sbjct: 72  RMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKVFYL- 130

Query: 129 YVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQIIPP 188
                + +D FVHTP+VPF++ N++    S GVMITASHNPKMDNGYKVYY N CQIIPP
Sbjct: 131 -----TPDDQFVHTPLVPFSVLNLKA---SVGVMITASHNPKMDNGYKVYYDNACQIIPP 182

Query: 189 HDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQS-- 246
           HD+ I   I  NLEPW+ +WD  A  ++ +++ KL  ++  M +KY   ++ +L+  S  
Sbjct: 183 HDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHL 242

Query: 247 NLKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNP 306
           +LK    P+FVYTPMHGVG E F +  + +L + E+ DY+VV EQ+ PDP FPTVSFPNP
Sbjct: 243 SLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNP 302

Query: 307 EERGALDMAMKVADANGITVVLANDPDADRFSVAV--KYHGEWNQLTGNQIGILFAQAEM 364
           EE+GAL +A+K+A  NG+++V+ANDPDADRFS AV  K  G+W QLTGN+IG L    E 
Sbjct: 303 EEKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEF 362

Query: 365 QSYFKEPKLDRKQ--LAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELELEG 422
           Q Y ++    RK   LAM+ S VSSQ++++MA+  GF   +TLTGFKW+GN+A +L  EG
Sbjct: 363 QLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEG 422

Query: 423 YYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQM-CYEWKKVAKSSQEVLQECYEKYGYF 481
           YYVPF +EEAIGYMF  +  DKDGI+AA VFLQ  C+   +   S  ++++E + K+G F
Sbjct: 423 YYVPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVF 482

Query: 482 VDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATN 541
            +YNGYYI    ++TK VFD+ R+EY    K YPS IG E  V   RDLTVGYQS+T  N
Sbjct: 483 KEYNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDN 542

Query: 542 IPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRASHLS 601
           IP+LPVD  SQMIT   KP +      +VR T RGSGTEPKLKVYIE+C+ + + A++L+
Sbjct: 543 IPNLPVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLA 602

Query: 602 HLAWDVLKREWFRPTETGLQTNF 624
              WD+LKREWFRP  TGL T+F
Sbjct: 603 RSTWDILKREWFRPEVTGLTTSF 625

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/620 (55%), Positives = 424/620 (68%), Gaps = 17/620 (2%)

Query: 8   VPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEAGF 67
           +P +LK  +  WL  D+N +T  EI EL     W EL +RL  R+ FGTAGLRARMEAGF
Sbjct: 5   IPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAGF 64

Query: 68  SRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIYYL 127
           SRMNTL VIQA+QGLA+YIK QFPD L  V+GHDHRF+S +FA+AT    L+  ++++YL
Sbjct: 65  SRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHYL 124

Query: 128 NYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQIIP 187
           N        D +VHTPMVPF ++ V+    S GVMITASHNPK+DNGYKVYYANGCQIIP
Sbjct: 125 N------QGDSYVHTPMVPFTVDRVKA---SVGVMITASHNPKLDNGYKVYYANGCQIIP 175

Query: 188 PHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQSN 247
           PHD  I R I++NLEP    WD    +++A   GKL   R +ML++Y   ++   V + +
Sbjct: 176 PHDSAIARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELD 235

Query: 248 LKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPE 307
               G PWFVYTPMHGVGY+ F +  + +L +E ++D++VV EQ  PDPEFPTV FPNPE
Sbjct: 236 SLPKGKPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPE 295

Query: 308 ERGALDMAMKVADANGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSY 367
           E+GALD+A+K+A+ +GI +V+A+DPDADRFSVA K    W QL+GN IG LFA  E+Q Y
Sbjct: 296 EKGALDLAIKLAENHGIKLVIASDPDADRFSVAFKGPHGWQQLSGNDIGFLFAYYELQKY 355

Query: 368 --FKEPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELELEGYYV 425
             F         LAML S VSSQ++  MA  EGF   +TLTGFKW+GNRA ELE  GYYV
Sbjct: 356 RGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYV 415

Query: 426 PFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQEVLQECYEKYGYFVDYN 485
           PF +EEAIGYMF    HDKDGI+AA VFLQ  + W    KS  ++L E   KYG F +YN
Sbjct: 416 PFGFEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGKSPLDILDEASAKYGVFREYN 475

Query: 486 GYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATNIPDL 545
           GYY+   P++T + F Y R +YTP G+ YP  IG + +V+  RDLT GYQSDT  NIP+L
Sbjct: 476 GYYLVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNL 534

Query: 546 PVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRASHLSHLAW 605
            VD +SQMIT V +P K     E VRFT RGSGTEPKLKVYIE+ A +  RA  L+   W
Sbjct: 535 HVDPSSQMITIVAQP-KGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTW 593

Query: 606 DVLKREWF-RPTETGLQTNF 624
           D+L+ EWF RP   GL T F
Sbjct: 594 DILREEWFNRP---GLTTKF 610

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/629 (53%), Positives = 427/629 (67%), Gaps = 19/629 (3%)

Query: 6   DAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEA 65
           + +P  L+D +  WL  DKN ET +E+  L   +  +EL KR   RI FGTAGLR++MEA
Sbjct: 13  ETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKMEA 72

Query: 66  GFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIY 125
           GFSRMNTL V+QA+QGLA YIK QFP +LK VIGHDHR+HS+EFAE   + FL   + +Y
Sbjct: 73  GFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFTVY 132

Query: 126 YLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQI 185
            LN  PPG+    FVHTP+VPF ++ +     S GVMITASHNPKMDNGYKVYY+NGCQI
Sbjct: 133 NLN--PPGT----FVHTPLVPFTVDQIGA---SVGVMITASHNPKMDNGYKVYYSNGCQI 183

Query: 186 IPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQ 245
           IPP D  I + ID NLEPW+ +WDS   IE  + + KL  +R EML  Y D +   ++ +
Sbjct: 184 IPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDK 243

Query: 246 SNLKFAG---GPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVS 302
             ++       PWFVYTPMHGVGYE F   V   + ++E++DY+ V EQ  PDP FPT+S
Sbjct: 244 KTIREFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTIS 303

Query: 303 FPNPEERGALDMAMKVADANGITVVLANDPDADRFSVAV--KYHGEWNQLTGNQIGILFA 360
           FPNPEE+GALDMA+ +A  N I++V+ANDPDADRFS A+   + GEW QLTGN+IG LF 
Sbjct: 304 FPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFG 363

Query: 361 QAEMQSYFK-EPKLDRKQ-LAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRAREL 418
                 Y   +P+  +   LAML S VSS++L+ MA+ E F  ++TLTGFKW+GN+A +L
Sbjct: 364 YYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDL 423

Query: 419 ELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQ-EVLQECYEK 477
           + EGY+V F YEEAIGYMF  + HDKDGI A+ VFLQ  +EW  ++K +  ++L++  EK
Sbjct: 424 KKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEK 483

Query: 478 YGYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSD 537
           YG F +YNGYY+ S P VT ++F Y RNEY   G  YP  IG   EV   RDLT G+QSD
Sbjct: 484 YGAFKEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSD 543

Query: 538 TATNIPDLPVDHNSQMITCVLKPVKMETDCES--VRFTARGSGTEPKLKVYIESCAANHQ 595
           T  NIP LPVD +SQMIT   K    E       VRFT RGSGTEPKLK+YIE  + +  
Sbjct: 544 TVDNIPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPI 603

Query: 596 RASHLSHLAWDVLKREWFRPTETGLQTNF 624
            AS ++ L WDVLK+EW RP  TG+ T++
Sbjct: 604 AASKIAKLTWDVLKKEWIRPEVTGVTTSY 632

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/627 (53%), Positives = 443/627 (70%), Gaps = 18/627 (2%)

Query: 6   DAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEA 65
           D  P++L++++  WL  DK  ET++E+ +L  +  W EL KR   RI FGTAGLR+RMEA
Sbjct: 10  DDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRMEA 69

Query: 66  GFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIY 125
           GFSRMN L ++QASQGLA+YIK+QFP +L  V+GHDHRFHS++FA  T + FL++ + +Y
Sbjct: 70  GFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFKVY 129

Query: 126 YLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQI 185
           YLN       ED FVHTP+VPF++N++     S GVMITASHNPKMDNGYKVYY+NGCQI
Sbjct: 130 YLN------PEDSFVHTPLVPFSVNHLNA---SIGVMITASHNPKMDNGYKVYYSNGCQI 180

Query: 186 IPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQ 245
           IPPHD+ I   ID NLEPW+  W+  +  E+ +K  KL  VR+EM  KY  +++ +LV  
Sbjct: 181 IPPHDKNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSS 240

Query: 246 SNLKFAGG---PWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVS 302
           S  +       PWFVYTPMHGVGY  F +   ++L  EE+ DY VV EQ YPDP FPTVS
Sbjct: 241 SISRPNNNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVS 300

Query: 303 FPNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVKYH--GEWNQLTGNQIGILFA 360
           FPNPEE+GAL +A K+A+ N I++V+ANDPDADRFSVA K    G+W QL+GN+IG LFA
Sbjct: 301 FPNPEEKGALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFA 360

Query: 361 QAEMQSYFKEPKLDRKQ--LAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRAREL 418
             E++ Y  +    R+   LAM+ S VSSQ+++KMA+ E F   +TLTGFKW+GNRA +L
Sbjct: 361 SFELEKYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDL 420

Query: 419 ELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQ-EVLQECYEK 477
           + +GYYVPF +EEAIGYMF  +V DKDG++AA VFL     W     S   ++L++ ++K
Sbjct: 421 QGQGYYVPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKK 480

Query: 478 YGYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSD 537
           +G+F +YNGYYI   P  TK++FD+ R +Y  +G PYP +IG EF++E  RDLT GYQS+
Sbjct: 481 FGFFKEYNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSN 540

Query: 538 TATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRA 597
           T  N+P+LPVD +S+MIT    P K +     VRFT RGSGTEPKLK+YIE+ A N + A
Sbjct: 541 TIDNLPNLPVDPHSEMITIEAVP-KQDIGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCA 599

Query: 598 SHLSHLAWDVLKREWFRPTETGLQTNF 624
             L++  W+VLK+EW RP  TGL T F
Sbjct: 600 IDLAYEMWNVLKKEWIRPDVTGLTTTF 626

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/628 (54%), Positives = 430/628 (68%), Gaps = 22/628 (3%)

Query: 7   AVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEAG 66
           ++P  LK+ +  W  +D N ET  E+ EL  N   DEL KR   RI FGTAGLR+RMEAG
Sbjct: 14  SIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRSRMEAG 73

Query: 67  FSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIYY 126
           F+RMN LTV+Q++QGLA YIKSQFP +L  V+GHDHR+HS+EFA+ T A FL   + +YY
Sbjct: 74  FNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGFKVYY 133

Query: 127 LNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQII 186
           LN        D FVHTPMVPF IN       S GVMITASHNP+MDNGYKVYY NGCQII
Sbjct: 134 LN------PNDEFVHTPMVPFGINLYSA---SIGVMITASHNPEMDNGYKVYYNNGCQII 184

Query: 187 PPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQS 246
           PPHD+ I   I+ NLEP +  W+++A+I +AI++ KL   ++++LQ+Y  ++   ++ + 
Sbjct: 185 PPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPK- 243

Query: 247 NLKFAGG-----PWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTV 301
           N+          PWFVYTPMHGVGY+ F    ++ L + ED DY+ V EQ  PDP FPTV
Sbjct: 244 NISLGTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTV 303

Query: 302 SFPNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVK--YHGEWNQLTGNQIGILF 359
           SFPNPEE+GALD+ +K A  + I +V+ANDPDADRFSVAV+     E+ QLTGN+IG LF
Sbjct: 304 SFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLF 363

Query: 360 AQAEMQSYFKEPK--LDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARE 417
           A    + Y   P    D+  LAM+ S VSSQ+++KMAE EGF   +TLTGFKW+GN+ARE
Sbjct: 364 AYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARE 423

Query: 418 LELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQ-EVLQECYE 476
           LE EGYYVPF +EEAIGYMF ++  DKDGI A  VFLQ  Y W    K S  ++++  ++
Sbjct: 424 LEKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFK 483

Query: 477 KYGYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQS 536
           KYG F +YNGYYI +  ++TK +FD  R       K Y SHIG EF+V   RDLT+GYQS
Sbjct: 484 KYGVFKEYNGYYIVNDLSLTKIIFDNIRENKNDKEK-YVSHIGTEFKVITFRDLTLGYQS 542

Query: 537 DTATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQR 596
           DT  N+P LPVD +SQMIT  + P  +  +  SVRFT RGSGTEPKLKVYIE+ A     
Sbjct: 543 DTIGNVPTLPVDPSSQMITMTIIPTSLPENG-SVRFTIRGSGTEPKLKVYIEANAKTEAE 601

Query: 597 ASHLSHLAWDVLKREWFRPTETGLQTNF 624
           A+ L+ L WDVLKREWF   +TGL TNF
Sbjct: 602 ANRLAKLTWDVLKREWFSSEKTGLTTNF 629

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/628 (53%), Positives = 428/628 (68%), Gaps = 32/628 (5%)

Query: 3   ENTDAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRAR 62
           E  +++PS L+  +  WL +DK  ET++EI +L       EL KRL   I FGTAGLR R
Sbjct: 5   EVIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGR 64

Query: 63  MEAGFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDY 122
           MEAGF+RMN LTV QASQGLA+YIK QFP++L VV+GHDHR +SR F + T+  FLQL +
Sbjct: 65  MEAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGF 124

Query: 123 DIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANG 182
            +++LN+     +E   VHTP+VPF +N       S G+MITASHNPKMDNGYKVYY NG
Sbjct: 125 KVFHLNH----ENEKSLVHTPLVPFTVNATGA---SVGIMITASHNPKMDNGYKVYYTNG 177

Query: 183 CQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTML 242
           CQIIPPHD+LI   I  NLEP++             ++G + D +++M +KY D+I + L
Sbjct: 178 CQIIPPHDKLIAESIIHNLEPFSSP-----------QTGTIIDCKEKMTKKYIDAIGSTL 226

Query: 243 VKQSNLKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVS 302
           +  +  K    PWFVYTPMHGVG+E F+     +L +EE KDY+VV EQKYPD +FPTVS
Sbjct: 227 IDGAVNKKTNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVS 286

Query: 303 FPNPEERGALDMAMKVADANG-ITVVLANDPDADRFSVAVKYHGE-----WNQLTGNQIG 356
           FPNPEE+GALD+A++    N  + +++ANDPDADRFSVAV+ + +     W QLTGN+IG
Sbjct: 287 FPNPEEKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIG 346

Query: 357 ILFAQAEMQSYFKEPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRAR 416
            LFA  E + Y   P +D + LAML S VSSQ++++MAE EGF   +TLTGFKWLGNRA 
Sbjct: 347 FLFAYYEWERYKHSP-ID-EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRAL 404

Query: 417 ELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQEVLQECYE 476
           ELE EGYY PFAYEEAIGYMFS VVHDKDGI+AA VFLQ   +W+   ++  ++L     
Sbjct: 405 ELEQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQTVLDILATASL 464

Query: 477 KYGYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQS 536
           KYG+F ++NGYYI    A+TK+VFD  R+       PYP  +G  FE+   RDLT GYQS
Sbjct: 465 KYGHFKEFNGYYIVPDLAITKQVFDAIRS----IESPYPKKLGSSFEIIKFRDLTNGYQS 520

Query: 537 DTATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQR 596
           DT  +IP+L  D +SQMITC +  + +E     VRFT RGSGTEPKLKVYIE+       
Sbjct: 521 DTPDHIPELASDPSSQMITCEM--LLVEQPTSRVRFTIRGSGTEPKLKVYIEARTNTEPN 578

Query: 597 ASHLSHLAWDVLKREWFRPTETGLQTNF 624
           +  L+   WDVL++EWF+P  TGL T F
Sbjct: 579 SIALAKFTWDVLRQEWFKPELTGLLTPF 606

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/637 (53%), Positives = 429/637 (67%), Gaps = 29/637 (4%)

Query: 9   PSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEAGFS 68
           P  L+  ++ WL  DK+  T+ EI +L  +    EL +R   RITFGTAGLR+ MEAGFS
Sbjct: 15  PEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTMEAGFS 74

Query: 69  RMNTLTVIQASQGLARYIKSQFPD---DLKVVIGHDHRFHSREFAEATIAAFLQLDYDIY 125
           RMNTLTV+QASQGLA Y+K+   +    L  VIGHDHR+HS+EFA+     FL   + +Y
Sbjct: 75  RMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIAGFKVY 134

Query: 126 YLNYVPPGSDED----VFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYAN 181
           YLN     S ED     FVHTPMVPF + N++    S GVM+TASHNPKMDNGYKVYY+N
Sbjct: 135 YLN---DDSLEDPRDNKFVHTPMVPFTVKNLKA---SVGVMVTASHNPKMDNGYKVYYSN 188

Query: 182 GCQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTM 241
           GCQIIPPHD  I + IDANLEPW  +W+ K ++  A   G L   R  ML  Y   ++  
Sbjct: 189 GCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEK 248

Query: 242 LVKQSNLKFA------GGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPD 295
           L  +  +  +        PWFVYTPMHGVGYE F +    +L ++E +D+IVV EQK+PD
Sbjct: 249 LTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPD 308

Query: 296 PEFPTVSFPNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVK---YHGEWNQLTG 352
           P FPTVSFPNPEE+GA+DM +K+A+ NGI++V+ANDPDADRFS+AVK     G W+Q TG
Sbjct: 309 PGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTG 368

Query: 353 NQIGILFAQAEMQSYFKEPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLG 412
           N+IG LFA  E Q Y K  K D  +L M+ S VSSQ+++KMAE EGF   ETLTGFKW+G
Sbjct: 369 NEIGYLFAYFEFQKY-KISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIG 427

Query: 413 NRARELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAK-SSQEVL 471
           NRA +L  +G  VPF YEEAIGYMF  +  DKDGIAA  +F+Q    W ++ K    E++
Sbjct: 428 NRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEII 487

Query: 472 QECYEKYGYFVDYNGYYISSAPAVTKEVFDYFRNEY----TPAGKPYPSHIGCEFEVEYL 527
           Q  ++KYG F++YNGYY  +   +TK++FDY R +Y    +   K YP HIG EF++   
Sbjct: 488 QLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKIIKY 547

Query: 528 RDLTVGYQSDTATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYI 587
           RDLT GYQSDT  N P LPVD +SQMIT  + P   E+D  S+R T RGSGTEPKLKVYI
Sbjct: 548 RDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDG-SIRLTIRGSGTEPKLKVYI 606

Query: 588 ESCAANHQRASHLSHLAWDVLKREWFRPTETGLQTNF 624
           E+C+ +   AS L+  AW+VLKREW RP +TG+ T F
Sbjct: 607 EACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate which is a key step in hexose
           metabolism functions as the acceptor for a
           Glc-phosphotransferase and to YKL127W uniprot|P33401
           Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 571

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 134/573 (23%), Positives = 231/573 (40%), Gaps = 92/573 (16%)

Query: 55  GTAGLRARMEAGFSRMN-TLTVIQASQGLARYIKSQFPD---DLKVVIGHDHRFHSREFA 110
           GT+GLR + +      N T   IQA       +    P+   D  +V+G D RF++    
Sbjct: 19  GTSGLRKKTKVFMEEPNYTENFIQA-------VMDAIPEGSQDATLVVGGDGRFYNDVVV 71

Query: 111 E--ATIAAFLQLDYDIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHN 168
           +  A I A   +   +   N +         + TP     I        + G+++TASHN
Sbjct: 72  QKIAAIGAANGVHKLVIGQNGI---------LSTPAASHIIRTYPHAKITGGIILTASHN 122

Query: 169 P---KMDNGYKVYYANGC--------QIIPPHDELIGRHIDAN---LEPWTRAWDSK--A 212
           P   K D G K   +NG         +I     +L    I AN   L+   +  D +   
Sbjct: 123 PGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRYGP 182

Query: 213 LIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQSNLKFAGGPWFVYTPMHGVGYEFFKEA 272
           L+ + I S + +    + +  + D I+  +  Q   K   G   ++  ++GV   + K  
Sbjct: 183 LLVDIIDSTEAYVKLMKSIFDF-DLIKKFIKTQ---KETVGFKLLFDSLNGVTGPYGKAL 238

Query: 273 VASVLGIEEDKDYIVVPEQKY-PDPEFPTVSFPNPEERGALDMAMKVADANGITVVLAND 331
               LG+  ++       Q Y P P+F  +  P+P    A  +  +V D + I    A+D
Sbjct: 239 FVDELGLSAEESL-----QNYVPKPDFGGLH-PDPNLTYAHTLVERV-DKDKIAFGAASD 291

Query: 332 PDADRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSYFKEPKLDRKQLAMLTSAVSSQLLR 391
            D DR    +  +G      G+ + I+   A    YF +  +      +  S  +S  + 
Sbjct: 292 GDGDR--NMIYGYGPAFVSPGDSVAIIAEYASEIPYFAKQGI----YGLARSFPTSAAID 345

Query: 392 KMAEEEGFLAVETLTGFKWLGN--RARELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAA 449
           ++A+  G    E  TG+K+      A++L + G       EE+ G   S  V +KDG+ A
Sbjct: 346 RVAKAHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGVWA 397

Query: 450 AAVFLQM--CYEWKKVAK--SSQEVLQECYEKYG--YFVDYNGYYISS--APAVTKEVFD 501
              +L +   Y  K   K  S + + +E + KYG  +F  Y+   I+S  A  V + + +
Sbjct: 398 IMAWLNILAIYNRKNPTKEASIKTIQEEFWNKYGRTFFTRYDFEQIASENADKVIQLLHN 457

Query: 502 YFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATNIPDLPVDHNSQMITCVLKPV 561
           +   + +   K +P+            DLTV    D +    D  V  N  +       V
Sbjct: 458 FVSKKDSVVNKAFPAAT----------DLTVVDAGDFSYTDLDGSVSSNQGLF------V 501

Query: 562 KMETDCE-SVRFTARGSGTEPKLKVYIESCAAN 593
           K+   C+  VR +  GS +   +++Y+E  + N
Sbjct: 502 KLSNGCKFVVRLSGTGS-SGATIRLYVERYSDN 533

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 108/484 (22%), Positives = 196/484 (40%), Gaps = 68/484 (14%)

Query: 55  GTAGLRARMEAGFSRMNTLTVIQASQGLARYIKSQFPDDLK---VVIGHDHRFHSREFAE 111
           GT+GLR + +   S  N       ++   + I +  P+ +K   +V+G D RF++    +
Sbjct: 19  GTSGLRKKTKIFMSEKN------YTENFIQSILNSIPNGVKNSTIVVGGDGRFYN----D 68

Query: 112 ATIAAFLQLDYDIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHN--- 168
             +   +Q+         V     ++  + TP   + I N +      G+++TASHN   
Sbjct: 69  IILDKIMQISAANGVRKLV---IGQNGILSTPAASYIIRNYKESCNGGGIILTASHNPGG 125

Query: 169 PKMDNGYKVYYANGC--------QIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKS 220
           P+ D G K   +NG         +I      L    I  NL            + E +K 
Sbjct: 126 PENDIGIKYNLSNGGPAPESITDEIWEASKHLTHYKIIENLPQL-----DTTKVSENVKY 180

Query: 221 GKLH----DVRKEMLQKYKDSIQTMLVKQ-SNLKFAGGPW-FVYTPMHGVGYEFFKEAVA 274
           G L     D  K  ++  K+     L++   + +     W  ++  ++GV   + K    
Sbjct: 181 GPLLVDIIDSTKSYVELMKEIFDFPLIRNFIHTQREKNNWKLLFDSLNGVTGPYGKTIFV 240

Query: 275 SVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPEERGALDMAMKVADANGITVVLANDPDA 334
             LG+  D+      +  +P P+F  +  P+P    A  +  +V D   I    A+D D 
Sbjct: 241 DELGLLADETL----QNWHPLPDFGGLH-PDPNLTYAHTLVERV-DREMINFGAASDGDG 294

Query: 335 DRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSYFKEPKLDRKQLAMLTSAVSSQLLRKMA 394
           DR    +  +G      G+ + I+   A+   YF +    +    +  S  +S  + ++A
Sbjct: 295 DR--NMIYGYGPSFVSPGDSLAIISEYADEIPYFAK----QGMFGVARSFPTSSAIDRVA 348

Query: 395 EEEGFLAVETLTGFKWLGN--RARELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAV 452
           + +G    E  TG+K+      A++L + G       EE+ G   S  + +KDG+ A   
Sbjct: 349 KAKGLNCYEVPTGWKFFCALFDAQKLSICG-------EESFG-TGSNHIREKDGLWAIVA 400

Query: 453 FLQMCYEWKK----VAKSSQEVLQECYEKYG--YFVDYNGYYISS--APAVTKEVFDYFR 504
           +L +   + K       S + +  + + KYG  +F  Y+   +SS  A  V K + DY  
Sbjct: 401 WLNILAIYNKRNPEKESSIKNIQMDFWLKYGRTFFTRYDYENLSSEDAEKVVKLLKDYVS 460

Query: 505 NEYT 508
           +  T
Sbjct: 461 DPQT 464

>TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {ON}
           Anc_2.445 YKL127W
          Length = 571

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 114/490 (23%), Positives = 193/490 (39%), Gaps = 63/490 (12%)

Query: 55  GTAGLRARMEAGFSRMNTLTVIQASQGLARYIKSQFPDDLK---VVIGHDHRFHSREFAE 111
           GT+GLR +  A F +    T     +   + I    P+  K   +V+G D R+++     
Sbjct: 20  GTSGLRKKT-AIFEKEPNYT-----ENFIQAIMEAIPEGCKGATLVVGGDGRYYNDAILH 73

Query: 112 --ATIAAFLQLDYDIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHN- 168
             A I A   +   I           ++  + TP     I     G  + G+++TASHN 
Sbjct: 74  NIAAIGAANGVKKLIV---------GQNGLLSTPAASHIIRTYAPGEITGGIILTASHNP 124

Query: 169 --PKMDNGYKVYYANGCQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLH-- 224
             PK D G K    NG     P  E I       L+ +    D   L  + +   K +  
Sbjct: 125 GGPKNDMGIKYNIQNGAPAPEPVTEAI-WEASKKLQNYKIIKDFPELELKTLGKNKQYGP 183

Query: 225 ------DVRKEMLQKYKDSIQTMLVKQ-SNLKFAGGPW-FVYTPMHGVGYEFFKEAVASV 276
                 D  +  +Q  K+     L+K+  + +     W  ++  M+GV   + K      
Sbjct: 184 LLVDVIDTCEAYVQFIKEIFDFPLIKKFVDTQRKTKNWKLLFDGMNGVTGPYGKAIFVDE 243

Query: 277 LGIEEDKDYIVVPEQKYPDPEFPTVSFPNPEERGALDMAMKVADANGITVVLANDPDADR 336
           LG+  D+    V +  +P P+F     P+P    A  +  +V D   I    A+D D DR
Sbjct: 244 LGLPADE----VLKDWHPSPDFGG-HHPDPNLTYAKSLVDRV-DKEKIEFGAASDGDGDR 297

Query: 337 FSVAVKYHGEWNQLTGNQIGILFAQAEMQSYFKEPKLDRKQLAMLTSAVSSQLLRKMAEE 396
               +  +G      G+ + I+   A    YFK+  +      +  S  ++  + ++A+ 
Sbjct: 298 --NMIYGYGPAFVSPGDSVAIIAEYASDIPYFKKNGI----YGLARSFPTASSIDRVAKA 351

Query: 397 EGFLAVETLTGFKWLGNRARELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQM 456
            G  A E  TG+K+          +   V    EE+ G   S  V +KDG+ A   +L +
Sbjct: 352 HGLKAYEVPTGWKFFCKL-----FDSKKVSICGEESFG-TGSNHVREKDGVWAIIAWLNI 405

Query: 457 --CYEWKKVAK--SSQEVLQECYEKYG--YFVDYNGYYISSAPAVTKEVFDYFRN---EY 507
              Y  K   K  S + +  E + KYG  +F  Y+   + S  A   ++    R    + 
Sbjct: 406 LAIYNQKNPEKEASIKTIQDEFWLKYGRTFFTRYDYEKVESQKA--NQIVAKLRKFVLDP 463

Query: 508 TPAGKPYPSH 517
           +  GKP+P++
Sbjct: 464 SNKGKPFPTN 473

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 96/375 (25%), Positives = 152/375 (40%), Gaps = 56/375 (14%)

Query: 157 TSCGVMITASHNP---KMDNGYKVYYANGCQIIPPHDELIGRHIDANLEPWTRAWDSKAL 213
           T  G+++TASHNP   K D G K   +NG     P    I   I   +  +    D   L
Sbjct: 110 TQGGIILTASHNPGGIKNDMGIKFNLSNGGPAPEPVTNKI-WEISKKMTSFKIIKDFPEL 168

Query: 214 IEEAIKSGKLH--------DVRKEMLQKYK-----DSIQTMLVKQSNLKFAGGPW-FVYT 259
             E +   K +        D  K  ++  K     D I+  + KQ + K     W  ++ 
Sbjct: 169 ELETLGKNKKYGPLLVDVIDTTKAYVEFVKQIFDFDLIKKFVHKQRDTKH----WKLLFD 224

Query: 260 PMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPEERGALDMAMKVA 319
            M+GV   + K      LG+  D+    V +Q +P P+F  V  P+P    A  +  +V 
Sbjct: 225 GMNGVTGPYGKAIFVDELGLPADE----VLQQWHPSPDFGGVH-PDPNLTYAKALVDRV- 278

Query: 320 DANGITVVLANDPDADRFSVAVKYHGEWNQLT--GNQIGILFAQAEMQSYFKEPKLDRKQ 377
           D   I    A+D D DR  +    +G        G+ + I+   A    YF +  +    
Sbjct: 279 DRENIEFGAASDGDGDRNMI----YGAGPAFVSPGDSVAIIAEYAAEIPYFAKQGI---- 330

Query: 378 LAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGN--RARELELEGYYVPFAYEEAIGY 435
             +  S  +S  + ++A+  G    E  TG+K+      A++L + G       EE+ G 
Sbjct: 331 YGLARSFPTSSAIDRVAKAHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG- 382

Query: 436 MFSQVVHDKDGIAAAAVFLQMCYEWKK---VAKSSQEVLQ-ECYEKYG--YFVDYNGYYI 489
             S  V +KDGI A   +L +   + K       S +++Q E + KYG  +F  Y+  Y 
Sbjct: 383 TGSNHVREKDGIWAILAWLNLLAIYNKHHPDRDVSIKIIQDEFWNKYGRTFFTRYD--YE 440

Query: 490 SSAPAVTKEVFDYFR 504
             A     +V D  R
Sbjct: 441 KVATEDAAKVIDNLR 455

>TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa]
           {ON} Anc_2.445 YKL127W
          Length = 569

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 122/486 (25%), Positives = 185/486 (38%), Gaps = 83/486 (17%)

Query: 55  GTAGLRARMEAGFSRMN-TLTVIQASQGLARYIKSQFPD---DLKVVIGHDHRFHSREFA 110
           GT+GLR + +      N T   IQA       I    P+   D  +V+G D RF++    
Sbjct: 19  GTSGLRKKTKVFMDEPNYTENFIQA-------IMDAIPEGSKDATLVVGGDGRFYNDVIM 71

Query: 111 E--ATIAAFLQLDYDIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHN 168
              A I A   +   I   N +         + TP     I   +   T  G+++TASHN
Sbjct: 72  NKIAAIGAANGVKKLIIGQNGI---------LSTPAASHIIRTYKDKVTG-GIILTASHN 121

Query: 169 ---PKMDNGYKVYYANGCQIIPPHDELIGRHIDANLEPWTRAWDSK----------ALIE 215
              P  D G K    NG     P  E +    DA  E   +  D K          A I 
Sbjct: 122 PGGPTNDLGIKYNLGNGA----PAPEAV---TDAIWEASKKLTDYKIVNDFPELDLATIV 174

Query: 216 EAIKSGKLH-DV--RKEMLQKYKDS------IQTMLVKQSNLKFAGGPW-FVYTPMHGVG 265
           E  K G L  D+    E   KY         I+  +V Q   K     W  ++  ++GV 
Sbjct: 175 ENKKYGNLLVDIIDSTEAYVKYMKEIFDFPLIKKFIVSQRETK----NWKLLFDSLNGVT 230

Query: 266 YEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPEERGALDMAMKVADANGIT 325
             + K   A   G+  D+    V +   P P+F  +  P+P    A  +  +V D   I 
Sbjct: 231 GPYGKAIFADEFGLPADE----VLQNYVPKPDFGGLH-PDPNLTYAKTLVSRV-DKEKIE 284

Query: 326 VVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSYFKEPKLDRKQLAMLTSAV 385
              A+D D DR    +  +G      G+ + I+   A    YF +  +      +  S  
Sbjct: 285 FGAASDGDGDR--NMIYGYGPTFVSPGDSVAIIAEYASEIPYFAKQGI----YGLARSFP 338

Query: 386 SSQLLRKMAEEEGFLAVETLTGFKWLGNRARELELEGYYVPFAYEEAIGYMFSQVVHDKD 445
           +S  + ++A+E      E  TG+K+      E +L         EE+ G   S  V +KD
Sbjct: 339 TSSAIDRVAKEHNLNCYEVPTGWKFFCKLFDENKLS-----ICGEESFG-TGSNHVREKD 392

Query: 446 GIAAAAVFLQMCYEWKKV----AKSSQEVLQECYEKYG--YFVDYNGYYISSAPAVTKEV 499
           G+ A   +L +   + K       S + +  E + KYG  +F  Y+   I S  A   E+
Sbjct: 393 GVWAIMAWLNILAIYNKKHPERDASLKTIQDEFWAKYGRTFFTRYDFENIKSETA--NEI 450

Query: 500 FDYFRN 505
            D  +N
Sbjct: 451 VDILKN 456

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 70/316 (22%), Positives = 108/316 (34%), Gaps = 61/316 (19%)

Query: 160 GVMITASHNPKMDNGYKVYYANGC----QIIPPHDELIGRHIDANLEPWTRAWDSKALIE 215
           GVM+TASHNP  DNG KV    G     Q  P    L     +   + W   W S  L+E
Sbjct: 59  GVMVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTS--LVE 116

Query: 216 EAIKSGKL-----HDVRKEMLQKYKDSIQTMLVKQSNLKFAGGPWFVYTP---------- 260
           E   +G       HD R+   +  K+ +   L           PW    P          
Sbjct: 117 EGNYTGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSLQR 176

Query: 261 ------------MHGVGYEFFKEAVAS----------------------VLGIEEDKDYI 286
                         G   + F + V +                        G   D++  
Sbjct: 177 DGVTDAAAYNDHFQGCWQKLFPDGVVAWPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKF 236

Query: 287 VVPEQKYPDPEFPTVSFPNPEERGALDMAMKVADANGITVVLAN-----DPDADRFSVAV 341
            +    Y  PE   V       +    +  +V D  G +  L +     D DADR     
Sbjct: 237 RLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFDGDADRIVFYF 296

Query: 342 KYHGEWNQLTGNQIGILFAQAEMQSYFKEPKLDRKQLAMLTSA-VSSQLLRKMAEEEGFL 400
             + +++ L G++I  LFA+   Q   +    D+  + ++ +A  +    R +A E G  
Sbjct: 297 VKNKQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNSTRYIASELGIP 356

Query: 401 AVETLTGFKWLGNRAR 416
           +  T TG K L + A+
Sbjct: 357 SACTKTGVKHLHHVAK 372

>Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C
           (PGM2) - Phosphoglucomutase [contig 55] FULL
          Length = 570

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 121/530 (22%), Positives = 211/530 (39%), Gaps = 88/530 (16%)

Query: 92  DDLKVVIGHDHRFHSREFAE--ATIAAFLQLDYDIYYLNYVPPGSDEDVFVHTPMVPFAI 149
           ++  +V+G D R+++ E  +    IAA   +   I   N +         + TP     I
Sbjct: 53  ENATLVVGGDGRYYNNEVMQIIGAIAAANGVRKMILGQNGI---------LSTPAASHII 103

Query: 150 NNVEGGPTSC--GVMITASHNP---KMDNGYKVYYANGCQIIPPHDELIGRHIDANLEPW 204
            +    P  C  G+++TASHNP   + D G K   +NG     P  E +   I    +  
Sbjct: 104 RSY---PEKCTGGIILTASHNPGGPENDFGIKYNLSNGG----PAPESVTNAIFEKSKQL 156

Query: 205 TRAWDSKAL----IEEAIKSGKLHDVRKEMLQKYKDSIQTM-------LVKQ--SNLKFA 251
           T     K        +  K  K   +  +++    D +  M       L+K+   N +  
Sbjct: 157 THYKIVKNFPKIDFSKIGKDQKYGPLLVDVVDSTADYVALMKEIFDFDLIKKFIDNQRST 216

Query: 252 GGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPEERGA 311
            G   ++  ++GV   + +      LG+  ++    V +   P P+F  +  P+P    A
Sbjct: 217 KGFKILFDSLNGVTGPYGEAIFVKELGLPAEE----VLQNYVPKPDFGGLH-PDPNLTYA 271

Query: 312 LDMAMKVADANGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSYFKEP 371
             +  +V D   I    A+D D DR    +   G      G+ + I+   A    YFK+ 
Sbjct: 272 HTLVERV-DKEQIAFGAASDGDGDR--NMIYGCGPAFVSPGDSVAIIAEYASEIPYFKKQ 328

Query: 372 KLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGN--RARELELEGYYVPFAY 429
            +      +  S  +S  + ++A+E+G    E  TG+K+      A++L + G       
Sbjct: 329 GI----YGLARSFPTSAAIDRVAKEQGLACYEVPTGWKFFCALFDAKKLSICG------- 377

Query: 430 EEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKK---VAKSSQEVLQECY-EKYG--YFVD 483
           EE+ G   S  V +KDG+ A   +L +   + +    +  S +V+QE +  KYG  +F  
Sbjct: 378 EESFG-TGSNHVREKDGVWAIVAWLNILAIYNRDHPDSDVSIKVIQEKFWAKYGRTFFTR 436

Query: 484 YNGYYIS--SAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATN 541
           Y+   +S  SA  V + + D    + +  GKP+  +            LTV    D +  
Sbjct: 437 YDFEQVSSESAAQVLQVLEDLVAAKDSSVGKPFAGNPA----------LTVADCGDFSYT 486

Query: 542 IPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPK---LKVYIE 588
             D  V  +  +        K+   C   RF  R SGT      +++Y+E
Sbjct: 487 DLDGSVSEHQGLYA------KLSNGC---RFVVRLSGTGSSGATIRLYVE 527

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 106/459 (23%), Positives = 188/459 (40%), Gaps = 71/459 (15%)

Query: 158 SCGVMITASHN---PKMDNGYKVYYANGCQIIPPHDELIGRHIDANLEPWTRAWDSKAL- 213
           + G+++TASHN   PK D G K   +NG     P    I   +   L+ +    D   L 
Sbjct: 111 TGGIILTASHNPGGPKNDMGIKYNLSNGGPAPEPVTNKI-WEVSKQLDHYKIIPDLPELA 169

Query: 214 ---IEEAIKSGKLH----DVRKEMLQKYKDS-----IQTMLVKQSNLKFAGGPW-FVYTP 260
              + E ++ G L     D  ++ ++  K+      I++ + KQ + K     W  ++  
Sbjct: 170 LDTLAENVQYGPLLVDVVDTTRDYVEFLKEIFDFPLIKSFIHKQRSQKH----WKLLFDG 225

Query: 261 MHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPEERGALDMAMKVAD 320
           M+GV   + K        +  ++    V +  +P P+F  +  P+P    A  +  +V D
Sbjct: 226 MNGVTGPYGKAIFVDEFELPAEE----VLQNWHPQPDFGGIH-PDPNLTYARSLVDRV-D 279

Query: 321 ANGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSYFKEPKLDRKQLAM 380
              I    A+D D DR  +     G      G+ + I+   A    YF +  +      +
Sbjct: 280 RENIEFGAASDGDGDRNMIYGA--GPAFVSPGDSVAIIAEYAAEIPYFAKQGI----YGL 333

Query: 381 LTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGN--RARELELEGYYVPFAYEEAIGYMFS 438
             S  ++  + ++AE+ G    E  TG+K+      A++L + G       EE+ G   S
Sbjct: 334 ARSFPTASAIDRVAEKHGLKCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGS 385

Query: 439 QVVHDKDGIAAAAVFLQMCYEWKKVAK----SSQEVLQECYEKYG--YFVDYNGYYISSA 492
             V +KDG+ A   +L +   + +       S + + +E ++KYG  +F  Y+  ++ S 
Sbjct: 386 NHVREKDGVWAIIAWLNLLAIYNRRHPDRDVSIKIIQEEFWKKYGRVFFTRYDYEHVDSN 445

Query: 493 PAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATNIPDLPVDHNSQ 552
            A  K+V D  R+ YT      P  +G +F  +    LTV    D +    D  V  +  
Sbjct: 446 SA--KKVIDNLRS-YTEK----PGVVGSKFPTD--TTLTVTESGDFSYKDLDGSVSEHQG 496

Query: 553 MITCVLKPVKMETDCESVRFTARGSGTEPK---LKVYIE 588
           +   +             RF  R SGT      +++Y+E
Sbjct: 497 LYVRL---------SNGARFVVRLSGTGSSGATIRLYLE 526

>Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 125/573 (21%), Positives = 223/573 (38%), Gaps = 89/573 (15%)

Query: 55  GTAGLRARMEAGFSRMN-TLTVIQASQGLARYIKS--QFPDDLKVVIGHDHRFHSREFAE 111
           GT+GLR +       ++ T   IQA+      I+S    P  + +V+G D RF++     
Sbjct: 19  GTSGLRKKTRVFMDELHYTENFIQAT------IESIPNGPGGVTLVVGGDGRFYNDVIMN 72

Query: 112 ATIAAFLQLDYDIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHN--- 168
              A           +        +   + TP     I   E   +  G+++TASHN   
Sbjct: 73  KIAAVGAANGVRKLVIG-------QGGLLSTPAASHVIRTYEDKCSGGGIILTASHNPGG 125

Query: 169 PKMDNGYKVYYANG-------------CQIIPPHDELIGRHIDANLEPWTRAWDSKALIE 215
           P+ D G K    NG                   H ++I    + NL    +      L+ 
Sbjct: 126 PENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYKIIKDFPELNLNKLGKNQRYGPLLV 185

Query: 216 EAIKSGKLH-DVRKEMLQKYKDSIQTMLVKQSNLKFAGGPWFVYTPMHGVGYEFFKEAVA 274
           + I+  K +  + KE+     D I+  L +Q  +K   G   ++  ++G+   + K    
Sbjct: 186 DIIEPAKAYVQLLKEIFD--FDLIRGFLKEQRRVK---GWKLLFDSLNGITGPYGKALFV 240

Query: 275 SVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPEERGALDMAMKVADANGITVVLANDPDA 334
              G+  ++    V +  +P P+F  +  P+P    A  +  +V D   I    A+D D 
Sbjct: 241 DEFGLPAEE----VLQNWHPLPDFGGLH-PDPNLTYAHTLVDRV-DREKIEFGAASDGDG 294

Query: 335 DRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSYFKEPKLDRKQLAMLTSAVSSQLLRKMA 394
           DR    +  +G      G+ + I+   A    YF +  +      +  S  +S  + ++A
Sbjct: 295 DR--NMIYGYGPAFVSPGDSVAIIAQYAPDIPYFVKHGI----YGLARSFPTSSAIDRVA 348

Query: 395 EEEGFLAVETLTGFKWLGN--RARELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAV 452
            + G    E  TG+K+      A++L + G       EE+ G   S  + +KDG+ A   
Sbjct: 349 AKNGLKCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHIREKDGLWAIIA 400

Query: 453 FLQM--CYEWKKVAK--SSQEVLQECYEKYG--YFVDYNGYYISSAPA-VTKEVFDYFRN 505
           +L +   Y  +   K  S + +  E + +YG  +F  Y+  +I    A     + D F  
Sbjct: 401 WLNILAIYNKRNPGKEASIKTIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLDKFVT 460

Query: 506 EYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATNIPDLPVDHNSQMITCVLKPVKMET 565
           E        P+ +G +F  +  + LTV    D +    D  +     +       VK+  
Sbjct: 461 E--------PNVVGSQFPGD--KSLTVTDCGDFSYTDLDGSISERQGLF------VKL-- 502

Query: 566 DCESVRFTARGSGTEPK---LKVYIESCAANHQ 595
             +  +F  R SGT      +++YIE  + N +
Sbjct: 503 -SDGAKFVLRLSGTGSSGATIRLYIEKYSDNKE 534

>TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 116/479 (24%), Positives = 193/479 (40%), Gaps = 71/479 (14%)

Query: 55  GTAGLRARMEAGFSRMN-TLTVIQASQGLARYIKSQFPD---DLKVVIGHDHRFHSREFA 110
           GT+GLR + +   +  N T   IQA       I    P+   +  +V+G D RF++    
Sbjct: 19  GTSGLRKKSKVFMNEPNYTENFIQA-------ILDAIPEGSENSTLVVGGDGRFYND--- 68

Query: 111 EATIAAFLQLDYDIYYLNYVPPGS-DEDVFVHTPMVPFAINNVEGGPTSCGVMITASHN- 168
                  LQL  +I   N V      +   + TP     I       T  G+++TASHN 
Sbjct: 69  -----VILQLIAEIGAANGVRKLIIGQAGILSTPAASHIIRTYHEEVTG-GIILTASHNP 122

Query: 169 --PKMDNGYKVYYANGCQIIPPHDELIGRHI---DANLEPWTRAWDSKAL----IEEAIK 219
             P+ D G K   ANG     P  E +   I     NL  +    D   +    I E +K
Sbjct: 123 GGPENDIGIKYNLANGG----PAPESVTNAIWEASKNLTTYKTMKDFPKIDINTISENVK 178

Query: 220 SGKLH----DVRKEMLQKYKDSIQTMLVKQ-SNLKFAGGPW-FVYTPMHGVGYEFFKEAV 273
            G L     D  ++ ++  K+     L+K+    +     W  ++  ++GV   + K   
Sbjct: 179 YGPLLIDIIDSTEDYVKFLKEIFDFPLIKKFIETQRKTNNWKLLFDSLNGVTGPYGKAIF 238

Query: 274 ASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPEERGALDMAMKVADANGITVVLANDPD 333
               G+  D+    V +  +P P+F  +  P+P    A  +  +V D   I    A+D D
Sbjct: 239 VDEFGLPADE----VLQNWHPQPDFGGLH-PDPNLTYARTLVDRV-DKEKIEFGAASDGD 292

Query: 334 ADRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSYFKEPKLDRKQLAMLTSAVSSQLLRKM 393
            DR    +  +G      G+ + I+   A    YF +  +      +  S  +S  +  +
Sbjct: 293 GDR--NMIYGYGPAFVSPGDSVAIIAEYANEIPYFAKQGI----YGVARSFPTSSAIDLV 346

Query: 394 AEEEGFLAVETLTGFKWLGN--RARELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAA 451
           A+ +G    E  TG+K+      A++L + G       EE+ G   S  V +KDG+ A  
Sbjct: 347 AKHKGLDCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGVWAII 398

Query: 452 VFLQMCYEWKK----VAKSSQEVLQECYEKYG--YFVDYNGYYISSAPAVTKEVFDYFR 504
            +L +   + K       S + +  E ++KYG  +F  Y+   + SA A   +V D+  
Sbjct: 399 AWLNILAIYNKHHPEKDASIKTIQTEFWQKYGRTFFTRYDYESLPSADAA--KVVDFLN 455

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 42/87 (48%), Gaps = 10/87 (11%)

Query: 137 DVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQII----PPHDEL 192
           +  + T  +   + ++  G  + GVMITASHNP  DNG K+   NG  +     P   EL
Sbjct: 32  NTVMFTTGIVACLRSISLGGKAVGVMITASHNPPEDNGVKIVEPNGAMLDQSWEPMATEL 91

Query: 193 IGRHIDANLEPWTRAWDSKALIEEAIK 219
                 AN+   +   D KA +EE +K
Sbjct: 92  ------ANIAANSTFDDLKAYVEEKVK 112

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 86/375 (22%), Positives = 150/375 (40%), Gaps = 44/375 (11%)

Query: 158 SCGVMITASHN---PKMDNGYKVYYANGCQIIPPHDELIGRHIDANLEPWTRAWDSKALI 214
           + G+++TASHN   P+ D G K   +NG    P     +   I   L  +    D   L 
Sbjct: 111 TGGIILTASHNPGGPENDMGIKYNLSNGGP-APESVTNVIWDISKKLTSYKIIKDFPELD 169

Query: 215 EEAIKSGKLH--------DVRKEMLQKYKDSIQTMLVKQ--SNLKFAGGPWFVYTPMHGV 264
              I   K +        D+ K+ +   K+     L+K+   N +       ++  M+GV
Sbjct: 170 LATIGKNKKYGPLLVDIIDITKDYVDFLKEIFDFKLIKKFIDNQRSTKNWKLLFDSMNGV 229

Query: 265 GYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPEERGALDMAMKVADANGI 324
              + K       G+  D+    V +  +P P+F  +  P+P    A  +  +V D   I
Sbjct: 230 TGPYGKAIFVDEFGLPADE----VLQNWHPSPDFGGMH-PDPNLTYASTLVKRV-DREKI 283

Query: 325 TVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSYFKEPKLDRKQLAMLTSA 384
               A+D D DR    +  +G      G+ + I+   A    YF +  +      +  S 
Sbjct: 284 EFGAASDGDGDR--NMIYGYGPSFVSPGDSVAIIAEYAAEIPYFAKQGI----YGLARSF 337

Query: 385 VSSQLLRKMAEEEGFLAVETLTGFKWLGN--RARELELEGYYVPFAYEEAIGYMFSQVVH 442
            +S  + ++A+  G    E  TG+K+      A++L + G       EE+ G   S  V 
Sbjct: 338 PTSAAIDRVAKAHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVR 389

Query: 443 DKDGIAAAAVFLQMCYEWKK----VAKSSQEVLQECYEKYG--YFVDYNGYYISSAPAVT 496
           +KDG+ A   +L +   + K       S + +  E + KYG  +F  Y+   + S  A  
Sbjct: 390 EKDGVWAIMAWLNILAIYNKHHPENEASIKTIQNEFWAKYGRTFFTRYDFEKVESQKA-- 447

Query: 497 KEVFDYFRNEYTPAG 511
            ++ D  +   T +G
Sbjct: 448 NKIVDQLKAYVTKSG 462

>YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON}
           PGM2Phosphoglucomutase, catalyzes the conversion from
           glucose-1-phosphate to glucose-6-phosphate, which is a
           key step in hexose metabolism; functions as the acceptor
           for a Glc-phosphotransferase
          Length = 569

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 87/378 (23%), Positives = 151/378 (39%), Gaps = 50/378 (13%)

Query: 158 SCGVMITASHN---PKMDNGYKVYYANGCQIIPPHDELIGR---HIDANLEPWTRAWDSK 211
           + G+++TASHN   P+ D G K   +NG     P  E +      I   L  +    D  
Sbjct: 111 TGGIILTASHNPGGPENDMGIKYNLSNGG----PAPESVTNAIWEISKKLTSYKIIKDFP 166

Query: 212 ALIEEAIKSGKLH--------DVRKEMLQKYKDSIQTMLVKQ--SNLKFAGGPWFVYTPM 261
            L    I   K +        D+ K+ +   K+     L+K+   N +       ++  M
Sbjct: 167 ELDLGTIGKNKKYGPLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSM 226

Query: 262 HGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPEERGALDMAMKVADA 321
           +GV   + K       G+  D+    V +  +P P+F  +  P+P    A  +  +V D 
Sbjct: 227 NGVTGPYGKAIFVDEFGLPADE----VLQNWHPSPDFGGMH-PDPNLTYASSLVKRV-DR 280

Query: 322 NGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSYFKEPKLDRKQLAML 381
             I    A+D D DR    +  +G      G+ + I+   A    YF +  +      + 
Sbjct: 281 EKIEFGAASDGDGDR--NMIYGYGPSFVSPGDSVAIIAEYAAEIPYFAKQGI----YGLA 334

Query: 382 TSAVSSQLLRKMAEEEGFLAVETLTGFKWLGN--RARELELEGYYVPFAYEEAIGYMFSQ 439
            S  +S  + ++A+  G    E  TG+K+      A++L + G       EE+ G   S 
Sbjct: 335 RSFPTSGAIDRVAKAHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSN 386

Query: 440 VVHDKDGIAAAAVFLQMCYEWKK----VAKSSQEVLQECYEKYG--YFVDYNGYYISSAP 493
            V +KDG+ A   +L +   + K       S + +  E + KYG  +F  Y+   + +  
Sbjct: 387 HVREKDGVWAIMAWLNILAIYNKHHPENEASIKTIQNEFWAKYGRTFFTRYDFEKVETEK 446

Query: 494 AVTKEVFDYFRNEYTPAG 511
           A   ++ D  R   T +G
Sbjct: 447 A--NKIVDQLRAYVTKSG 462

>Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 88/386 (22%), Positives = 156/386 (40%), Gaps = 53/386 (13%)

Query: 158 SCGVMITASHN---PKMDNGYKVYYANGCQIIPPHDELIGR---HIDANLEPWTRAWDSK 211
           + G+++TASHN   P+ D G K   +NG     P  E +      I   L  +    D  
Sbjct: 111 TGGIILTASHNPGGPENDMGIKYNLSNGG----PAPESVTNAIWEISKKLTSYKIVKDFP 166

Query: 212 ALIEEAIKSGKLH--------DVRKEMLQKYKDSIQTMLVKQ--SNLKFAGGPWFVYTPM 261
            L  + I   + +        DV K  ++  ++     L+K+   N +       ++  M
Sbjct: 167 ELDLQTIGKDRKYGPLLIDIIDVTKAYVELMEEIFDFNLIKKFIDNQRSTKNWKLLFDSM 226

Query: 262 HGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPEERGALDMAMKVADA 321
           +GV   + K       G+  ++    V +  +P P+F  +  P+P    A  +  +V D 
Sbjct: 227 NGVTGPYGKAIFVDKFGLPAEE----VLQNWHPSPDFGGMH-PDPNLTYASSLVKRV-DR 280

Query: 322 NGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSYFKEPKLDRKQLAML 381
             I    A+D D DR    +  +G      G+ + I+   A    YF +  +      + 
Sbjct: 281 EQIEFGAASDGDGDR--NMIYGYGPSFVSPGDSVAIIAEYAAEIPYFAKQGI----YGLA 334

Query: 382 TSAVSSQLLRKMAEEEGFLAVETLTGFKWLGN--RARELELEGYYVPFAYEEAIGYMFSQ 439
            S  +S  + ++A+  G    E  TG+K+      A++L + G       EE+ G   S 
Sbjct: 335 RSFPTSAAIDRVAKAHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSN 386

Query: 440 VVHDKDGIAAAAVFLQMCYEWKK----VAKSSQEVLQECYEKYG--YFVDYNGYYISSAP 493
            V +KDG+ A   +L +   + K       S + +  E + KYG  +F  Y+   + S  
Sbjct: 387 HVREKDGVWAIMAWLNILAIYNKHHPEKEASIKTIQDEFWAKYGRTFFTRYDFEKVESEK 446

Query: 494 AVTKEVFDY---FRNEYTPAGKPYPS 516
           A   E+ D    F ++    G P+P+
Sbjct: 447 A--NEIVDQLGAFTSKPGVIGSPFPT 470

>KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 568

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 88/372 (23%), Positives = 152/372 (40%), Gaps = 72/372 (19%)

Query: 158 SCGVMITASHNP---KMDNGYKVYYANGCQIIPPHDELIGRHIDANLEPW--TRAWDSKA 212
           + G+++TASHNP     D G K   ANG     P  E +   I      W  +R      
Sbjct: 111 TGGIILTASHNPGGPTNDFGIKYNLANGG----PAPESVTNSI------WHKSRELTHYK 160

Query: 213 LIEE--AIKSGKLHDVRK--EMLQKYKDS----------------IQTMLVKQSNLKFAG 252
           ++E   AI   K+   +K  ++L    DS                I++ +  Q+   F  
Sbjct: 161 IVESFPAIDLTKIGQDQKYGDLLVDIVDSTAAYVELMKEIFDFPLIKSFIDTQAKNGFK- 219

Query: 253 GPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPEERGAL 312
               ++  M+GV   + +      LG+ E        +  +P P+F  +  P+P    A 
Sbjct: 220 ---ILFDAMNGVTGPYGEALFVKELGLPESS-----LQNYHPKPDFGGLH-PDPNLTYAH 270

Query: 313 DMAMKVADANGITVVLANDPDADRFSVAVKYHGEWNQLT--GNQIGILFAQAEMQSYFKE 370
            +  +V D  GI    A+D D DR  +    +G        G+ + I+   A    YFK+
Sbjct: 271 TLVERV-DKYGIQFGAASDGDGDRNMI----YGAGPAFVSPGDSVAIIAEYASAIPYFKK 325

Query: 371 PKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGN--RARELELEGYYVPFA 428
             +      +  S  +S  + ++A+E+G    E  TG+K+      A++L + G      
Sbjct: 326 QGI----YGLARSFPTSSAIDRVAKEQGLNCYEVPTGWKFFCALFDAKKLSICG------ 375

Query: 429 YEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKK----VAKSSQEVLQECYEKYG--YFV 482
            EE+ G   S  V +KDG+ A   +L +   + +       S + +  + ++KYG  +F 
Sbjct: 376 -EESFG-TGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIKSIQTDFWQKYGRTFFT 433

Query: 483 DYNGYYISSAPA 494
            Y+   +SS  A
Sbjct: 434 RYDFENLSSEDA 445

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 87/376 (23%), Positives = 155/376 (41%), Gaps = 58/376 (15%)

Query: 157 TSCGVMITASHNP---KMDNGYKVYYANGCQIIPP-------------HDELIGRHIDAN 200
           T+ G+++TASHNP   + D G K   +NG     P             H ++I    +  
Sbjct: 110 TTGGIILTASHNPGGLENDMGIKYNLSNGGPAPEPVTNKIWEISKKMTHYKIIKDFPELE 169

Query: 201 LEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQ--SNLKFAGGPWFVY 258
           LE   +      L+ + I      D+ K  +   K+     L+K+   N +       ++
Sbjct: 170 LETLGKNKKYGPLLVDVI------DITKAYVDFLKEIFDFELIKKFIHNQREKKHWKLLF 223

Query: 259 TPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPEERGALDMAMKV 318
             M+GV   + K       G+  D+    V +Q +P P+F  V  P+P    A  +  +V
Sbjct: 224 DGMNGVTGPYGKAIFVDEFGLPADE----VLQQWHPQPDFGGVH-PDPNLTYAKALVDRV 278

Query: 319 ADANGITVVLANDPDADRFSVAVKYHGEWNQLT--GNQIGILFAQAEMQSYFKEPKLDRK 376
            +   I    A+D D DR  +    +G        G+ + I+   A    YFK+  +   
Sbjct: 279 -NREKIEFGAASDGDGDRNMI----YGAGPAFVSPGDSVAIIAEYASEIPYFKKQGI--- 330

Query: 377 QLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGN--RARELELEGYYVPFAYEEAIG 434
              +  S  ++  + ++A+  G    +  TG+K+      A +L + G       EE+ G
Sbjct: 331 -YGLARSFPTASSIDRVAKAHGLNCYQVPTGWKFFCALFDANKLSICG-------EESFG 382

Query: 435 YMFSQVVHDKDGIAAAAVFLQMCYEWKK---VAKSSQEVLQ-ECYEKYG--YFVDYNGYY 488
              S  V +KDG+ A   +L +   + K       S +++Q E + KYG  +F  Y+  +
Sbjct: 383 -TGSNHVREKDGLWAIIAWLNVLAIYNKHNPEKDVSIKIIQDEFWNKYGRTFFTRYDYEH 441

Query: 489 ISSAPAVTKEVFDYFR 504
           +++  A   +V D  R
Sbjct: 442 VTTEAA--GKVIDQLR 455

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 157 TSCGVMITASHNPKMDNGYKVYYANGCQIIPPHDELIGR--HIDANLEPWTRAWD 209
           T  GVM+TASHNP +DNG KV    G  +I   + L  +  +I AN E + + +D
Sbjct: 58  TPVGVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAAN-ESFEKVYD 111

>Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 87/378 (23%), Positives = 150/378 (39%), Gaps = 50/378 (13%)

Query: 158 SCGVMITASHN---PKMDNGYKVYYANGCQIIPPHDELIGR---HIDANLEPWTRAWDSK 211
           + G+++TASHN   P+ D G K   +NG     P  E +      I   L  +    D  
Sbjct: 111 TGGIILTASHNPGGPENDMGIKYNLSNGG----PAPESVTNAIWDISKKLTNYKIVKDFP 166

Query: 212 ALIEEAIKSGKLH--------DVRKEMLQKYKDSIQTMLVKQ--SNLKFAGGPWFVYTPM 261
            L  + I   K +        D+ K  +   K      L+K+   N +       ++  M
Sbjct: 167 ELDLKTIGKNKKYGPLLIDVIDITKAYVDFLKKIFDFDLIKKFIDNQRSTKNWKLLFDSM 226

Query: 262 HGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPEERGALDMAMKVADA 321
           +GV   + K       G+  ++    V +  +P P+F  +  P+P    A  +  +V D 
Sbjct: 227 NGVTGPYGKAIFVDEFGLPAEE----VLQNWHPSPDFGGMH-PDPNLTYASSLVKRV-DR 280

Query: 322 NGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSYFKEPKLDRKQLAML 381
             I    A+D D DR    +  +G      G+ + I+   A    YF +  +      + 
Sbjct: 281 EKIEFGAASDGDGDR--NMIYGYGPSFVSPGDSVAIIAEYAAEIPYFAKQGI----YGLA 334

Query: 382 TSAVSSQLLRKMAEEEGFLAVETLTGFKWLGN--RARELELEGYYVPFAYEEAIGYMFSQ 439
            S  +S  + ++A+  G    E  TG+K+      A++L + G       EE+ G   S 
Sbjct: 335 RSFPTSAAIDRVAKAHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSN 386

Query: 440 VVHDKDGIAAAAVFLQMCYEWKK----VAKSSQEVLQECYEKYG--YFVDYNGYYISSAP 493
            V +KDG+ A   +L +   + K       S + +  E + KYG  +F  Y+   + S  
Sbjct: 387 HVREKDGVWAVMAWLNILAIYNKHHPENEASIKTIQNEFWAKYGRTFFTRYDFEKVESEK 446

Query: 494 AVTKEVFDYFRNEYTPAG 511
           A   ++ D  R   T +G
Sbjct: 447 A--NKIVDQLRAYVTKSG 462

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%)

Query: 137 DVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQIIPPHDELIGR 195
           D  + T  V  A+ ++       GVMITASHNP  DNG K+  ++G  ++   + L  R
Sbjct: 32  DSVMFTTGVIAALRSISCQCAPVGVMITASHNPPRDNGVKIVESDGSMLLQDWEPLATR 90

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 94/393 (23%), Positives = 158/393 (40%), Gaps = 67/393 (17%)

Query: 158 SCGVMITASHN---PKMDNGYKVYYANGCQIIPPHDELIGRHIDANLEPWTRAWDSKAL- 213
           + G+++TASHN   PK D G K   ANG     P  E +   I  N +  T     K L 
Sbjct: 111 TGGIILTASHNPGGPKNDMGIKYNLANGG----PAPESVTDKIWENSKKLTSYKIIKDLP 166

Query: 214 ------IEEAIKSGKLH----DVRKEMLQKYKDSIQTMLVKQSNLKFAGGPWFVYTPMHG 263
                 I E  K G +     DV K  ++  K+     L+K+          F++T    
Sbjct: 167 TLDTSKIGENQKYGPILIDVIDVTKAYVEFLKEIFDFELIKK----------FIHTQRKT 216

Query: 264 VGYEFFKEAVASVLGIEEDK---DYIVVPEQK-----YPDPEFPTVSFPNPEERGALDMA 315
             ++   + +  + G        D   +PE +     +P P+F  +  P+P    A  + 
Sbjct: 217 KNWKLLFDGLNGITGPYGKAIFVDEFELPENEVLQNYHPQPDFGGLH-PDPNLTYARSLV 275

Query: 316 MKVADANGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSYFKEPKLDR 375
            +V D   I    A+D D DR    +  +G      G+ + I+   A    YF +  +  
Sbjct: 276 DRV-DKEKIEFGAASDGDGDR--NMIYGYGPAFVSPGDSVAIIAEYASEIPYFAKQGI-- 330

Query: 376 KQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGN--RARELELEGYYVPFAYEEAI 433
               +  S  +S  + ++A+  G    E  TG+K+      A++L + G       EE+ 
Sbjct: 331 --YGLARSFPTSAAIDRVAKAHGLECYEVPTGWKFFCALFDAKKLSICG-------EESF 381

Query: 434 GYMFSQVVHDKDGIAAAAVFLQMCYEWKK----VAKSSQEVLQECYEKYG--YFVDYNGY 487
           G   S  V +KDG+ A   +L +   + K       S + +  + + KYG  +F  Y+  
Sbjct: 382 G-TGSNHVREKDGLWAIVAWLNVLAIFNKHHPEREASIKTIQDDFWLKYGRTFFTRYDYE 440

Query: 488 YISSAPAVTKEVFDYFRNEYTPAGK----PYPS 516
           +++S  A   +V D    E+T   K    P+P 
Sbjct: 441 HVTSEDA--NKVVDLL-TEFTSNSKTKNAPFPG 470

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 19/27 (70%)

Query: 160 GVMITASHNPKMDNGYKVYYANGCQII 186
           GVMITASHNP  DNG KV   +G  +I
Sbjct: 58  GVMITASHNPSGDNGVKVVEPDGSMLI 84

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 38.1 bits (87), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%)

Query: 157 TSCGVMITASHNPKMDNGYKVYYANGCQII 186
           ++ GVM+TASHNP  DNG K+   NG  ++
Sbjct: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 158 SCGVMITASHNPKMDNGYKVYYANGCQI 185
           + GVM+TASHNP +DNG K+   NG  +
Sbjct: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 37.7 bits (86), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%)

Query: 160 GVMITASHNPKMDNGYKVYYANGCQII 186
           GVMITASHNP  DNG K+   +G  +I
Sbjct: 60  GVMITASHNPPQDNGVKIVEPSGAMLI 86

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 135 DEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQII 186
           D D  + T  +   + +++      GVMITASHNP  DNG K+   +G  ++
Sbjct: 36  DLDTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 160 GVMITASHNPKMDNGYKVYYANGCQII 186
           GVMITASHNP  DNG K+   +G  ++
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLL 87

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 160 GVMITASHNPKMDNGYKVYYANGCQII 186
           GVMITASHNP  DNG K+   +G  ++
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLL 87

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 160 GVMITASHNPKMDNGYKVYYANGCQII 186
           GVMITASHNP  DNG K+   +G  ++
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLL 87

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%)

Query: 160 GVMITASHNPKMDNGYKVYYANG 182
           GVM+TASHNP +DNG KV   +G
Sbjct: 60  GVMVTASHNPPVDNGVKVVEPDG 82

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%)

Query: 137 DVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKV 177
           D  + T  +  AI ++       GVMITASHNP  DNG K+
Sbjct: 36  DTVMFTTGILAAIRSIYLKGQYVGVMITASHNPPQDNGVKI 76

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 8/40 (20%)

Query: 155 GPTSCGVMITASHNPKMDNGYKVYYANGCQIIPPHDELIG 194
           G    GVM+TASHNP  DNG K        ++ PH E++ 
Sbjct: 54  GGAYVGVMLTASHNPPEDNGVK--------LVDPHGEMLA 85

>TPHA0P00960 Chr16 complement(194351..196105) [1755 bp, 584 aa] {ON}
           Anc_2.195 YOR090C
          Length = 584

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%)

Query: 73  LTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIYY 126
            T  + ++ L RY+ +Q  +   V    D   +S +F +A    FLQLD DI Y
Sbjct: 203 FTSAKLTKDLVRYVATQLNELFSVTENTDTEQYSAQFDDAIEKGFLQLDSDIVY 256

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 17/25 (68%)

Query: 158 SCGVMITASHNPKMDNGYKVYYANG 182
           + GVMITASHNP  DNG K+    G
Sbjct: 57  TVGVMITASHNPPEDNGVKIVDPKG 81

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 15/18 (83%), Positives = 15/18 (83%)

Query: 160 GVMITASHNPKMDNGYKV 177
           GVMITASHNP  DNG KV
Sbjct: 55  GVMITASHNPPEDNGVKV 72

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 34.7 bits (78), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 16/20 (80%)

Query: 158 SCGVMITASHNPKMDNGYKV 177
           + GVMITASHNP  DNG K+
Sbjct: 57  TVGVMITASHNPPEDNGVKI 76

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 38/86 (44%), Gaps = 12/86 (13%)

Query: 158 SCGVMITASHNPKMDNGYKVYYANGCQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEA 217
           + GVMITASHN   DNG K        I+ P     G  +D + EP+     +KA    +
Sbjct: 57  AVGVMITASHNQPCDNGVK--------IVEPD----GSMLDQSWEPFATELANKASFCHS 104

Query: 218 IKSGKLHDVRKEMLQKYKDSIQTMLV 243
            +  KL+   K    K    I  +LV
Sbjct: 105 TQEFKLYLQEKFAQYKVDSGITPVLV 130

>Suva_12.236 Chr12 complement(377999..380287) [2289 bp, 762 aa] {ON}
           YJR143C (REAL)
          Length = 762

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 18/98 (18%)

Query: 104 FHSREFAEATIAAFLQLD------YDIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPT 157
           F S EF E    + L +D      +DI  L +     D DVF+H+ +  +     +G  +
Sbjct: 313 FMSAEFQETLYDSPLNIDSKVVNYFDIITLKH----QDTDVFLHSHLAHYPQRYEDGRIS 368

Query: 158 SCGVMITASHNPKMDNGYKVYYANGCQIIPPHDELIGR 195
           S G  +T   +P  +N ++V        +PP D  IG+
Sbjct: 369 SAGQQVTGYAHPDFNNQWEV--------LPPRDSDIGK 398

>Kwal_27.11611 s27 (875218..879903) [4686 bp, 1561 aa] {ON} YIR019C
           (MUC1) - cell surface flocculin with structure similar
           to serine/threonine-rich GPI-anchored cell wall proteins
           [contig 27] FULL
          Length = 1561

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 38/70 (54%), Gaps = 11/70 (15%)

Query: 333 DADRFSVA---VKYHGEWNQLTGNQIGILFAQAEMQSY-----FKEPKLDRKQLAMLTSA 384
           D D+ SV+   +K   +WN++ G Q+G +  +    S      F++P+  RKQ+  +   
Sbjct: 881 DMDKHSVSRKSIKSFEDWNRIPGAQVGQVAPRVSPLSVSRPRNFQDPEAGRKQIEKI--- 937

Query: 385 VSSQLLRKMA 394
           V+ Q+ RKM+
Sbjct: 938 VARQITRKMS 947

>Smik_16.110 Chr16 (204253..206730) [2478 bp, 825 aa] {ON} YGR196C
           (REAL)
          Length = 825

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 39/85 (45%), Gaps = 11/85 (12%)

Query: 479 GYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDT 538
           GY +D NG  +   PA  K       +E     + +PS  G + ++E ++D    Y ++T
Sbjct: 564 GYVIDSNGKLVDLTPASMKPRVVSTYSEMESTWEAFPSK-GEDDDLETIKDTKTIYDNNT 622

Query: 539 ----------ATNIPDLPVDHNSQM 553
                      +N+P LP+D N Q+
Sbjct: 623 IYNVPGLIGNQSNLPPLPMDANEQL 647

>Suva_7.490 Chr7 complement(846128..848647) [2520 bp, 839 aa] {ON}
           YGR196C (REAL)
          Length = 839

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 479 GYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGC-EFEVEYLRDLTVGYQSD 537
           GY +D NG  +   PA  K       +E       +PS  G  + ++E +RD    Y ++
Sbjct: 576 GYVIDSNGKLVDLTPASMKPRVVSTYSEMESTWDAFPSKSGNGDDDLETIRDTKTLYDNN 635

Query: 538 TATNIPDLPVDH 549
           T  N+P L  +H
Sbjct: 636 TIYNVPGLIGNH 647

>YLR438W Chr12 (1012501..1013775) [1275 bp, 424 aa] {ON}
           CAR2L-ornithine transaminase (OTAse), catalyzes the
           second step of arginine degradation, expression is
           dually-regulated by allophanate induction and a specific
           arginine induction process; not nitrogen catabolite
           repression sensitive
          Length = 424

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 8/66 (12%)

Query: 70  MNT-LTVIQASQGLAR---YIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIY 125
           MNT    ++ +  LAR   Y+K   P D  +++G +  FH R F     A  L  DY+  
Sbjct: 107 MNTGAEAVETALKLARRWGYMKKNIPQDKAIILGAEGNFHGRTFG----AISLSTDYEDS 162

Query: 126 YLNYVP 131
            L++ P
Sbjct: 163 KLHFGP 168

>Smik_12.534 Chr12 (941490..942764) [1275 bp, 424 aa] {ON} YLR438W
           (REAL)
          Length = 424

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 8/66 (12%)

Query: 70  MNT-LTVIQASQGLAR---YIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIY 125
           MNT    ++ +  LAR   Y+K   P D  +++G +  FH R F     A  L  DY+  
Sbjct: 107 MNTGAEAVETALKLARRWGYMKKNIPQDKAIILGAEGNFHGRTFG----AISLSTDYEDS 162

Query: 126 YLNYVP 131
            L++ P
Sbjct: 163 KLHFGP 168

>Suva_10.555 Chr10 (967287..968561) [1275 bp, 424 aa] {ON} YLR438W
           (REAL)
          Length = 424

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 5/66 (7%)

Query: 70  MNT-LTVIQASQGLAR---YIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIY 125
           MNT    ++ +  LAR   Y+K   P D  +++G +  FH R F   +++   + D  ++
Sbjct: 107 MNTGAEAVETALKLARRWGYMKKNIPQDKAIILGAEGNFHGRTFGAISLSTDFE-DSKLH 165

Query: 126 YLNYVP 131
           +  +VP
Sbjct: 166 FGPFVP 171

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 14/18 (77%)

Query: 160 GVMITASHNPKMDNGYKV 177
           G MITASHNP  DNG K+
Sbjct: 59  GAMITASHNPPQDNGVKL 76

>Skud_12.530 Chr12 (946371..947645) [1275 bp, 424 aa] {ON} YLR438W
           (REAL)
          Length = 424

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 8/66 (12%)

Query: 70  MNT-LTVIQASQGLAR---YIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIY 125
           MNT    ++ +  LAR   Y K   P D  +++G +  FH R F     A  L  DY+  
Sbjct: 107 MNTGAEAVETALKLARRWGYTKKSIPQDKAIILGAEGNFHGRTFG----AISLSTDYEDS 162

Query: 126 YLNYVP 131
            L++ P
Sbjct: 163 KLHFGP 168

>Skud_10.367 Chr10 complement(656888..659176) [2289 bp, 762 aa] {ON}
           YJR143C (REAL)
          Length = 762

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 40/94 (42%), Gaps = 10/94 (10%)

Query: 104 FHSREFAEATIAAFLQLDYDI--YYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGV 161
           F S EF E    + L +D     Y+        D   F+H+ +  +     +G  +S G 
Sbjct: 313 FMSAEFQETLRDSPLSIDSKTVNYFDTITIKHQDTGAFLHSHLARYPQRYEDGRISSAGQ 372

Query: 162 MITASHNPKMDNGYKVYYANGCQIIPPHDELIGR 195
            +T   +P  +N ++V        +PPHD  +G+
Sbjct: 373 QVTGYAHPDFNNQWEV--------LPPHDSGVGK 398

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,894,757
Number of extensions: 3016527
Number of successful extensions: 7275
Number of sequences better than 10.0: 75
Number of HSP's gapped: 7306
Number of HSP's successfully gapped: 75
Length of query: 624
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 508
Effective length of database: 40,180,143
Effective search space: 20411512644
Effective search space used: 20411512644
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)