Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ABL125W8.841ON33633616110.0
KAFR0B00210singletonON3263229861e-133
Ecym_46128.841ON3263249781e-132
SAKL0D01452g8.841ON3273249701e-131
KLLA0D01551g8.841ON3313309651e-130
KLTH0C03850g8.841ON3293269561e-129
Kwal_27.102558.841ON3293269541e-128
Suva_13.515na 1ON3253249521e-128
KNAG0B06970singletonON3323259501e-128
NCAS0D049408.841ON3273279441e-127
YPL273W (SAM4)8.841ON3253249411e-126
Smik_6.4848.841ON3253249381e-126
TDEL0E05690singletonON3283249171e-123
TPHA0G03760singletonON3313279171e-123
NDAI0F00250singletonON3293269151e-122
TDEL0E00240singletonON3283258991e-120
YLL062C (MHT1)na 2ON3243218961e-119
Suva_16.17singletonON3243258931e-119
Smik_12.1na 2ON3243258931e-119
Skud_12.4na 2ON3253248851e-118
KAFR0F04420singletonON3263268481e-112
KAFR0L00150singletonON3263228371e-111
Suva_64.1singletonON2732728211e-109
TBLA0B032608.841ON3263208111e-107
ZYRO0G14212g8.841ON3253257801e-102
TPHA0I002608.841ON3233197701e-100
Kpol_1068.78.841ON3233197326e-95
Suva_16.328.841ON2592487128e-93
Skud_101.1singletonON2002005973e-76
Skud_100.1singletonON2002005973e-76
SAKL0D09306gna 3ON3263345762e-71
AFR410WsingletonON3703275132e-61
Kwal_0.322na 3ON3323354884e-58
KLTH0H12716gna 3ON3483324712e-55
Skud_47.2singletonON96952855e-31
YMR321Cna 1ON105972175e-21
Kwal_0.321singletonOFF6726690.58
AAR056C6.326ON15546701.7
TBLA0E05020singletonON79566722.2
Smik_85.1singletonON22273684.3
KLLA0E24795g8.598ON602110694.8
KAFR0G008507.477ON15484665.4
AFR476WsingletonOFF16573657.9
Suva_8.436na 4ON54558678.1
CAGL0I02552g5.59ON1005174678.9
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABL125W
         (1011 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-synteni...   625   0.0  
KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON}       384   e-133
Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar ...   381   e-132
SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {O...   378   e-131
KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {O...   376   e-130
KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {O...   372   e-129
Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {O...   372   e-128
Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {O...   371   e-128
KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON}             370   e-128
NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON}               368   e-127
YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}  SAM4S-adenos...   367   e-126
Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W (...   365   e-126
TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {...   357   e-123
TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON}     357   e-123
NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON}       357   e-122
TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON}       350   e-120
YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}  MH...   349   e-119
Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON} ...   348   e-119
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...   348   e-119
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...   345   e-118
KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON}               331   e-112
KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON}      327   e-111
Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)        320   e-109
TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.84...   317   e-107
ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} simil...   305   e-102
TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841 ...   301   e-100
Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}...   286   6e-95
Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W (R...   278   8e-93
Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   234   3e-76
Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   234   3e-76
SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar...   226   2e-71
AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-synte...   202   2e-61
Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MH...   192   4e-58
KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} simi...   186   2e-55
Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)      114   5e-31
YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON} P...    88   5e-21
Kwal_0.321 s0 complement(152330..152533) [204 bp, 67 aa] {OFF} [...    31   0.58 
AAR056C Chr1 complement(442171..442638) [468 bp, 155 aa] {ON} Sy...    32   1.7  
TBLA0E05020 Chr5 complement(1285286..1287673) [2388 bp, 795 aa] ...    32   2.2  
Smik_85.1 Chr85 (111..776) [666 bp, 222 aa] {ON}   (NOVEL)             31   4.3  
KLLA0E24795g Chr5 (2195975..2197783) [1809 bp, 602 aa] {ON} simi...    31   4.8  
KAFR0G00850 Chr7 (207918..208382) [465 bp, 154 aa] {ON} Anc_7.47...    30   5.4  
AFR476W Chr6 (1295534..1296031) [498 bp, 165 aa] {OFF} NOHBY645;...    30   7.9  
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...    30   8.1  
CAGL0I02552g Chr9 (227257..230274) [3018 bp, 1005 aa] {ON} weakl...    30   8.9  

>ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-syntenic
            homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 336

 Score =  625 bits (1611), Expect = 0.0
 Identities = 310/336 (92%), Positives = 310/336 (92%)
 Frame = +1

Query: 1    MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
            MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA
Sbjct: 1    MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60

Query: 181  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
            IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK
Sbjct: 61   IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120

Query: 361  YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
            YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE
Sbjct: 121  YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180

Query: 541  LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXXXPLNPNFLGLGINCSS 720
            LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM           PLNPNFLGLGINCSS
Sbjct: 181  LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVAAIVAAAAPLNPNFLGLGINCSS 240

Query: 721  LSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPHVVDWGAVVASYIRSGARI 900
            LSRT               MTIYPNSGEIYDPVKKVWNASPHVVDWGAVVASYIRSGARI
Sbjct: 241  LSRTPAILAELHALLPALPMTIYPNSGEIYDPVKKVWNASPHVVDWGAVVASYIRSGARI 300

Query: 901  IGGCCRTIPNDIRQIADAVRTHARASSTDVPGHASP 1008
            IGGCCRTIPNDIRQIADAVRTHARASSTDVPGHASP
Sbjct: 301  IGGCCRTIPNDIRQIADAVRTHARASSTDVPGHASP 336

>KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  384 bits (986), Expect = e-133
 Identities = 185/322 (57%), Positives = 232/322 (72%), Gaps = 2/322 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           MPR PI++YLEE+P +VLV+DGGQGTELENRGI VA+PVWS  PF+  + W    S++R 
Sbjct: 1   MPRQPIKEYLEENPKKVLVLDGGQGTELENRGIHVANPVWSTIPFISESFWSNASSKDRE 60

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           IV  + +DF+ AGA+++MTITYQ SF SVT NT I TL++YN LL+RIV F R  +GD+K
Sbjct: 61  IVKGMFQDFLDAGADILMTITYQTSFKSVTENTPIKTLKEYNELLERIVSFSRSCIGDEK 120

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           YL+G IG WGAHVCAEF GDYG  P++IDY AYFKPQLDNF     LDLIGFET+PN HE
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGGHPENIDYYAYFKPQLDNFFQNKDLDLIGFETVPNFHE 180

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCS 717
           L+AILSWD+++++KPFY+ LSVH+ G LRDGT M             +NPNFL LGINC 
Sbjct: 181 LKAILSWDDTILSKPFYIGLSVHENGVLRDGTTMNEIGYYIKSLGSKINPNFLLLGINCV 240

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPHV-VDWGAVVASYIRSGA 894
           S S +               +  YPNSGEIYD VKK+W  + +  + W  VV  YI++GA
Sbjct: 241 SFSDSPDILESIHKELPDMPLIAYPNSGEIYDTVKKIWLPNHYSDITWNDVVNRYIKAGA 300

Query: 895 RIIGGCCRTIPNDIRQIADAVR 960
           RIIGGCCRT+P+DI Q++ AV+
Sbjct: 301 RIIGGCCRTMPDDIEQVSAAVK 322

>Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ABL125W
          Length = 326

 Score =  381 bits (978), Expect = e-132
 Identities = 183/324 (56%), Positives = 230/324 (70%), Gaps = 2/324 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M R  ++Q L+ +P ++L+MDGGQGTELENRGI VA+PVWS  PF++ + W    SR+R 
Sbjct: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINDSFWSDRSSRDRQ 60

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           IVA +  +++AAGA ++MTITYQ+SF SV+ NT I TL++YN LLDRIV F R  +G D 
Sbjct: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           YLVG IG+WGAH+CAEF+GDYG  P+ I YL YF+PQL+NFN Q  +D+IGFETIPN HE
Sbjct: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCS 717
           L AILSWDES+I KPFY+ +SVH+ GTLRDGT M             LNPNFL LGINC 
Sbjct: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPH-VVDWGAVVASYIRSGA 894
           S   +               +  YPNSGE+YD VKK+W  + + +V W  +V SY++SGA
Sbjct: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300

Query: 895 RIIGGCCRTIPNDIRQIADAVRTH 966
           RIIGGCCRT PNDIRQI  AV+ +
Sbjct: 301 RIIGGCCRTTPNDIRQIVTAVKKY 324

>SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 327

 Score =  378 bits (970), Expect = e-131
 Identities = 182/324 (56%), Positives = 222/324 (68%), Gaps = 2/324 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M R PI+Q+ +E P  +LVMDGGQGTELENRGI VA+PVWS  PF+  + W    SR+R 
Sbjct: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           IV  +  DF+  G+ ++MT TYQ SF SV+ NT I TL++YN LL+RIV F RE +G+DK
Sbjct: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           YL+G IGAWGAHVC EFTGDYG  P+ ID+L YF+PQL NFN+   +DLIGFETIPN HE
Sbjct: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCS 717
           L+AILSWDES+I+KPFY+ LSVH+ G LRDGT M             LNPN + LGINC 
Sbjct: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVW-NASPHVVDWGAVVASYIRSGA 894
           S + +               M +YPNSGEIYD VKK+W +     V W  VV SYI +GA
Sbjct: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300

Query: 895 RIIGGCCRTIPNDIRQIADAVRTH 966
           RIIGGCCRT P DI+ I  A+  +
Sbjct: 301 RIIGGCCRTSPQDIKDIVQAIEKY 324

>KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase,
          Length = 331

 Score =  376 bits (965), Expect = e-130
 Identities = 179/330 (54%), Positives = 233/330 (70%), Gaps = 2/330 (0%)
 Frame = +1

Query: 7   RIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERAIV 186
           R+PI++Y EE+P  VLVMDGGQGTELENRGI VA+PVWS  PF++ + W    S++R IV
Sbjct: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61

Query: 187 ASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKYL 366
             +  DF+ AGA+++MTITYQ SF SV+ NT I TL++YN LLDRIV F R  +G+D+YL
Sbjct: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121

Query: 367 VGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHELR 546
           +G IGAWGAHVC+EFTGDYGP PD IDY  YF+PQL NF     +D+IGFETIPN HELR
Sbjct: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181

Query: 547 AILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCSSL 723
           AILSWDE+V++KPFY+ LSVH+ G LRDGT M             LN N + +GINC + 
Sbjct: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241

Query: 724 SRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPH-VVDWGAVVASYIRSGARI 900
           +++               + +YPNSGEIYD VKK+W  + + +  W  VV SYI +GARI
Sbjct: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301

Query: 901 IGGCCRTIPNDIRQIADAVRTHARASSTDV 990
           IGGCCRT  +DI+++  AV  +A+ +++ +
Sbjct: 302 IGGCCRTTVDDIKEVRLAVNKYAKQTTSSL 331

>KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 329

 Score =  372 bits (956), Expect = e-129
 Identities = 186/326 (57%), Positives = 222/326 (68%), Gaps = 4/326 (1%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDS--RE 174
           MPR  +++YL  +P  VLV+DGGQGTELENRGI VA+PVWS  PF+  + W   DS  ++
Sbjct: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60

Query: 175 RAIVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGD 354
           R IV  +  DF+ AGA V+MT+TYQASF SV+ NT ITTL++Y+ALL RIV F R  +GD
Sbjct: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120

Query: 355 DKYLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNA 534
           DK+LVG IG WGAH C+EFTGDYG  P+ IDYL YFKPQLDNF     LDLIGFETIPN 
Sbjct: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180

Query: 535 HELRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGIN 711
           HELRAILSWD +++ KPFY+ LSVH+ G LRDGT M             +NPNF+ LGIN
Sbjct: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240

Query: 712 CSSLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWN-ASPHVVDWGAVVASYIRS 888
           C S + +               +  YPNSGE+YD VKK+WN    H + W  VV SYI S
Sbjct: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300

Query: 889 GARIIGGCCRTIPNDIRQIADAVRTH 966
           GARIIGGCCRT P DI  I  AV  +
Sbjct: 301 GARIIGGCCRTSPKDIAAINAAVNKY 326

>Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {ON}
           YPL273W (SAM4) - S-adenosylmethionine:homocysteine
           S-methyltransferase [contig 37] FULL
          Length = 329

 Score =  372 bits (954), Expect = e-128
 Identities = 186/326 (57%), Positives = 228/326 (69%), Gaps = 4/326 (1%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPD--SRE 174
           M R  I+++LE++P  VLV+DGGQGTELENRGI VA+PVWS  PF+  + W   D  S++
Sbjct: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60

Query: 175 RAIVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGD 354
           R IV  +  DF+ AGA V+MT+TYQASF SV+ NT I TL++Y++LL+RIV F RE +GD
Sbjct: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120

Query: 355 DKYLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNA 534
           DK+LVG IGAWGAH C+EFTGDYG  P+ ID+L YFKPQLDNF     +DLIGFETIPN 
Sbjct: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180

Query: 535 HELRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXXXP-LNPNFLGLGIN 711
           HELRAILSWDES+I KPFY+ LSVH+ G LRDGT M             LNPNF  LGIN
Sbjct: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240

Query: 712 CSSLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWN-ASPHVVDWGAVVASYIRS 888
           C S +++               +  YPNSGE+YD VKK+WN  +   + W  +V SYI S
Sbjct: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300

Query: 889 GARIIGGCCRTIPNDIRQIADAVRTH 966
           GARIIGGCCRT P DI  I +AV+ +
Sbjct: 301 GARIIGGCCRTSPKDIEAIHEAVQKY 326

>Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {ON}
           YPL273W (REAL)
          Length = 325

 Score =  371 bits (952), Expect = e-128
 Identities = 180/324 (55%), Positives = 224/324 (69%), Gaps = 2/324 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M RIP++Q L +DP +VLV+DGGQGTELENRGI VA+PVWS  PF+  + W    S  R 
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           IV  +  DF+AAGAE++MTITYQ SF SV+ NT I TL  Y+ LL RIV F R+ +G++K
Sbjct: 61  IVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEK 120

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           +L+G IG WGAHVC EFTG+YGP P+ ID+  YFKPQLDNFN    LDL+GFETIPN HE
Sbjct: 121 HLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHE 180

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCS 717
           L+AILSWDES+++KPFY+ LSVH+ G LRDGT M             +NPNFL LGINC 
Sbjct: 181 LKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCV 240

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNA-SPHVVDWGAVVASYIRSGA 894
           S +++               +  YPNSGE+YD  KK+W   S  +  W  VV  YI SGA
Sbjct: 241 SFNQSPDILESLHRALPNMPLLAYPNSGEVYDTEKKIWMPNSDKLNSWDTVVKQYIGSGA 300

Query: 895 RIIGGCCRTIPNDIRQIADAVRTH 966
           RIIGGCCRT P DI++++ AV+ +
Sbjct: 301 RIIGGCCRTTPKDIQEVSAAVKKY 324

>KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON} 
          Length = 332

 Score =  370 bits (950), Expect = e-128
 Identities = 183/325 (56%), Positives = 226/325 (69%), Gaps = 2/325 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           MPR PI++YL+ +P +VLV+DGGQGTELENRGI VA+PVWS  PF+D++ W    S++R 
Sbjct: 1   MPRQPIQEYLKVNPRKVLVLDGGQGTELENRGINVANPVWSTVPFIDSSFWSNKSSKDRV 60

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           IV  +   F+ AGAE++MT TYQ SF SV+ NT I  L++Y++LLDRIV F R+ +G DK
Sbjct: 61  IVKGMFDAFLDAGAEILMTTTYQTSFKSVSENTPIQNLEEYSSLLDRIVQFSRDCIGPDK 120

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           YL+G IG WGAHVCAEF GDYGP P  IDYL+YFKPQLDNF     LDLIGFETIPN HE
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGPNPAEIDYLSYFKPQLDNFFHNDNLDLIGFETIPNIHE 180

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCS 717
           LRAILSWDE++++KPFY+ LSVH+ G LRDG+ M             LN N   LGINC 
Sbjct: 181 LRAILSWDETILSKPFYIGLSVHNNGLLRDGSTMKDVADLIKSFGGKLNKNLTLLGINCV 240

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNAS-PHVVDWGAVVASYIRSGA 894
           S S +               +  YPNSGE+YD VKK+W  +   V+ W  VV  YI++GA
Sbjct: 241 SFSDSPDILESIHKELPDMPLIAYPNSGEVYDTVKKIWLPNRDMVMTWEEVVDRYIKAGA 300

Query: 895 RIIGGCCRTIPNDIRQIADAVRTHA 969
           RI+GGCCRT P DIR +A AV+  A
Sbjct: 301 RIVGGCCRTSPKDIRAVAAAVKKRA 325

>NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  368 bits (944), Expect = e-127
 Identities = 179/327 (54%), Positives = 225/327 (68%), Gaps = 3/327 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M R  I++YL+++P +VLV+DGGQGTELENRGI VA+PVWS  PF+  + W    S +R 
Sbjct: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           IV  +  DF+AAGAE++MT TYQ SF SV+ NT I TLQ+YN LL+RIV F R+ +G+ K
Sbjct: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           YL+G IG WGAHVCAEF GDYG  P++IDY  YFKPQLDNF A   LDLIGFET+PN +E
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCS 717
           L+AILSWDE +++KPFY+ LSVH+ G LRDGT M             +NPN L LGINC 
Sbjct: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVW--NASPHVVDWGAVVASYIRSG 891
           S + +               +  YPNSGE+YD VKK+W    S + + W  VV  YI +G
Sbjct: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300

Query: 892 ARIIGGCCRTIPNDIRQIADAVRTHAR 972
           ARIIGGCCRT P DI +I+ AV+  ++
Sbjct: 301 ARIIGGCCRTTPKDILEISKAVKKFSK 327

>YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}
           SAM4S-adenosylmethionine-homocysteine methyltransferase,
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 325

 Score =  367 bits (941), Expect = e-126
 Identities = 176/324 (54%), Positives = 223/324 (68%), Gaps = 2/324 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M R+P++Q+L ++P +VLV+DGGQGTELENRGI VA+PVWS  PF+  + W    S  R 
Sbjct: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           IV  +  DF+ AGAE++MT TYQ S+ SV+ NT I TL +YN LL+RIV F R  +G+DK
Sbjct: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           YL+G IG WGAH+C EFTGDYG  P++ID+  YFKPQL+NFN    LDLIGFETIPN HE
Sbjct: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCS 717
           L+AILSWDES++++PFY+ LSVH+ G LRDGT M             +NPNF  LGINC 
Sbjct: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVW-NASPHVVDWGAVVASYIRSGA 894
           S +++               +  YPNSGE+YD  KK+W   S  +  W  VV  YI SGA
Sbjct: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300

Query: 895 RIIGGCCRTIPNDIRQIADAVRTH 966
           RIIGGCCRT P DI++I+ AV+ +
Sbjct: 301 RIIGGCCRTSPKDIQEISAAVKKY 324

>Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W
           (REAL)
          Length = 325

 Score =  365 bits (938), Expect = e-126
 Identities = 180/324 (55%), Positives = 220/324 (67%), Gaps = 2/324 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M R+P++Q L ++P +VLV+DGGQGTELENRGI VA+PVWS  PF+  + W    S  R 
Sbjct: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSSSRK 60

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           IV  +  DF+ AGAE++MT TYQ S+ SV+ NT I TL +YN LL RIV F R  +G+DK
Sbjct: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           YL+G IG WGAH+C EFTGDYG  P+ ID+  YFKPQLDNFN    LDLIGFETIPN HE
Sbjct: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNIHE 180

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCS 717
           L+AILSWDESV++KPFY+ LSVH+ G LRDGT M             +NPNF  LGINC 
Sbjct: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVW-NASPHVVDWGAVVASYIRSGA 894
           S +++               +  YPNSGE+YD  KK+W   S  +  W AVV  YI SGA
Sbjct: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300

Query: 895 RIIGGCCRTIPNDIRQIADAVRTH 966
           RIIGGCCRT P DI++I  AV+ +
Sbjct: 301 RIIGGCCRTSPKDIQEIFTAVKKY 324

>TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {ON}
           
          Length = 328

 Score =  357 bits (917), Expect = e-123
 Identities = 177/324 (54%), Positives = 221/324 (68%), Gaps = 2/324 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M RIPI++ + E    +LV+DGGQGTELENRGI VA+PVWS  PFL  + W    S+ER 
Sbjct: 1   MVRIPIKKLVIESK-EILVLDGGQGTELENRGIEVANPVWSTIPFLSESFWTDSSSKERK 59

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           IV SV  DF  +G+ ++MTITYQ SFTS+  NT   TL +YN LLDRIV F R  +GD++
Sbjct: 60  IVESVFDDFKKSGSNILMTITYQTSFTSIVENTQFKTLAEYNTLLDRIVKFSRSCIGDER 119

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           YL+GS+G WGAHVC EFTG+YG  P+ IDY  YFKPQLDNFN Q  +DLIGFET+PN HE
Sbjct: 120 YLIGSVGPWGAHVCCEFTGNYGLHPESIDYYEYFKPQLDNFNGQDEIDLIGFETVPNFHE 179

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCS 717
           L+AILSWDE+ IAKPFY+ LSVH+ G LRDGT M             ++ NFL LG+NC 
Sbjct: 180 LKAILSWDETKIAKPFYIGLSVHNNGVLRDGTTMEEIGEYIKGLGEKISSNFLLLGVNCV 239

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPHVVD-WGAVVASYIRSGA 894
           S + +               +  YPNSGE+YD  KK+W  +   +D W +VV SYI +GA
Sbjct: 240 SFNDSSDMVKSIHKALPDMPLLAYPNSGEVYDTEKKIWFDNKDKLDSWDSVVRSYIDNGA 299

Query: 895 RIIGGCCRTIPNDIRQIADAVRTH 966
           RIIGGCCRT P DI +++ AV+ +
Sbjct: 300 RIIGGCCRTSPRDIAEVSAAVKKY 323

>TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON} 
          Length = 331

 Score =  357 bits (917), Expect = e-123
 Identities = 173/327 (52%), Positives = 219/327 (66%), Gaps = 3/327 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M R  I+ YL+E+P +VLVMDGGQGTELENRGI VA+PVWS  PF+  + W    S +R 
Sbjct: 1   MARQCIKNYLQENPNKVLVMDGGQGTELENRGIKVANPVWSTIPFISESFWSDQSSEDRK 60

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           IV  +  DF+ AGAE++MT TYQ SF SV+ NT I   + YN LL+RI+ F R+ +G+++
Sbjct: 61  IVKEMFNDFINAGAEILMTTTYQTSFKSVSENTPIKNTKHYNELLNRIIDFSRDCIGEER 120

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           YL+G IG+WGAH+CAEF GDYG  P++ID+  YFKPQLDNF     LDLIGFET+PN HE
Sbjct: 121 YLIGCIGSWGAHICAEFHGDYGEHPENIDFYEYFKPQLDNFFNNNKLDLIGFETVPNIHE 180

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCS 717
           L+AILSWDE +++KPFY+ LSVH+ G LRDGT M             LNPN   LGINC 
Sbjct: 181 LKAILSWDEKILSKPFYIGLSVHENGLLRDGTSMQEVANLIKGFGEKLNPNLTLLGINCV 240

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVW--NASPHVVDWGAVVASYIRSG 891
           S + +               +  YPNSGEIYD  KK+W  N +P +  W  +V  YI +G
Sbjct: 241 SYNHSNDIIKSIHKELPNLPLIAYPNSGEIYDTTKKIWLPNKNP-IFTWDDIVKGYIEAG 299

Query: 892 ARIIGGCCRTIPNDIRQIADAVRTHAR 972
            RIIGGCCRT PNDI+ +  AV+  A+
Sbjct: 300 VRIIGGCCRTTPNDIKAVTIAVKERAK 326

>NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  357 bits (915), Expect = e-122
 Identities = 171/326 (52%), Positives = 222/326 (68%), Gaps = 3/326 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M R PI+ YL E+P ++L++DGGQGTELENRGI VA+PVWS  PF++ + W    S++R 
Sbjct: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           IV  +  DF+ AGAE++MT TYQ SF SV+ NT I TL++Y+ LL RIV F R+ +G++K
Sbjct: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           YL+G IG WGAH+C+EFTG+YG  P+ IDY  YFKPQL NF     LD+IGFETIPN +E
Sbjct: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCS 717
           L+ ILSW   ++ KPFY+ LSVH+ G LRDGT M             LNPN + LGINC 
Sbjct: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVW--NASPHVVDWGAVVASYIRSG 891
           SL+ +               + +YPNSGE+YD VKK+W        + W  VV  Y+++G
Sbjct: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300

Query: 892 ARIIGGCCRTIPNDIRQIADAVRTHA 969
           ARIIGGCCRT PNDI+QI+DAV  ++
Sbjct: 301 ARIIGGCCRTTPNDIKQISDAVHKYS 326

>TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  350 bits (899), Expect = e-120
 Identities = 168/325 (51%), Positives = 225/325 (69%), Gaps = 2/325 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M R+P+R+ L  D  ++LV+DGGQGTE+ENRGI VA+PVWS+ PF+  + W    S+ER 
Sbjct: 1   MGRVPLRKVLT-DSRKILVLDGGQGTEMENRGIEVANPVWSSIPFVSESFWTDEWSKERK 59

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           IV  + +DF+++G++++MT+TYQASF ++  NT + TL +YN+LLDRIV F R  +GD++
Sbjct: 60  IVEEIYKDFMSSGSDMLMTVTYQASFKAIAENTELQTLSEYNSLLDRIVAFSRRCIGDER 119

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           YLVGS+G W A+  +E+TGDYG   D IDY  Y+KPQLDNFN Q  +D+IG ET+PN HE
Sbjct: 120 YLVGSVGPWAAYNASEYTGDYGLHADSIDYYGYYKPQLDNFNKQEEIDMIGIETVPNFHE 179

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCS 717
           L+AILSWDE  IAKPFYV+L+ HD+G LRDGT M             LNPNF+ LGINC 
Sbjct: 180 LKAILSWDEKKIAKPFYVSLTTHDSGVLRDGTAMEDIAQYIKCLGNNLNPNFMLLGINCV 239

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASP-HVVDWGAVVASYIRSGA 894
           S + +               +  YPNSGE+Y+P KK+W A+      W +VV S+I SGA
Sbjct: 240 SFNDSRDILELLHNALPEMLLLAYPNSGEVYEPKKKIWLANKCKTTSWDSVVKSFINSGA 299

Query: 895 RIIGGCCRTIPNDIRQIADAVRTHA 969
           RIIGGCCRT P DI  ++ AV+ ++
Sbjct: 300 RIIGGCCRTSPQDIADVSIAVKKYS 324

>YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}
           MHT1S-methylmethionine-homocysteine methyltransferase,
           functions along with Sam4p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 324

 Score =  349 bits (896), Expect = e-119
 Identities = 168/321 (52%), Positives = 220/321 (68%), Gaps = 2/321 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M RIPI++ + E P +VL++DGGQGTELENRGI + SPVWSAAPF   + W+ P S+ER 
Sbjct: 1   MKRIPIKELIVEHPGKVLILDGGQGTELENRGININSPVWSAAPFTSESFWE-PSSQERK 59

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           +V  + RDF+ AGA ++MTITYQA+F S++ NT I TL  Y   LD+IV F RE +G+++
Sbjct: 60  VVEEMYRDFMIAGANILMTITYQANFQSISENTSIKTLAAYKRFLDKIVSFTREFIGEER 119

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           YL+GSIG W AHV  E+TGDYGP P++IDY  +FKPQL+NFN    +DLIGFETIPN HE
Sbjct: 120 YLIGSIGPWAAHVSCEYTGDYGPHPENIDYYGFFKPQLENFNQNRDIDLIGFETIPNFHE 179

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCS 717
           L+AILSWDE +I+KPFY+ LSV D   LRDGT +             +N N L +G+NC 
Sbjct: 180 LKAILSWDEDIISKPFYIGLSVDDNSLLRDGTTLEEISVHIKGLGNKINKNLLLMGVNCV 239

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPHVV-DWGAVVASYIRSGA 894
           S +++               + +YPNSGEIY+P +K W+   + + DW   V  ++ +GA
Sbjct: 240 SFNQSALILKMLHEHLPGMPLLVYPNSGEIYNPKEKTWHRPTNKLDDWETTVKKFVDNGA 299

Query: 895 RIIGGCCRTIPNDIRQIADAV 957
           RIIGGCCRT P DI +IA AV
Sbjct: 300 RIIGGCCRTSPKDIAEIASAV 320

>Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON}
           YLL062C (REAL)
          Length = 324

 Score =  348 bits (893), Expect = e-119
 Identities = 173/325 (53%), Positives = 219/325 (67%), Gaps = 2/325 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M RI I + + E P +VLV+DGGQGTELENRGI + SPVWSAAPF+  + W+   S +R 
Sbjct: 1   MGRIAIEKLILEHPQKVLVLDGGQGTELENRGIDINSPVWSAAPFISDSFWESTSS-DRT 59

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           +V  + RDF+ AGA V+MT+TYQA+F+S++ NT I TL DYN  LDR+V F R  +G+D+
Sbjct: 60  LVEEMYRDFMDAGANVLMTVTYQANFSSISENTSIKTLSDYNRFLDRVVSFTRRVIGEDR 119

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           YL+GSIG W AHV +E+TGDYG  P+ IDYL +FK QLDNFN    +DLIGFET+PN HE
Sbjct: 120 YLIGSIGPWAAHVSSEYTGDYGSHPEDIDYLQHFKAQLDNFNKHTEIDLIGFETVPNFHE 179

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCS 717
           L+AILSWDE++I+KPFYV LSVHD G LRDGT M             +N +FL LG+NC 
Sbjct: 180 LKAILSWDENIISKPFYVGLSVHDNGLLRDGTTMEEIAAYVKSLGRKINRHFLLLGVNCI 239

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWN-ASPHVVDWGAVVASYIRSGA 894
           S +++               +  YPNSGE+YD   K W+ A      W  VV  +I +GA
Sbjct: 240 SFNQSTSILKSLHQALPDMPLLAYPNSGEVYDTKTKTWHQAKGKQNSWEVVVEEFIDNGA 299

Query: 895 RIIGGCCRTIPNDIRQIADAVRTHA 969
           RIIGGCCRT   DI +IA AV  H+
Sbjct: 300 RIIGGCCRTSAKDISEIASAVDKHS 324

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score =  348 bits (893), Expect = e-119
 Identities = 174/325 (53%), Positives = 221/325 (68%), Gaps = 2/325 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M RIPI + L E P +VLV+DGGQGTELENRGI + SPVWSAAPF+  + W++  SRER 
Sbjct: 1   MKRIPIEKLLIEHPQKVLVLDGGQGTELENRGININSPVWSAAPFVSDSFWEK-SSRERK 59

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           +V  + RDF+ AGA V+MTITYQA+F S++ NT I TL  Y   LD+IV F R  +G+++
Sbjct: 60  VVEEMYRDFMNAGANVLMTITYQANFKSISKNTTIKTLPAYRRFLDQIVCFSRRLIGEER 119

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           YL+GSIG W AHV +E+TG+YGP P+ IDY  +F+PQLD FN    +DLIGFETIPN HE
Sbjct: 120 YLIGSIGPWAAHVSSEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIGFETIPNFHE 179

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCS 717
           L+AILSW E +I++PFYV LSVHD G LRDGT +             +N NFL LG+NC 
Sbjct: 180 LKAILSWGEDIISRPFYVGLSVHDNGLLRDGTTLEEISAHIKGLGSKINKNFLLLGVNCI 239

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPHVVD-WGAVVASYIRSGA 894
           S +++               + +YPNSGEIYDP +K W      +D W   V  +I SGA
Sbjct: 240 SFNQSTLILKALHEVLPDFPLLVYPNSGEIYDPKEKTWYHPTDKLDSWDVTVRKFIDSGA 299

Query: 895 RIIGGCCRTIPNDIRQIADAVRTHA 969
           RIIGGCCRT P DI +IA +V T++
Sbjct: 300 RIIGGCCRTSPKDIAEIAASVDTYS 324

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score =  345 bits (885), Expect = e-118
 Identities = 172/324 (53%), Positives = 217/324 (66%), Gaps = 2/324 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M RI I + + E PTRVLV+DGGQGTELENRGI +  PVWSA PF   + W+Q  S +R 
Sbjct: 1   MKRISIEKLILEYPTRVLVLDGGQGTELENRGINIGGPVWSATPFTSDSFWEQ-SSHDRE 59

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           +V  + RDF+ AGA V+MTITYQA+F S++ NT I TL  YN  LDRIV F R  +G+++
Sbjct: 60  VVEEMYRDFMNAGANVLMTITYQANFKSISENTSIQTLSAYNGFLDRIVSFTRRFIGEER 119

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           YLVGSIG W AHV +E+TG+YGP P+ IDY  +FKPQLD+FN    +DLIGFET+PN HE
Sbjct: 120 YLVGSIGPWAAHVSSEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIGFETVPNFHE 179

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXXXP-LNPNFLGLGINCS 717
           L+AILSW E +I+KPFYV LSVHD G LRDGT M             +N + L +G+NC 
Sbjct: 180 LKAILSWGEDIISKPFYVGLSVHDNGLLRDGTTMEEVSAHIKGLGSRINKHLLLMGVNCI 239

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWN-ASPHVVDWGAVVASYIRSGA 894
           S +R+               + +YPNSGE+YD  +K W+  +     W   V ++I SGA
Sbjct: 240 SFNRSTLILRTLHESLPDTPLLVYPNSGEVYDVKEKTWHWPTDKPESWDITVKTFIDSGA 299

Query: 895 RIIGGCCRTIPNDIRQIADAVRTH 966
           RIIGGCCRT P DI +IA AVR +
Sbjct: 300 RIIGGCCRTSPKDIAEIATAVRRY 323

>KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  331 bits (848), Expect = e-112
 Identities = 159/326 (48%), Positives = 217/326 (66%), Gaps = 2/326 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M R+PI++YL  +  ++LV+DGGQGTELE RGI ++SPVWS  PF++ + W    S +R 
Sbjct: 1   MGRVPIKEYLLRNSDKILVLDGGQGTELEKRGINISSPVWSTLPFINESFWSNSSSNDRK 60

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           I+  +  DF++AGA+V+ T TYQ SF S++ NT I TL+DY+ LL+RI  F RE +GD K
Sbjct: 61  IIKDMYSDFISAGADVLSTTTYQTSFASISENTNIQTLKDYHELLNRITKFTRECIGDSK 120

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           YLVGSIG + A++ AE+TGD+G   D IDY  YFKPQLDNFN    +D+IGFETIPN HE
Sbjct: 121 YLVGSIGTYAAYLSAEYTGDFGDAADTIDYHGYFKPQLDNFNRSTEIDIIGFETIPNIHE 180

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCS 717
           LRAILS ++  ++KPFY++LS +    LRDGT +             LNPN + LGINC 
Sbjct: 181 LRAILSLNKKDLSKPFYISLSTNSKAQLRDGTSLKGVVDVIKSFESTLNPNLILLGINCI 240

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPH-VVDWGAVVASYIRSGA 894
            L+ +               + +YPNSGE YDPV+K+W A       W  +V  Y+ +GA
Sbjct: 241 GLNSSHLTMEYLNNHLPQFPLIVYPNSGEKYDPVRKIWLADEDPAFTWEYIVHRYLDAGA 300

Query: 895 RIIGGCCRTIPNDIRQIADAVRTHAR 972
           RI+GGCCRT P+DIR I++A++ + +
Sbjct: 301 RIVGGCCRTTPSDIRSISEAIKCYTK 326

>KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  327 bits (837), Expect = e-111
 Identities = 153/322 (47%), Positives = 217/322 (67%), Gaps = 2/322 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M R+P+++YL+E+P +VLV DGGQG ELE RG+ +   +WS  PFL  + W  P S +  
Sbjct: 1   MVRVPLKKYLKENPEKVLVSDGGQGLELERRGLDIKHRLWSTRPFLSKSFWSDPSSNDIR 60

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           IV  +  DFV AGAE++MT TYQ SF +V+ +T + +L++YN LLD+IVGF R  +GD++
Sbjct: 61  IVKGMFEDFVNAGAEILMTTTYQTSFKAVSESTELKSLREYNELLDKIVGFTRACIGDNR 120

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           YL+GSIG++GA V  E++GDYG  P+ +D+ +YFKPQLDNF     +D++GFETI N  E
Sbjct: 121 YLIGSIGSYGALVGGEYSGDYGDSPETVDFYSYFKPQLDNFLNNDEIDIVGFETIANFTE 180

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCS 717
           L+++LSWDE  ++KPFY++LSVHD G LRDGTPM             +NPN   LG+NC 
Sbjct: 181 LKSLLSWDEKKVSKPFYISLSVHDNGNLRDGTPMHLITDYIKSLATAINPNLTFLGVNCV 240

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPH-VVDWGAVVASYIRSGA 894
           + ++                ++++PNSGE+++  K +W A+P     W AVV  +I SG 
Sbjct: 241 NYNKATEIIDSIHNGLPTMPLSVFPNSGEVFNVEKGIWTANPEAAASWEAVVKRFISSGV 300

Query: 895 RIIGGCCRTIPNDIRQIADAVR 960
           RI+GGCCRT P+DI QI+ AV+
Sbjct: 301 RIVGGCCRTRPHDIEQISKAVK 322

>Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)
          Length = 273

 Score =  320 bits (821), Expect = e-109
 Identities = 154/272 (56%), Positives = 190/272 (69%), Gaps = 1/272 (0%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M RIP++Q L +DP +VLV+DGGQGTELENRGI VA+PVWS  PF+  + W    S  R 
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           IV  +  DF+AAGAE++MTITYQ SF SV+ NT I TL  Y+ LL RIV F R+ +G++K
Sbjct: 61  IVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEK 120

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           +L+G IG WGAHVC EFTG+YGP P+ ID+  YFKPQLDNFN    LDL+GFETIPN HE
Sbjct: 121 HLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHE 180

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCS 717
           L+AILSWDES+++KPFY+ LSVH+ G LRDGT M             +NPNFL LGINC 
Sbjct: 181 LKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCV 240

Query: 718 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYD 813
           S +++               +  YPNSGE+YD
Sbjct: 241 SFNQSPDILESLHRALPNMPLLAYPNSGEVYD 272

>TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.841
           YPL273W
          Length = 326

 Score =  317 bits (811), Expect = e-107
 Identities = 150/320 (46%), Positives = 209/320 (65%), Gaps = 3/320 (0%)
 Frame = +1

Query: 7   RIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPD-SRERAI 183
           R   ++Y    P  V+VMDGGQGTELE RG+ V+S VWS  PF+    WQ+ + S+  +I
Sbjct: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61

Query: 184 VASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKY 363
           V  + + FVAAG++ +M+ITYQ SF+++++NT I  L++YN LL++IV FCRE +G+ KY
Sbjct: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121

Query: 364 LVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHEL 543
           L+GSIG + +HV AE+TGDYG  P+++DYL YFKPQLDNFN    +DLI  ET+PN +EL
Sbjct: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNKYEL 181

Query: 544 RAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXXXPLNPNFLGLGINCSSL 723
           +A+LSWD + I KPFY++LSV D G LRDGT M             NPN + +G+NC S 
Sbjct: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVSY 241

Query: 724 SRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPHVV--DWGAVVASYIRSGAR 897
            +T               +  YPNSGE+YD + + W  +  +    W  +V   + +G R
Sbjct: 242 DKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGVR 301

Query: 898 IIGGCCRTIPNDIRQIADAV 957
           ++GGCCRT P+DI +IA AV
Sbjct: 302 MVGGCCRTTPDDIHKIAQAV 321

>ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 325

 Score =  305 bits (780), Expect = e-102
 Identities = 160/325 (49%), Positives = 207/325 (63%), Gaps = 11/325 (3%)
 Frame = +1

Query: 16  IRQYLEE---DPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQ--QPDSRERA 180
           +RQ L E   D  RVLVMDGGQGTELENRG+ ++ P+WS  PF     W   QP + +R 
Sbjct: 1   MRQQLLEVLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYT-DRD 59

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 360
           +V S+ + +V AGA+++ T+TYQ S+ ++  +T I T   Y+ LLDRIVGFCR  +GDD 
Sbjct: 60  VVNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDH 119

Query: 361 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           YLVGSIG + AHV AE+TGDYGP+P+ IDY  YF+PQ+ NFN    +D+IG ET+PN HE
Sbjct: 120 YLVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHE 179

Query: 541 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXXXPLNPNFLGLGINCSS 720
           L++ILSWDE+ I+KPFYV+L V D G LRDGTP+             N N L +GINC S
Sbjct: 180 LKSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPLFANRS--NKNLLLVGINCCS 237

Query: 721 LSRTXXXXXXXXXXXXXXXM--TIYPNSGEIYDPVKKVWN----ASPHVVDWGAVVASYI 882
           LS +               M   +YPNSGEIYD   + W+       H + W ++V  Y 
Sbjct: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYR 297

Query: 883 RSGARIIGGCCRTIPNDIRQIADAV 957
           + GAR IGGCCRT P DI++I   V
Sbjct: 298 KFGARAIGGCCRTTPLDIQEICKVV 322

>TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841
           YPL273W
          Length = 323

 Score =  301 bits (770), Expect = e-100
 Identities = 149/319 (46%), Positives = 200/319 (62%), Gaps = 2/319 (0%)
 Frame = +1

Query: 7   RIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQP-DSRERAI 183
           R+P R++++E P  +LV+DGGQGTELENRG+ + SP+WS   F++   W +  ++ ER  
Sbjct: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61

Query: 184 VASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKY 363
           +  +  DF  AGA V  T+TYQ SF+SV+ NT I +LQ+Y+ LL +I GFCR  + DD Y
Sbjct: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121

Query: 364 LVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHEL 543
           L+G IGA+ A + AE+ G+YG     IDYL YFKPQLD FN    +D+IGFETIPN HEL
Sbjct: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181

Query: 544 RAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXXXPLNPNFLGLGINCSSL 723
            AILSWDE +I +PF++ALS+ D   LRDGT               N N + +G NC S 
Sbjct: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGRNKNLVYVGGNCISY 241

Query: 724 SRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPHV-VDWGAVVASYIRSGARI 900
           + +               +  YPNSGEIYD   K W+++  + + W  VV  Y  +G +I
Sbjct: 242 AYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVKI 301

Query: 901 IGGCCRTIPNDIRQIADAV 957
           IGGCCRT P+DI+QI  AV
Sbjct: 302 IGGCCRTTPDDIKQIKKAV 320

>Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}
           complement(11996..12967) [972 nt, 324 aa]
          Length = 323

 Score =  286 bits (732), Expect = 6e-95
 Identities = 140/319 (43%), Positives = 194/319 (60%), Gaps = 2/319 (0%)
 Frame = +1

Query: 7   RIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQ-QPDSRERAI 183
           R+PI + +   P  VLV DGG GT LE+RGI V+SP+WS  PFL    W  +  + +R I
Sbjct: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61

Query: 184 VASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKY 363
           +  + RD++ +G+ ++ TITYQ SF  ++T+T + T++ Y  L+  I  FCR  +G+D Y
Sbjct: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121

Query: 364 LVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHEL 543
           L+GSIG +GA + AE+TG+YG  P +I+YL YFKPQL+ FN    +D+IGFET+PN +EL
Sbjct: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181

Query: 544 RAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXXXPLNPNFLGLGINCSSL 723
            AILSWD+SVI+KP+YV+LS+ D G LRDGT               N N +  G NC S 
Sbjct: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN-NDNLILTGANCISF 240

Query: 724 SRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPHV-VDWGAVVASYIRSGARI 900
                             + +YPNSGEIYDP+ K W       + W  ++     S  RI
Sbjct: 241 KYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVRI 300

Query: 901 IGGCCRTIPNDIRQIADAV 957
           +GGCCRT P+DI +I D +
Sbjct: 301 VGGCCRTTPDDINKIKDMI 319

>Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W
           (REAL)
          Length = 259

 Score =  278 bits (712), Expect = 8e-93
 Identities = 136/248 (54%), Positives = 169/248 (68%), Gaps = 2/248 (0%)
 Frame = +1

Query: 229 IMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKYLVGSIGAWGAHVCAE 408
           +MTITYQ SF SV+ NT I TL  Y+ LL RIV F R+ +G++K+L+G IG WGAHVC E
Sbjct: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70

Query: 409 FTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHELRAILSWDESVIAKPF 588
           FTG+YGP P+ ID+  YFKPQLDNFN    LDL+GFETIPN HEL+AILSWDES+++KPF
Sbjct: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130

Query: 589 YVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCSSLSRTXXXXXXXXXXX 765
           Y+ LSVH+ G LRDGT M             +NPNFL LGINC S +++           
Sbjct: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190

Query: 766 XXXXMTIYPNSGEIYDPVKKVW-NASPHVVDWGAVVASYIRSGARIIGGCCRTIPNDIRQ 942
               +  YPNSGE+YD  KK+W   S  +  W  VV  YI SGARIIGGCCRT P DI++
Sbjct: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250

Query: 943 IADAVRTH 966
           ++ AV+ +
Sbjct: 251 VSAAVKKY 258

>Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  234 bits (597), Expect = 3e-76
 Identities = 113/200 (56%), Positives = 136/200 (68%), Gaps = 1/200 (0%)
 Frame = +1

Query: 232 MTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKYLVGSIGAWGAHVCAEF 411
           MT TYQ S+ SV+ NT I TL +YN LL RIV F R+ +G++KYL+G IG WGAH+C EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRDCIGENKYLIGCIGPWGAHICREF 60

Query: 412 TGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHELRAILSWDESVIAKPFY 591
           TGDYGP P+ ID+  YFKPQLDNFN    LDLIGFETIPN HELRAILSWDES+++KPFY
Sbjct: 61  TGDYGPDPESIDFYEYFKPQLDNFNKNDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 592 VALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCSSLSRTXXXXXXXXXXXX 768
           + LSVH+ G LRDGT M             +NPNF  LGINC S +++            
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQALP 180

Query: 769 XXXMTIYPNSGEIYDPVKKV 828
              +  YPNSGE+YD  KK+
Sbjct: 181 DMALLAYPNSGEVYDTEKKI 200

>Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  234 bits (597), Expect = 3e-76
 Identities = 114/200 (57%), Positives = 134/200 (67%), Gaps = 1/200 (0%)
 Frame = +1

Query: 232 MTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKYLVGSIGAWGAHVCAEF 411
           MT TYQ S+ SV+ NT I TL +YN LL RIV F R  +G+DKYL+G IG WGAH+C EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRVCIGEDKYLIGCIGPWGAHICCEF 60

Query: 412 TGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHELRAILSWDESVIAKPFY 591
           TGDYGP P  ID+  YFKPQLDNFN    LDLIGFETIPN HELRAILSWDES+++KPFY
Sbjct: 61  TGDYGPDPQSIDFYKYFKPQLDNFNKSDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 592 VALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGINCSSLSRTXXXXXXXXXXXX 768
           + LSVH+ G LRDGT M             +NPNF  LGINC S +++            
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQVLP 180

Query: 769 XXXMTIYPNSGEIYDPVKKV 828
              +  YPNSGE+YD  KK+
Sbjct: 181 NMALLAYPNSGEVYDTEKKI 200

>SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar to
           uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 326

 Score =  226 bits (576), Expect = 2e-71
 Identities = 132/334 (39%), Positives = 187/334 (55%), Gaps = 15/334 (4%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M R PI +YLE     +LV+DGGQGTE+E RGI V  P+WS  PF+     + P      
Sbjct: 1   MRRQPIAEYLESS---ILVLDGGQGTEMERRGIDVIHPLWSTLPFIK----KNPTHLNH- 52

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVT--TNTGITTLQDYNALLDRIVGFCRET-VG 351
            +  +  DF  +GA  + TITYQASF ++   ++  + T Q Y   L+ I+GF R+  + 
Sbjct: 53  -IKGMYHDFSTSGARALSTITYQASFATLKQYSDGQVVTEQQYQQFLNDIIGFTRDQCIS 111

Query: 352 DDKYLVGSIGAWGAHVC--AEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETI 525
           D +YL+G +G + A++C  AE++GDYG   + ID+  YFKPQLD F+    +D++GFETI
Sbjct: 112 DSQYLIGCVGPYAAYLCNGAEYSGDYGS--EKIDFKQYFKPQLDVFSRDDRIDMVGFETI 169

Query: 526 PNAHELRAILSWDESVI--AKPFYVALSVHDAGTLRDGTPMXXXXXXXXXXXPLN-PNFL 696
           PN  EL+ +LS D + +   KPFY+++S    G LRDGTP+               PN L
Sbjct: 170 PNIEELKTLLSKDFTSMLGTKPFYISISTDSNGNLRDGTPVAKICETIKDADKSTPPNLL 229

Query: 697 GLGINC----SSLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPHV---VD 855
            LGINC     S +                   +YPNSGEIYD     W+ +  +   + 
Sbjct: 230 FLGINCVDYHHSYNILSRLNGGLGDDCSLLFKAVYPNSGEIYDGNTHTWHTNSEIAPELT 289

Query: 856 WGAVVASYIRSGARIIGGCCRTIPNDIRQIADAV 957
           W  +V+ +     ++IGGCCRT P+DI+QIADAV
Sbjct: 290 WNYLVSKFAEQKCQLIGGCCRTTPDDIKQIADAV 323

>AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 370

 Score =  202 bits (513), Expect = 2e-61
 Identities = 125/327 (38%), Positives = 177/327 (54%), Gaps = 13/327 (3%)
 Frame = +1

Query: 16  IRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERAIVASV 195
           I ++LE +   VLVMDGG G ELE RG+ V SP+WS APFL      + D      +  +
Sbjct: 51  ITEFLERN---VLVMDGGMGVELERRGMDVKSPLWSTAPFL------RGDRAALDTIRGL 101

Query: 196 LRDFVAAGAEVIMTITYQASFTSVTTNTG-ITTLQDYNALLDRIVGFC-RETVGDDK-YL 366
            R+F AAG+  I T+TYQASF S+   +G +++  DY   L+++V F  RE V   + Y+
Sbjct: 102 YREFRAAGSRGISTLTYQASFHSMVKYSGSVSSRADYEKFLEQVVDFTYRECVDPARDYI 161

Query: 367 VGSIGAWGAHVC--AEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 540
           +GS+G + A +C  AE+TGDYG   + I++  YF+PQ+  F   P +D I FET+PN  E
Sbjct: 162 IGSVGPYAAFLCNGAEYTGDYG--FETINFFNYFEPQVSKFATDPRIDAIAFETVPNVVE 219

Query: 541 LRAILSWDESVIA--KPFYVALSVHDAGTLRDGTPM-XXXXXXXXXXXPLNPNFLGLGIN 711
           L A+L  +   +   KPFY+++S  D   LRDGTP+             L PN L  G+N
Sbjct: 220 LMAMLQPEFHALLKNKPFYISISAKDEHVLRDGTPLAVVGQLIRERMDDLPPNLLCFGLN 279

Query: 712 CSSLSRTXXXXXXXXXXXXXXXM---TIYPNSGEIYDPVKKVWNASPHV--VDWGAVVAS 876
           C  L+R+               +    IYPN   ++D     W  S     + W   V  
Sbjct: 280 CVDLTRSAAMLAELNMQLQDCPIKFQAIYPNGTSVFDESLSAWRPSKDAESLTWAEAVKL 339

Query: 877 YIRSGARIIGGCCRTIPNDIRQIADAV 957
           Y+    R+IGGCC T P D+RQIA+A+
Sbjct: 340 YLNQDCRMIGGCCGTTPQDMRQIAEAL 366

>Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MHT1)
           - S-methylmethionine:homocysteine S-methyltransferase
           [contig 86] FULL
          Length = 332

 Score =  192 bits (488), Expect = 4e-58
 Identities = 113/335 (33%), Positives = 178/335 (53%), Gaps = 18/335 (5%)
 Frame = +1

Query: 7   RIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERAIV 186
           R+ + +YL+ +   +L++DGGQGTELE RGI +A P+WS  P++        D +   I+
Sbjct: 2   RLQLEEYLKHE---ILLLDGGQGTELEKRGINIAHPLWSTLPYVTK------DKKHLKII 52

Query: 187 ASVLRDFVAAGAEVIMTITYQASFTSVTTNTG--ITTLQDYNALLDRIVGFCR-ETVGDD 357
             +   F +AG   +MTITYQASF S+  ++   I   ++Y   LD ++ +   + +  +
Sbjct: 53  KEMYSAFESAGCNALMTITYQASFLSMKNHSDGLINNEKEYTRFLDYVIDYTENQCISPN 112

Query: 358 KYLVGSIGAWGAHVC--AEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPN 531
            YLVGS+G + A++   AE++G Y    D+ID++ +F+PQ+ +F     +DLIG ETIPN
Sbjct: 113 SYLVGSVGPYAAYLSNGAEYSGHY--IEDNIDFIEFFRPQVQHFAVSSRIDLIGIETIPN 170

Query: 532 AHELRAILSWDESVIA--KPFYVALSVHDAGTLRDGTP-MXXXXXXXXXXXPLNPNFLGL 702
             E +A+L  + S +   KP+Y++++  + G LRDGT               L PN +  
Sbjct: 171 FEEFKALLRPEFSRLCALKPYYISITTDNEGNLRDGTARQDICETIKRSAQDLPPNLVFF 230

Query: 703 GINCSSLSRTXXXXXXXXXXXXXXXM-------TIYPNSGEIYDPVKKVWNASPHV---V 852
           GINC S +                 +        +YPNSGE+Y      W  +P +    
Sbjct: 231 GINCVSFAHCADILKLLNDSLDDIGVENRLRFRAVYPNSGEVYHGDTHSWGPNPEIGPAD 290

Query: 853 DWGAVVASYIRSGARIIGGCCRTIPNDIRQIADAV 957
            W  + +  ++ G  +IGGCCRT P D+RQIA  V
Sbjct: 291 TWENLASKVVQQGCLMIGGCCRTSPADLRQIASVV 325

>KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 348

 Score =  186 bits (471), Expect = 2e-55
 Identities = 114/332 (34%), Positives = 177/332 (53%), Gaps = 18/332 (5%)
 Frame = +1

Query: 7   RIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERAIV 186
           R P++++ + +   +L++DGGQGTELE +G+ ++ P+WS  PF+        +      +
Sbjct: 2   RKPLKEFFKNN---ILLLDGGQGTELEKKGVSISHPLWSTLPFIIK------NKTHLEAI 52

Query: 187 ASVLRDFVAAGAEVIMTITYQASFTSVTTNTG--ITTLQDYNALLDRIVGFC-RETVGDD 357
             + RDF  AG+  +MTITYQASF+S+   +   + + +DY A LD ++GF  RE +  D
Sbjct: 53  KEMYRDFAEAGSNALMTITYQASFSSMKKYSEGLVNSEEDYAAFLDYVIGFTDRECITPD 112

Query: 358 KYLVGSIGAWGAHVC--AEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPN 531
           KYLVGS+G +   +   AE++G YG     ID++ Y+ PQ+ +F   P +DLIG ETIPN
Sbjct: 113 KYLVGSVGPYAGLLSNGAEYSGYYGE--GKIDFIDYYSPQVKHFALSPRIDLIGIETIPN 170

Query: 532 AHELRAILSWDESVI--AKPFYVALSVHDAGTLRDGTPMXXXXXXXXXXXPLNP-NFLGL 702
             E +A+LS + S +  +KP+Y++++  + G LRDGT +            L P NF+  
Sbjct: 171 IDEFKALLSPEFSRLSFSKPYYISVTTDNNGCLRDGTSLNEICRAIKQSASLLPDNFVFF 230

Query: 703 GINC-------SSLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPHV---V 852
            INC         L                     YPNSGEIY      W+++P+     
Sbjct: 231 AINCVEFLHCVEILQSLNDCLEMQGVDRRFRFRGAYPNSGEIYHGGTHSWSSNPYAGPED 290

Query: 853 DWGAVVASYIRSGARIIGGCCRTIPNDIRQIA 948
            W  +    +     ++GGCCRT   +IRQ+A
Sbjct: 291 TWENLTLGLLSQECLMLGGCCRTGSEEIRQMA 322

>Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)
          Length = 96

 Score =  114 bits (285), Expect = 5e-31
 Identities = 53/95 (55%), Positives = 69/95 (72%)
 Frame = +1

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 180
           M R+P++Q LE++P +VLV+DGGQGTELENRGI VA+PVWS  PF+  + W    S  R 
Sbjct: 1   MVRLPLKQLLEDNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWSDESSANRK 60

Query: 181 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGI 285
           IV  +  DF+ AGAE++MT TYQ S+ SV+ NT I
Sbjct: 61  IVKGMFNDFLNAGAEILMTTTYQTSYKSVSENTPI 95

>YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON}
           Putative protein of unknown function; proposed to be a
           palmitoylated membrane protein
          Length = 105

 Score = 88.2 bits (217), Expect = 5e-21
 Identities = 44/97 (45%), Positives = 57/97 (58%), Gaps = 1/97 (1%)
 Frame = +1

Query: 679 LNPNFLGLGINCSSLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNA-SPHVVD 855
           +NPN   LGINC S +++               +  YPNSGE+YD  KK+W   S  +  
Sbjct: 8   INPNLSFLGINCVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNS 67

Query: 856 WGAVVASYIRSGARIIGGCCRTIPNDIRQIADAVRTH 966
           W  VV  YI SGARIIGGCCRT P DI++I+ AV+ +
Sbjct: 68  WDTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKKY 104

>Kwal_0.321 s0 complement(152330..152533) [204 bp, 67 aa] {OFF}
          [contig 86] FULL
          Length = 67

 Score = 31.2 bits (69), Expect = 0.58
 Identities = 13/26 (50%), Positives = 16/26 (61%)
 Frame = -2

Query: 98 IPLFSNSVPWPPSMTRTRVGSSSRYC 21
          +PLFS+SVPWPPS  +      S  C
Sbjct: 3  MPLFSSSVPWPPSSNKISCFRYSSSC 28

>AAR056C Chr1 complement(442171..442638) [468 bp, 155 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNR024W
          Length = 155

 Score = 31.6 bits (70), Expect = 1.7
 Identities = 18/46 (39%), Positives = 21/46 (45%)
 Frame = +1

Query: 133 FLDAAAWQQPDSRERAIVASVLRDFVAAGAEVIMTITYQASFTSVT 270
           F+D++ W  P  RER       R  VA G  VI TI  Q    S T
Sbjct: 42  FIDSSEWSIPGRRERLRQIPTPRPVVAVGHTVIRTIDAQGGQASAT 87

>TBLA0E05020 Chr5 complement(1285286..1287673) [2388 bp, 795 aa]
           {ON} 
          Length = 795

 Score = 32.3 bits (72), Expect = 2.2
 Identities = 23/66 (34%), Positives = 33/66 (50%)
 Frame = -2

Query: 227 TSAPAATKSRKTEATIARSRESGCCQAAASRNGAADHTGLATTIPLFSNSVPWPPSMTRT 48
           T  P  T +  TE TI ++    C  +  S NG  D T + TT+P  S ++P P + T T
Sbjct: 440 TQPPVYTTTIVTEGTITKTVIVSCSTSTGS-NG--DVTTVTTTLPCPSGTIPTPTTTTVT 496

Query: 47  RVGSSS 30
             G +S
Sbjct: 497 VNGVTS 502

>Smik_85.1 Chr85 (111..776) [666 bp, 222 aa] {ON}   (NOVEL)
          Length = 222

 Score = 30.8 bits (68), Expect = 4.3
 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 6/73 (8%)
 Frame = -1

Query: 381 ADGADEVLVVANGLAAEADDSVEEGVVILQGGDTSVSGDGGEGRLVSDGHDDLG------ 220
           +DG  + +   NG  +++D   + G      GD+   GDG  G   SDGHDD G      
Sbjct: 101 SDGDSDRVSDGNGGGSDSDGDGDGGSDGDGDGDSDGDGDGDGG---SDGHDDDGDGDGDD 157

Query: 219 TCGDEVAQDRGND 181
             GD+   D G+D
Sbjct: 158 DDGDDGDGDDGDD 170

>KLLA0E24795g Chr5 (2195975..2197783) [1809 bp, 602 aa] {ON} similar
           to uniprot|Q02981 Saccharomyces cerevisiae YPL109C
           Hypothetical ORF
          Length = 602

 Score = 31.2 bits (69), Expect = 4.8
 Identities = 28/110 (25%), Positives = 51/110 (46%), Gaps = 1/110 (0%)
 Frame = +1

Query: 16  IRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSA-APFLDAAAWQQPDSRERAIVAS 192
           +++  EE   +V ++D G  TEL +R  V    +++A A F    A +    R R    +
Sbjct: 453 MKRVFEEYEPQVCLIDAGLVTELNDRNRVNFIALFNALAKFDGYRAGELMIERSRTPETA 512

Query: 193 VLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRE 342
           + +D  A   E ++    + +FT  T + G         LLD+++G  R+
Sbjct: 513 IDKDLFALKVEKLVNKVKKQTFTLGTVSIG--------ELLDKMLGMVRQ 554

>KAFR0G00850 Chr7 (207918..208382) [465 bp, 154 aa] {ON} Anc_7.477
           YJR104C
          Length = 154

 Score = 30.0 bits (66), Expect = 5.4
 Identities = 28/84 (33%), Positives = 38/84 (45%), Gaps = 7/84 (8%)
 Frame = -1

Query: 393 GAPCAD-----GADEVLVVANGLAAEADDSVEEGVVILQGGDTSVSGDGGEGRLVSDGHD 229
           GAP A+         V   ANG+A     S+ + ++ L G  + V    G   ++  G D
Sbjct: 71  GAPTAETRHVGDMGNVKTDANGVAK---GSLTDSLIKLYGPTSVV----GRSVVIHSGQD 123

Query: 228 DLGTCGDEVAQDRGN--DRALAGV 163
           DLG  GDE +   GN   RA  GV
Sbjct: 124 DLGKGGDEESLKTGNAGGRAACGV 147

>AFR476W Chr6 (1295534..1296031) [498 bp, 165 aa] {OFF} NOHBY645; No
           homolog in Saccharomyces cerevisiae
          Length = 165

 Score = 29.6 bits (65), Expect = 7.9
 Identities = 20/73 (27%), Positives = 31/73 (42%), Gaps = 3/73 (4%)
 Frame = +1

Query: 169 RERAIVASVLRDFVAAGAEVIMTITYQASF---TSVTTNTGITTLQDYNALLDRIVGFCR 339
           RE   V   L D VAA  EV++T             T      T ++   + + + G C 
Sbjct: 87  REHEEVVKTLEDMVAACEEVLVTCEMVPGMYVDMVATCELAGGTCEEMTGMCELVTGTCE 146

Query: 340 ETVGDDKYLVGSI 378
           ETVG  K ++ ++
Sbjct: 147 ETVGTCKTVLETL 159

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
           (REAL)
          Length = 545

 Score = 30.4 bits (67), Expect = 8.1
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 6/58 (10%)
 Frame = +1

Query: 802 EIYDP------VKKVWNASPHVVDWGAVVASYIRSGARIIGGCCRTIPNDIRQIADAV 957
           +I DP      V+K WN      ++GAV+A  I  G+  +G        DI Q A  +
Sbjct: 177 DIVDPEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPREMDIIQYAKGI 234

>CAGL0I02552g Chr9 (227257..230274) [3018 bp, 1005 aa] {ON} weakly
           similar to uniprot|P38699 Saccharomyces cerevisiae
           YHR178w STB5 SIN3 binding protein
          Length = 1005

 Score = 30.4 bits (67), Expect = 8.9
 Identities = 39/174 (22%), Positives = 70/174 (40%), Gaps = 11/174 (6%)
 Frame = +1

Query: 142 AAAWQQPDSRERAIVASVLRDFVAAGAE-------VIMTITYQASFTSVTTNTGITTLQD 300
           + +W   D   + I  S+L  FV+A  E       ++  +T+     ++ +   I  L  
Sbjct: 386 STSWVNEDGSPKPIKKSLLEKFVSAYFEHNHRLFPMVDKVTFLKKLATINSFESIEMLAV 445

Query: 301 YNALLDRIVGFCRETVGDDKYLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAY--FKPQL 474
            N  L +   F       + Y++ +IG        + T D G   +H+ YLA   F+  L
Sbjct: 446 NNPELPKTFIF-------EIYMIMAIGCTTLQRAGKLTTDEGHLYEHLAYLAMRNFRDIL 498

Query: 475 --DNFNAQPALDLIGFETIPNAHELRAILSWDESVIAKPFYVALSVHDAGTLRD 630
              +      L L+G   I +  E + + SW  S IA    + L ++   T ++
Sbjct: 499 HQQDITTLRCLILLG---IYSFFEPKGVSSWTISGIAMRLAIELGLNRPLTAKE 549

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,156,559
Number of extensions: 1209601
Number of successful extensions: 4137
Number of sequences better than 10.0: 45
Number of HSP's gapped: 4030
Number of HSP's successfully gapped: 45
Length of query: 337
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 227
Effective length of database: 40,868,139
Effective search space: 9277067553
Effective search space used: 9277067553
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 34 (17.7 bits)