Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ABL125W8.841ON33633616210.0
KAFR0B00210singletonON32632610151e-138
SAKL0D01452g8.841ON32732510151e-138
Ecym_46128.841ON32632410101e-137
KLLA0D01551g8.841ON33133010021e-136
Kwal_27.102558.841ON3293269971e-135
NCAS0D049408.841ON3273279871e-133
Suva_13.515na 1ON3253259781e-132
KLTH0C03850g8.841ON3293269761e-132
YPL273W (SAM4)8.841ON3253259731e-131
TPHA0G03760singletonON3313289571e-129
TDEL0E05690singletonON3283279551e-128
KNAG0B06970singletonON3323149501e-128
NDAI0F00250singletonON3293309471e-127
Smik_6.4848.841ON3253259471e-127
TDEL0E00240singletonON3283259321e-125
Suva_16.17singletonON3243259301e-125
YLL062C (MHT1)na 2ON3243259251e-124
Smik_12.1na 2ON3243259231e-124
Skud_12.4na 2ON3253269101e-122
KAFR0F04420singletonON3263268831e-118
KAFR0L00150singletonON3263228691e-115
Suva_64.1singletonON2732728441e-112
TPHA0I002608.841ON3233198091e-106
TBLA0B032608.841ON3263208081e-106
ZYRO0G14212g8.841ON3253258061e-106
Kpol_1068.78.841ON3233197552e-98
Suva_16.328.841ON2592497292e-95
Skud_100.1singletonON2002006103e-78
Skud_101.1singletonON2002006093e-78
SAKL0D09306gna 3ON3263346014e-75
AFR410WsingletonON3703305351e-64
Kwal_0.322na 3ON3323355051e-60
KLTH0H12716gna 3ON3483525052e-60
Skud_47.2singletonON96952978e-33
YMR321Cna 1ON105972228e-22
KLLA0E24795g8.598ON602110770.41
CAGL0I02552g5.59ON1005174741.0
AAR056C6.326ON15546682.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL125W
         (336 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-synteni...   629   0.0  
KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON}       395   e-138
SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {O...   395   e-138
Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar ...   393   e-137
KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {O...   390   e-136
Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {O...   388   e-135
NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON}               384   e-133
Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {O...   381   e-132
KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {O...   380   e-132
YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}  SAM4S-adenos...   379   e-131
TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON}     373   e-129
TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {...   372   e-128
KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON}             370   e-128
NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON}       369   e-127
Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W (...   369   e-127
TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON}       363   e-125
Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON} ...   362   e-125
YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}  MH...   360   e-124
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...   360   e-124
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...   355   e-122
KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON}               344   e-118
KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON}      339   e-115
Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)        329   e-112
TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841 ...   316   e-106
TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.84...   315   e-106
ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} simil...   315   e-106
Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}...   295   2e-98
Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W (R...   285   2e-95
Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   239   3e-78
Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   239   3e-78
SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar...   236   4e-75
AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-synte...   210   1e-64
Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MH...   199   1e-60
KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} simi...   199   2e-60
Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)      119   8e-33
YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON} P...    90   8e-22
KLLA0E24795g Chr5 (2195975..2197783) [1809 bp, 602 aa] {ON} simi...    34   0.41 
CAGL0I02552g Chr9 (227257..230274) [3018 bp, 1005 aa] {ON} weakl...    33   1.0  
AAR056C Chr1 complement(442171..442638) [468 bp, 155 aa] {ON} Sy...    31   2.5  

>ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 336

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/336 (92%), Positives = 310/336 (92%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA
Sbjct: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK
Sbjct: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE
Sbjct: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXXXPLNPNFLGLGINCSS 240
           LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPM           PLNPNFLGLGINCSS
Sbjct: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVAAIVAAAAPLNPNFLGLGINCSS 240

Query: 241 LSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPHVVDWGAVVASYIRSGARI 300
           LSRT               MTIYPNSGEIYDPVKKVWNASPHVVDWGAVVASYIRSGARI
Sbjct: 241 LSRTPAILAELHALLPALPMTIYPNSGEIYDPVKKVWNASPHVVDWGAVVASYIRSGARI 300

Query: 301 IGGCCRTIPNDIRQIADAVRTHARASSTDVPGHASP 336
           IGGCCRTIPNDIRQIADAVRTHARASSTDVPGHASP
Sbjct: 301 IGGCCRTIPNDIRQIADAVRTHARASSTDVPGHASP 336

>KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  395 bits (1015), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 185/326 (56%), Positives = 233/326 (71%), Gaps = 2/326 (0%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           MPR PI++YLEE+P +VLV+DGGQGTELENRGI VA+PVWS  PF+  + W    S++R 
Sbjct: 1   MPRQPIKEYLEENPKKVLVLDGGQGTELENRGIHVANPVWSTIPFISESFWSNASSKDRE 60

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           IV  + +DF+ AGA+++MTITYQ SF SVT NT I TL++YN LL+RIV F R  +GD+K
Sbjct: 61  IVKGMFQDFLDAGADILMTITYQTSFKSVTENTPIKTLKEYNELLERIVSFSRSCIGDEK 120

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YL+G IG WGAHVCAEF GDYG  P++IDY AYFKPQLDNF     LDLIGFET+PN HE
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGGHPENIDYYAYFKPQLDNFFQNKDLDLIGFETVPNFHE 180

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXX-XXXXXXXXPLNPNFLGLGINCS 239
           L+AILSWD+++++KPFY+ LSVH+ G LRDGT M             +NPNFL LGINC 
Sbjct: 181 LKAILSWDDTILSKPFYIGLSVHENGVLRDGTTMNEIGYYIKSLGSKINPNFLLLGINCV 240

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPHV-VDWGAVVASYIRSGA 298
           S S +               +  YPNSGEIYD VKK+W  + +  + W  VV  YI++GA
Sbjct: 241 SFSDSPDILESIHKELPDMPLIAYPNSGEIYDTVKKIWLPNHYSDITWNDVVNRYIKAGA 300

Query: 299 RIIGGCCRTIPNDIRQIADAVRTHAR 324
           RIIGGCCRT+P+DI Q++ AV+   +
Sbjct: 301 RIIGGCCRTMPDDIEQVSAAVKKSHK 326

>SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 327

 Score =  395 bits (1015), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 182/325 (56%), Positives = 222/325 (68%), Gaps = 2/325 (0%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           M R PI+Q+ +E P  +LVMDGGQGTELENRGI VA+PVWS  PF+  + W    SR+R 
Sbjct: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           IV  +  DF+  G+ ++MT TYQ SF SV+ NT I TL++YN LL+RIV F RE +G+DK
Sbjct: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YL+G IGAWGAHVC EFTGDYG  P+ ID+L YF+PQL NFN+   +DLIGFETIPN HE
Sbjct: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXX-XPLNPNFLGLGINCS 239
           L+AILSWDES+I+KPFY+ LSVH+ G LRDGT M             LNPN + LGINC 
Sbjct: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVW-NASPHVVDWGAVVASYIRSGA 298
           S + +               M +YPNSGEIYD VKK+W +     V W  VV SYI +GA
Sbjct: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300

Query: 299 RIIGGCCRTIPNDIRQIADAVRTHA 323
           RIIGGCCRT P DI+ I  A+  + 
Sbjct: 301 RIIGGCCRTSPQDIKDIVQAIEKYK 325

>Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ABL125W
          Length = 326

 Score =  393 bits (1010), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 183/324 (56%), Positives = 230/324 (70%), Gaps = 2/324 (0%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           M R  ++Q L+ +P ++L+MDGGQGTELENRGI VA+PVWS  PF++ + W    SR+R 
Sbjct: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINDSFWSDRSSRDRQ 60

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           IVA +  +++AAGA ++MTITYQ+SF SV+ NT I TL++YN LLDRIV F R  +G D 
Sbjct: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YLVG IG+WGAH+CAEF+GDYG  P+ I YL YF+PQL+NFN Q  +D+IGFETIPN HE
Sbjct: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXX-XPLNPNFLGLGINCS 239
           L AILSWDES+I KPFY+ +SVH+ GTLRDGT M             LNPNFL LGINC 
Sbjct: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPH-VVDWGAVVASYIRSGA 298
           S   +               +  YPNSGE+YD VKK+W  + + +V W  +V SY++SGA
Sbjct: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300

Query: 299 RIIGGCCRTIPNDIRQIADAVRTH 322
           RIIGGCCRT PNDIRQI  AV+ +
Sbjct: 301 RIIGGCCRTTPNDIRQIVTAVKKY 324

>KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase,
          Length = 331

 Score =  390 bits (1002), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 231/330 (70%), Gaps = 2/330 (0%)

Query: 3   RIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERAIV 62
           R+PI++Y EE+P  VLVMDGGQGTELENRGI VA+PVWS  PF++ + W    S++R IV
Sbjct: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61

Query: 63  ASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKYL 122
             +  DF+ AGA+++MTITYQ SF SV+ NT I TL++YN LLDRIV F R  +G+D+YL
Sbjct: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121

Query: 123 VGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHELR 182
           +G IGAWGAHVC+EFTGDYGP PD IDY  YF+PQL NF     +D+IGFETIPN HELR
Sbjct: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181

Query: 183 AILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXX-XPLNPNFLGLGINCSSL 241
           AILSWDE+V++KPFY+ LSVH+ G LRDGT M             LN N + +GINC + 
Sbjct: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241

Query: 242 SRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVW-NASPHVVDWGAVVASYIRSGARI 300
           +++               + +YPNSGEIYD VKK+W      +  W  VV SYI +GARI
Sbjct: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301

Query: 301 IGGCCRTIPNDIRQIADAVRTHARASSTDV 330
           IGGCCRT  +DI+++  AV  +A+ +++ +
Sbjct: 302 IGGCCRTTVDDIKEVRLAVNKYAKQTTSSL 331

>Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {ON}
           YPL273W (SAM4) - S-adenosylmethionine:homocysteine
           S-methyltransferase [contig 37] FULL
          Length = 329

 Score =  388 bits (997), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 186/326 (57%), Positives = 228/326 (69%), Gaps = 4/326 (1%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPD--SRE 58
           M R  I+++LE++P  VLV+DGGQGTELENRGI VA+PVWS  PF+  + W   D  S++
Sbjct: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60

Query: 59  RAIVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGD 118
           R IV  +  DF+ AGA V+MT+TYQASF SV+ NT I TL++Y++LL+RIV F RE +GD
Sbjct: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120

Query: 119 DKYLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNA 178
           DK+LVG IGAWGAH C+EFTGDYG  P+ ID+L YFKPQLDNF     +DLIGFETIPN 
Sbjct: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180

Query: 179 HELRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXXXP-LNPNFLGLGIN 237
           HELRAILSWDES+I KPFY+ LSVH+ G LRDGT M             LNPNF  LGIN
Sbjct: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240

Query: 238 CSSLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWN-ASPHVVDWGAVVASYIRS 296
           C S +++               +  YPNSGE+YD VKK+WN  +   + W  +V SYI S
Sbjct: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300

Query: 297 GARIIGGCCRTIPNDIRQIADAVRTH 322
           GARIIGGCCRT P DI  I +AV+ +
Sbjct: 301 GARIIGGCCRTSPKDIEAIHEAVQKY 326

>NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  384 bits (987), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 179/327 (54%), Positives = 225/327 (68%), Gaps = 3/327 (0%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           M R  I++YL+++P +VLV+DGGQGTELENRGI VA+PVWS  PF+  + W    S +R 
Sbjct: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           IV  +  DF+AAGAE++MT TYQ SF SV+ NT I TLQ+YN LL+RIV F R+ +G+ K
Sbjct: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YL+G IG WGAHVCAEF GDYG  P++IDY  YFKPQLDNF A   LDLIGFET+PN +E
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXX-XXXXXXXXPLNPNFLGLGINCS 239
           L+AILSWDE +++KPFY+ LSVH+ G LRDGT M             +NPN L LGINC 
Sbjct: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVW--NASPHVVDWGAVVASYIRSG 297
           S + +               +  YPNSGE+YD VKK+W    S + + W  VV  YI +G
Sbjct: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300

Query: 298 ARIIGGCCRTIPNDIRQIADAVRTHAR 324
           ARIIGGCCRT P DI +I+ AV+  ++
Sbjct: 301 ARIIGGCCRTTPKDILEISKAVKKFSK 327

>Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {ON}
           YPL273W (REAL)
          Length = 325

 Score =  381 bits (978), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 180/325 (55%), Positives = 224/325 (68%), Gaps = 2/325 (0%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           M RIP++Q L +DP +VLV+DGGQGTELENRGI VA+PVWS  PF+  + W    S  R 
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           IV  +  DF+AAGAE++MTITYQ SF SV+ NT I TL  Y+ LL RIV F R+ +G++K
Sbjct: 61  IVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEK 120

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           +L+G IG WGAHVC EFTG+YGP P+ ID+  YFKPQLDNFN    LDL+GFETIPN HE
Sbjct: 121 HLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHE 180

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMX-XXXXXXXXXXPLNPNFLGLGINCS 239
           L+AILSWDES+++KPFY+ LSVH+ G LRDGT M             +NPNFL LGINC 
Sbjct: 181 LKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCV 240

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWN-ASPHVVDWGAVVASYIRSGA 298
           S +++               +  YPNSGE+YD  KK+W   S  +  W  VV  YI SGA
Sbjct: 241 SFNQSPDILESLHRALPNMPLLAYPNSGEVYDTEKKIWMPNSDKLNSWDTVVKQYIGSGA 300

Query: 299 RIIGGCCRTIPNDIRQIADAVRTHA 323
           RIIGGCCRT P DI++++ AV+ + 
Sbjct: 301 RIIGGCCRTTPKDIQEVSAAVKKYT 325

>KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 329

 Score =  380 bits (976), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 186/326 (57%), Positives = 222/326 (68%), Gaps = 4/326 (1%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDS--RE 58
           MPR  +++YL  +P  VLV+DGGQGTELENRGI VA+PVWS  PF+  + W   DS  ++
Sbjct: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60

Query: 59  RAIVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGD 118
           R IV  +  DF+ AGA V+MT+TYQASF SV+ NT ITTL++Y+ALL RIV F R  +GD
Sbjct: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120

Query: 119 DKYLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNA 178
           DK+LVG IG WGAH C+EFTGDYG  P+ IDYL YFKPQLDNF     LDLIGFETIPN 
Sbjct: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180

Query: 179 HELRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXX-XPLNPNFLGLGIN 237
           HELRAILSWD +++ KPFY+ LSVH+ G LRDGT M             +NPNF+ LGIN
Sbjct: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240

Query: 238 CSSLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWN-ASPHVVDWGAVVASYIRS 296
           C S + +               +  YPNSGE+YD VKK+WN    H + W  VV SYI S
Sbjct: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300

Query: 297 GARIIGGCCRTIPNDIRQIADAVRTH 322
           GARIIGGCCRT P DI  I  AV  +
Sbjct: 301 GARIIGGCCRTSPKDIAAINAAVNKY 326

>YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}
           SAM4S-adenosylmethionine-homocysteine methyltransferase,
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 325

 Score =  379 bits (973), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 176/325 (54%), Positives = 223/325 (68%), Gaps = 2/325 (0%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           M R+P++Q+L ++P +VLV+DGGQGTELENRGI VA+PVWS  PF+  + W    S  R 
Sbjct: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           IV  +  DF+ AGAE++MT TYQ S+ SV+ NT I TL +YN LL+RIV F R  +G+DK
Sbjct: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YL+G IG WGAH+C EFTGDYG  P++ID+  YFKPQL+NFN    LDLIGFETIPN HE
Sbjct: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXX-XPLNPNFLGLGINCS 239
           L+AILSWDES++++PFY+ LSVH+ G LRDGT M             +NPNF  LGINC 
Sbjct: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVW-NASPHVVDWGAVVASYIRSGA 298
           S +++               +  YPNSGE+YD  KK+W   S  +  W  VV  YI SGA
Sbjct: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300

Query: 299 RIIGGCCRTIPNDIRQIADAVRTHA 323
           RIIGGCCRT P DI++I+ AV+ + 
Sbjct: 301 RIIGGCCRTSPKDIQEISAAVKKYT 325

>TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON} 
          Length = 331

 Score =  373 bits (957), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 173/328 (52%), Positives = 219/328 (66%), Gaps = 4/328 (1%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           M R  I+ YL+E+P +VLVMDGGQGTELENRGI VA+PVWS  PF+  + W    S +R 
Sbjct: 1   MARQCIKNYLQENPNKVLVMDGGQGTELENRGIKVANPVWSTIPFISESFWSDQSSEDRK 60

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           IV  +  DF+ AGAE++MT TYQ SF SV+ NT I   + YN LL+RI+ F R+ +G+++
Sbjct: 61  IVKEMFNDFINAGAEILMTTTYQTSFKSVSENTPIKNTKHYNELLNRIIDFSRDCIGEER 120

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YL+G IG+WGAH+CAEF GDYG  P++ID+  YFKPQLDNF     LDLIGFET+PN HE
Sbjct: 121 YLIGCIGSWGAHICAEFHGDYGEHPENIDFYEYFKPQLDNFFNNNKLDLIGFETVPNIHE 180

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXX-XXXPLNPNFLGLGINCS 239
           L+AILSWDE +++KPFY+ LSVH+ G LRDGT M             LNPN   LGINC 
Sbjct: 181 LKAILSWDEKILSKPFYIGLSVHENGLLRDGTSMQEVANLIKGFGEKLNPNLTLLGINCV 240

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVW--NASPHVVDWGAVVASYIRSG 297
           S + +               +  YPNSGEIYD  KK+W  N +P +  W  +V  YI +G
Sbjct: 241 SYNHSNDIIKSIHKELPNLPLIAYPNSGEIYDTTKKIWLPNKNP-IFTWDDIVKGYIEAG 299

Query: 298 ARIIGGCCRTIPNDIRQIADAVRTHARA 325
            RIIGGCCRT PNDI+ +  AV+  A+ 
Sbjct: 300 VRIIGGCCRTTPNDIKAVTIAVKERAKK 327

>TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {ON}
           
          Length = 328

 Score =  372 bits (955), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 177/327 (54%), Positives = 222/327 (67%), Gaps = 3/327 (0%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           M RIPI++ + E    +LV+DGGQGTELENRGI VA+PVWS  PFL  + W    S+ER 
Sbjct: 1   MVRIPIKKLVIE-SKEILVLDGGQGTELENRGIEVANPVWSTIPFLSESFWTDSSSKERK 59

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           IV SV  DF  +G+ ++MTITYQ SFTS+  NT   TL +YN LLDRIV F R  +GD++
Sbjct: 60  IVESVFDDFKKSGSNILMTITYQTSFTSIVENTQFKTLAEYNTLLDRIVKFSRSCIGDER 119

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YL+GS+G WGAHVC EFTG+YG  P+ IDY  YFKPQLDNFN Q  +DLIGFET+PN HE
Sbjct: 120 YLIGSVGPWGAHVCCEFTGNYGLHPESIDYYEYFKPQLDNFNGQDEIDLIGFETVPNFHE 179

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXX-XXXXXXXXPLNPNFLGLGINCS 239
           L+AILSWDE+ IAKPFY+ LSVH+ G LRDGT M             ++ NFL LG+NC 
Sbjct: 180 LKAILSWDETKIAKPFYIGLSVHNNGVLRDGTTMEEIGEYIKGLGEKISSNFLLLGVNCV 239

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPHVVD-WGAVVASYIRSGA 298
           S + +               +  YPNSGE+YD  KK+W  +   +D W +VV SYI +GA
Sbjct: 240 SFNDSSDMVKSIHKALPDMPLLAYPNSGEVYDTEKKIWFDNKDKLDSWDSVVRSYIDNGA 299

Query: 299 RIIGGCCRTIPNDIRQIADAVRTHARA 325
           RIIGGCCRT P DI +++ AV+ + + 
Sbjct: 300 RIIGGCCRTSPRDIAEVSAAVKKYNKV 326

>KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON} 
          Length = 332

 Score =  370 bits (950), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 178/314 (56%), Positives = 219/314 (69%), Gaps = 2/314 (0%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           MPR PI++YL+ +P +VLV+DGGQGTELENRGI VA+PVWS  PF+D++ W    S++R 
Sbjct: 1   MPRQPIQEYLKVNPRKVLVLDGGQGTELENRGINVANPVWSTVPFIDSSFWSNKSSKDRV 60

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           IV  +   F+ AGAE++MT TYQ SF SV+ NT I  L++Y++LLDRIV F R+ +G DK
Sbjct: 61  IVKGMFDAFLDAGAEILMTTTYQTSFKSVSENTPIQNLEEYSSLLDRIVQFSRDCIGPDK 120

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YL+G IG WGAHVCAEF GDYGP P  IDYL+YFKPQLDNF     LDLIGFETIPN HE
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGPNPAEIDYLSYFKPQLDNFFHNDNLDLIGFETIPNIHE 180

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXX-XPLNPNFLGLGINCS 239
           LRAILSWDE++++KPFY+ LSVH+ G LRDG+ M             LN N   LGINC 
Sbjct: 181 LRAILSWDETILSKPFYIGLSVHNNGLLRDGSTMKDVADLIKSFGGKLNKNLTLLGINCV 240

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNAS-PHVVDWGAVVASYIRSGA 298
           S S +               +  YPNSGE+YD VKK+W  +   V+ W  VV  YI++GA
Sbjct: 241 SFSDSPDILESIHKELPDMPLIAYPNSGEVYDTVKKIWLPNRDMVMTWEEVVDRYIKAGA 300

Query: 299 RIIGGCCRTIPNDI 312
           RI+GGCCRT P DI
Sbjct: 301 RIVGGCCRTSPKDI 314

>NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  369 bits (947), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 172/330 (52%), Positives = 224/330 (67%), Gaps = 5/330 (1%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           M R PI+ YL E+P ++L++DGGQGTELENRGI VA+PVWS  PF++ + W    S++R 
Sbjct: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           IV  +  DF+ AGAE++MT TYQ SF SV+ NT I TL++Y+ LL RIV F R+ +G++K
Sbjct: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YL+G IG WGAH+C+EFTG+YG  P+ IDY  YFKPQL NF     LD+IGFETIPN +E
Sbjct: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXX-XXXXXXXPLNPNFLGLGINCS 239
           L+ ILSW   ++ KPFY+ LSVH+ G LRDGT M             LNPN + LGINC 
Sbjct: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVW---NASPHVVDWGAVVASYIRS 296
           SL+ +               + +YPNSGE+YD VKK+W   N   + + W  VV  Y+++
Sbjct: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETY-MSWDEVVERYLKA 299

Query: 297 GARIIGGCCRTIPNDIRQIADAVRTHARAS 326
           GARIIGGCCRT PNDI+QI+DAV  ++   
Sbjct: 300 GARIIGGCCRTTPNDIKQISDAVHKYSNTK 329

>Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W
           (REAL)
          Length = 325

 Score =  369 bits (947), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 180/325 (55%), Positives = 220/325 (67%), Gaps = 2/325 (0%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           M R+P++Q L ++P +VLV+DGGQGTELENRGI VA+PVWS  PF+  + W    S  R 
Sbjct: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSSSRK 60

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           IV  +  DF+ AGAE++MT TYQ S+ SV+ NT I TL +YN LL RIV F R  +G+DK
Sbjct: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YL+G IG WGAH+C EFTGDYG  P+ ID+  YFKPQLDNFN    LDLIGFETIPN HE
Sbjct: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNIHE 180

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXX-XPLNPNFLGLGINCS 239
           L+AILSWDESV++KPFY+ LSVH+ G LRDGT M             +NPNF  LGINC 
Sbjct: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVW-NASPHVVDWGAVVASYIRSGA 298
           S +++               +  YPNSGE+YD  KK+W   S  +  W AVV  YI SGA
Sbjct: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300

Query: 299 RIIGGCCRTIPNDIRQIADAVRTHA 323
           RIIGGCCRT P DI++I  AV+ + 
Sbjct: 301 RIIGGCCRTSPKDIQEIFTAVKKYT 325

>TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  363 bits (932), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 168/325 (51%), Positives = 225/325 (69%), Gaps = 3/325 (0%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           M R+P+R+ L  D  ++LV+DGGQGTE+ENRGI VA+PVWS+ PF+  + W    S+ER 
Sbjct: 1   MGRVPLRKVLT-DSRKILVLDGGQGTEMENRGIEVANPVWSSIPFVSESFWTDEWSKERK 59

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           IV  + +DF+++G++++MT+TYQASF ++  NT + TL +YN+LLDRIV F R  +GD++
Sbjct: 60  IVEEIYKDFMSSGSDMLMTVTYQASFKAIAENTELQTLSEYNSLLDRIVAFSRRCIGDER 119

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YLVGS+G W A+  +E+TGDYG   D IDY  Y+KPQLDNFN Q  +D+IG ET+PN HE
Sbjct: 120 YLVGSVGPWAAYNASEYTGDYGLHADSIDYYGYYKPQLDNFNKQEEIDMIGIETVPNFHE 179

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXX-XPLNPNFLGLGINCS 239
           L+AILSWDE  IAKPFYV+L+ HD+G LRDGT M             LNPNF+ LGINC 
Sbjct: 180 LKAILSWDEKKIAKPFYVSLTTHDSGVLRDGTAMEDIAQYIKCLGNNLNPNFMLLGINCV 239

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASP-HVVDWGAVVASYIRSGA 298
           S + +               +  YPNSGE+Y+P KK+W A+      W +VV S+I SGA
Sbjct: 240 SFNDSRDILELLHNALPEMLLLAYPNSGEVYEPKKKIWLANKCKTTSWDSVVKSFINSGA 299

Query: 299 RIIGGCCRTIPNDIRQIADAVRTHA 323
           RIIGGCCRT P DI  ++ AV+ ++
Sbjct: 300 RIIGGCCRTSPQDIADVSIAVKKYS 324

>Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON}
           YLL062C (REAL)
          Length = 324

 Score =  362 bits (930), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 173/325 (53%), Positives = 219/325 (67%), Gaps = 3/325 (0%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           M RI I + + E P +VLV+DGGQGTELENRGI + SPVWSAAPF+  + W+   S +R 
Sbjct: 1   MGRIAIEKLILEHPQKVLVLDGGQGTELENRGIDINSPVWSAAPFISDSFWESTSS-DRT 59

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           +V  + RDF+ AGA V+MT+TYQA+F+S++ NT I TL DYN  LDR+V F R  +G+D+
Sbjct: 60  LVEEMYRDFMDAGANVLMTVTYQANFSSISENTSIKTLSDYNRFLDRVVSFTRRVIGEDR 119

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YL+GSIG W AHV +E+TGDYG  P+ IDYL +FK QLDNFN    +DLIGFET+PN HE
Sbjct: 120 YLIGSIGPWAAHVSSEYTGDYGSHPEDIDYLQHFKAQLDNFNKHTEIDLIGFETVPNFHE 179

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXX-XPLNPNFLGLGINCS 239
           L+AILSWDE++I+KPFYV LSVHD G LRDGT M             +N +FL LG+NC 
Sbjct: 180 LKAILSWDENIISKPFYVGLSVHDNGLLRDGTTMEEIAAYVKSLGRKINRHFLLLGVNCI 239

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWN-ASPHVVDWGAVVASYIRSGA 298
           S +++               +  YPNSGE+YD   K W+ A      W  VV  +I +GA
Sbjct: 240 SFNQSTSILKSLHQALPDMPLLAYPNSGEVYDTKTKTWHQAKGKQNSWEVVVEEFIDNGA 299

Query: 299 RIIGGCCRTIPNDIRQIADAVRTHA 323
           RIIGGCCRT   DI +IA AV  H+
Sbjct: 300 RIIGGCCRTSAKDISEIASAVDKHS 324

>YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}
           MHT1S-methylmethionine-homocysteine methyltransferase,
           functions along with Sam4p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 324

 Score =  360 bits (925), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 168/325 (51%), Positives = 222/325 (68%), Gaps = 3/325 (0%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           M RIPI++ + E P +VL++DGGQGTELENRGI + SPVWSAAPF   + W+ P S+ER 
Sbjct: 1   MKRIPIKELIVEHPGKVLILDGGQGTELENRGININSPVWSAAPFTSESFWE-PSSQERK 59

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           +V  + RDF+ AGA ++MTITYQA+F S++ NT I TL  Y   LD+IV F RE +G+++
Sbjct: 60  VVEEMYRDFMIAGANILMTITYQANFQSISENTSIKTLAAYKRFLDKIVSFTREFIGEER 119

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YL+GSIG W AHV  E+TGDYGP P++IDY  +FKPQL+NFN    +DLIGFETIPN HE
Sbjct: 120 YLIGSIGPWAAHVSCEYTGDYGPHPENIDYYGFFKPQLENFNQNRDIDLIGFETIPNFHE 179

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXX-XXXPLNPNFLGLGINCS 239
           L+AILSWDE +I+KPFY+ LSV D   LRDGT +             +N N L +G+NC 
Sbjct: 180 LKAILSWDEDIISKPFYIGLSVDDNSLLRDGTTLEEISVHIKGLGNKINKNLLLMGVNCV 239

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPHVV-DWGAVVASYIRSGA 298
           S +++               + +YPNSGEIY+P +K W+   + + DW   V  ++ +GA
Sbjct: 240 SFNQSALILKMLHEHLPGMPLLVYPNSGEIYNPKEKTWHRPTNKLDDWETTVKKFVDNGA 299

Query: 299 RIIGGCCRTIPNDIRQIADAVRTHA 323
           RIIGGCCRT P DI +IA AV  ++
Sbjct: 300 RIIGGCCRTSPKDIAEIASAVDKYS 324

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score =  360 bits (923), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 174/325 (53%), Positives = 221/325 (68%), Gaps = 3/325 (0%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           M RIPI + L E P +VLV+DGGQGTELENRGI + SPVWSAAPF+  + W++  SRER 
Sbjct: 1   MKRIPIEKLLIEHPQKVLVLDGGQGTELENRGININSPVWSAAPFVSDSFWEK-SSRERK 59

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           +V  + RDF+ AGA V+MTITYQA+F S++ NT I TL  Y   LD+IV F R  +G+++
Sbjct: 60  VVEEMYRDFMNAGANVLMTITYQANFKSISKNTTIKTLPAYRRFLDQIVCFSRRLIGEER 119

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YL+GSIG W AHV +E+TG+YGP P+ IDY  +F+PQLD FN    +DLIGFETIPN HE
Sbjct: 120 YLIGSIGPWAAHVSSEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIGFETIPNFHE 179

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXX-XXXPLNPNFLGLGINCS 239
           L+AILSW E +I++PFYV LSVHD G LRDGT +             +N NFL LG+NC 
Sbjct: 180 LKAILSWGEDIISRPFYVGLSVHDNGLLRDGTTLEEISAHIKGLGSKINKNFLLLGVNCI 239

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPHVVD-WGAVVASYIRSGA 298
           S +++               + +YPNSGEIYDP +K W      +D W   V  +I SGA
Sbjct: 240 SFNQSTLILKALHEVLPDFPLLVYPNSGEIYDPKEKTWYHPTDKLDSWDVTVRKFIDSGA 299

Query: 299 RIIGGCCRTIPNDIRQIADAVRTHA 323
           RIIGGCCRT P DI +IA +V T++
Sbjct: 300 RIIGGCCRTSPKDIAEIAASVDTYS 324

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score =  355 bits (910), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 172/326 (52%), Positives = 217/326 (66%), Gaps = 3/326 (0%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           M RI I + + E PTRVLV+DGGQGTELENRGI +  PVWSA PF   + W+Q  S +R 
Sbjct: 1   MKRISIEKLILEYPTRVLVLDGGQGTELENRGINIGGPVWSATPFTSDSFWEQ-SSHDRE 59

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           +V  + RDF+ AGA V+MTITYQA+F S++ NT I TL  YN  LDRIV F R  +G+++
Sbjct: 60  VVEEMYRDFMNAGANVLMTITYQANFKSISENTSIQTLSAYNGFLDRIVSFTRRFIGEER 119

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YLVGSIG W AHV +E+TG+YGP P+ IDY  +FKPQLD+FN    +DLIGFET+PN HE
Sbjct: 120 YLVGSIGPWAAHVSSEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIGFETVPNFHE 179

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXXXP-LNPNFLGLGINCS 239
           L+AILSW E +I+KPFYV LSVHD G LRDGT M             +N + L +G+NC 
Sbjct: 180 LKAILSWGEDIISKPFYVGLSVHDNGLLRDGTTMEEVSAHIKGLGSRINKHLLLMGVNCI 239

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWN-ASPHVVDWGAVVASYIRSGA 298
           S +R+               + +YPNSGE+YD  +K W+  +     W   V ++I SGA
Sbjct: 240 SFNRSTLILRTLHESLPDTPLLVYPNSGEVYDVKEKTWHWPTDKPESWDITVKTFIDSGA 299

Query: 299 RIIGGCCRTIPNDIRQIADAVRTHAR 324
           RIIGGCCRT P DI +IA AVR +  
Sbjct: 300 RIIGGCCRTSPKDIAEIATAVRRYCE 325

>KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  344 bits (883), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 159/326 (48%), Positives = 217/326 (66%), Gaps = 2/326 (0%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           M R+PI++YL  +  ++LV+DGGQGTELE RGI ++SPVWS  PF++ + W    S +R 
Sbjct: 1   MGRVPIKEYLLRNSDKILVLDGGQGTELEKRGINISSPVWSTLPFINESFWSNSSSNDRK 60

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           I+  +  DF++AGA+V+ T TYQ SF S++ NT I TL+DY+ LL+RI  F RE +GD K
Sbjct: 61  IIKDMYSDFISAGADVLSTTTYQTSFASISENTNIQTLKDYHELLNRITKFTRECIGDSK 120

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YLVGSIG + A++ AE+TGD+G   D IDY  YFKPQLDNFN    +D+IGFETIPN HE
Sbjct: 121 YLVGSIGTYAAYLSAEYTGDFGDAADTIDYHGYFKPQLDNFNRSTEIDIIGFETIPNIHE 180

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMX-XXXXXXXXXXPLNPNFLGLGINCS 239
           LRAILS ++  ++KPFY++LS +    LRDGT +             LNPN + LGINC 
Sbjct: 181 LRAILSLNKKDLSKPFYISLSTNSKAQLRDGTSLKGVVDVIKSFESTLNPNLILLGINCI 240

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPH-VVDWGAVVASYIRSGA 298
            L+ +               + +YPNSGE YDPV+K+W A       W  +V  Y+ +GA
Sbjct: 241 GLNSSHLTMEYLNNHLPQFPLIVYPNSGEKYDPVRKIWLADEDPAFTWEYIVHRYLDAGA 300

Query: 299 RIIGGCCRTIPNDIRQIADAVRTHAR 324
           RI+GGCCRT P+DIR I++A++ + +
Sbjct: 301 RIVGGCCRTTPSDIRSISEAIKCYTK 326

>KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  339 bits (869), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 153/322 (47%), Positives = 217/322 (67%), Gaps = 2/322 (0%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           M R+P+++YL+E+P +VLV DGGQG ELE RG+ +   +WS  PFL  + W  P S +  
Sbjct: 1   MVRVPLKKYLKENPEKVLVSDGGQGLELERRGLDIKHRLWSTRPFLSKSFWSDPSSNDIR 60

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           IV  +  DFV AGAE++MT TYQ SF +V+ +T + +L++YN LLD+IVGF R  +GD++
Sbjct: 61  IVKGMFEDFVNAGAEILMTTTYQTSFKAVSESTELKSLREYNELLDKIVGFTRACIGDNR 120

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YL+GSIG++GA V  E++GDYG  P+ +D+ +YFKPQLDNF     +D++GFETI N  E
Sbjct: 121 YLIGSIGSYGALVGGEYSGDYGDSPETVDFYSYFKPQLDNFLNNDEIDIVGFETIANFTE 180

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXX-XXXXXXXPLNPNFLGLGINCS 239
           L+++LSWDE  ++KPFY++LSVHD G LRDGTPM             +NPN   LG+NC 
Sbjct: 181 LKSLLSWDEKKVSKPFYISLSVHDNGNLRDGTPMHLITDYIKSLATAINPNLTFLGVNCV 240

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPH-VVDWGAVVASYIRSGA 298
           + ++                ++++PNSGE+++  K +W A+P     W AVV  +I SG 
Sbjct: 241 NYNKATEIIDSIHNGLPTMPLSVFPNSGEVFNVEKGIWTANPEAAASWEAVVKRFISSGV 300

Query: 299 RIIGGCCRTIPNDIRQIADAVR 320
           RI+GGCCRT P+DI QI+ AV+
Sbjct: 301 RIVGGCCRTRPHDIEQISKAVK 322

>Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)
          Length = 273

 Score =  329 bits (844), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 154/272 (56%), Positives = 190/272 (69%), Gaps = 1/272 (0%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           M RIP++Q L +DP +VLV+DGGQGTELENRGI VA+PVWS  PF+  + W    S  R 
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           IV  +  DF+AAGAE++MTITYQ SF SV+ NT I TL  Y+ LL RIV F R+ +G++K
Sbjct: 61  IVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEK 120

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           +L+G IG WGAHVC EFTG+YGP P+ ID+  YFKPQLDNFN    LDL+GFETIPN HE
Sbjct: 121 HLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHE 180

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMX-XXXXXXXXXXPLNPNFLGLGINCS 239
           L+AILSWDES+++KPFY+ LSVH+ G LRDGT M             +NPNFL LGINC 
Sbjct: 181 LKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCV 240

Query: 240 SLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYD 271
           S +++               +  YPNSGE+YD
Sbjct: 241 SFNQSPDILESLHRALPNMPLLAYPNSGEVYD 272

>TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841
           YPL273W
          Length = 323

 Score =  316 bits (809), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 149/319 (46%), Positives = 200/319 (62%), Gaps = 2/319 (0%)

Query: 3   RIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQP-DSRERAI 61
           R+P R++++E P  +LV+DGGQGTELENRG+ + SP+WS   F++   W +  ++ ER  
Sbjct: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61

Query: 62  VASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKY 121
           +  +  DF  AGA V  T+TYQ SF+SV+ NT I +LQ+Y+ LL +I GFCR  + DD Y
Sbjct: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121

Query: 122 LVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHEL 181
           L+G IGA+ A + AE+ G+YG     IDYL YFKPQLD FN    +D+IGFETIPN HEL
Sbjct: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181

Query: 182 RAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXXXPLNPNFLGLGINCSSL 241
            AILSWDE +I +PF++ALS+ D   LRDGT               N N + +G NC S 
Sbjct: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGRNKNLVYVGGNCISY 241

Query: 242 SRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPHV-VDWGAVVASYIRSGARI 300
           + +               +  YPNSGEIYD   K W+++  + + W  VV  Y  +G +I
Sbjct: 242 AYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVKI 301

Query: 301 IGGCCRTIPNDIRQIADAV 319
           IGGCCRT P+DI+QI  AV
Sbjct: 302 IGGCCRTTPDDIKQIKKAV 320

>TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.841
           YPL273W
          Length = 326

 Score =  315 bits (808), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 151/320 (47%), Positives = 209/320 (65%), Gaps = 3/320 (0%)

Query: 3   RIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPD-SRERAI 61
           R   ++Y    P  V+VMDGGQGTELE RG+ V+S VWS  PF+    WQ+ + S+  +I
Sbjct: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61

Query: 62  VASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKY 121
           V  + + FVAAG++ +M+ITYQ SF+++++NT I  L++YN LL++IV FCRE +G+ KY
Sbjct: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121

Query: 122 LVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHEL 181
           L+GSIG + +HV AE+TGDYG  P+++DYL YFKPQLDNFN    +DLI  ET+PN +EL
Sbjct: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNKYEL 181

Query: 182 RAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXXXPLNPNFLGLGINCSSL 241
           +A+LSWD + I KPFY++LSV D G LRDGT M             NPN + +G+NC S 
Sbjct: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVSY 241

Query: 242 SRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVW--NASPHVVDWGAVVASYIRSGAR 299
            +T               +  YPNSGE+YD + + W  N    +  W  +V   + +G R
Sbjct: 242 DKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGVR 301

Query: 300 IIGGCCRTIPNDIRQIADAV 319
           ++GGCCRT P+DI +IA AV
Sbjct: 302 MVGGCCRTTPDDIHKIAQAV 321

>ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 325

 Score =  315 bits (806), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 207/325 (63%), Gaps = 14/325 (4%)

Query: 6   IRQYLEE---DPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQ--QPDSRERA 60
           +RQ L E   D  RVLVMDGGQGTELENRG+ ++ P+WS  PF     W   QP + +R 
Sbjct: 1   MRQQLLEVLRDTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYT-DRD 59

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120
           +V S+ + +V AGA+++ T+TYQ S+ ++  +T I T   Y+ LLDRIVGFCR  +GDD 
Sbjct: 60  VVNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDH 119

Query: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180
           YLVGSIG + AHV AE+TGDYGP+P+ IDY  YF+PQ+ NFN    +D+IG ET+PN HE
Sbjct: 120 YLVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHE 179

Query: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXXXPLNPNFLGLGINCSS 240
           L++ILSWDE+ I+KPFYV+L V D G LRDGTP+             N N L +GINC S
Sbjct: 180 LKSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPLFANRS--NKNLLLVGINCCS 237

Query: 241 LSRTXXXXXXXXXXXXXXXM--TIYPNSGEIYDPVKKVWN----ASPHVVDWGAVVASYI 294
           LS +               M   +YPNSGEIYD   + W+       H + W ++V  Y 
Sbjct: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYR 297

Query: 295 RSGARIIGGCCRTIPNDIRQIADAV 319
           + GAR IGGCCRT P DI++I   V
Sbjct: 298 KFGARAIGGCCRTTPLDIQEICKVV 322

>Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}
           complement(11996..12967) [972 nt, 324 aa]
          Length = 323

 Score =  295 bits (755), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 140/319 (43%), Positives = 194/319 (60%), Gaps = 3/319 (0%)

Query: 3   RIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAW-QQPDSRERAI 61
           R+PI + +   P  VLV DGG GT LE+RGI V+SP+WS  PFL    W  +  + +R I
Sbjct: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61

Query: 62  VASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKY 121
           +  + RD++ +G+ ++ TITYQ SF  ++T+T + T++ Y  L+  I  FCR  +G+D Y
Sbjct: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121

Query: 122 LVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHEL 181
           L+GSIG +GA + AE+TG+YG  P +I+YL YFKPQL+ FN    +D+IGFET+PN +EL
Sbjct: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181

Query: 182 RAILSWDESVIAKPFYVALSVHDAGTLRDGTPMXXXXXXXXXXXPLNPNFLGLGINCSSL 241
            AILSWD+SVI+KP+YV+LS+ D G LRDGT               N N +  G NC S 
Sbjct: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN-NDNLILTGANCISF 240

Query: 242 SRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPHV-VDWGAVVASYIRSGARI 300
                             + +YPNSGEIYDP+ K W       + W  ++     S  RI
Sbjct: 241 KYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVRI 300

Query: 301 IGGCCRTIPNDIRQIADAV 319
           +GGCCRT P+DI +I D +
Sbjct: 301 VGGCCRTTPDDINKIKDMI 319

>Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W
           (REAL)
          Length = 259

 Score =  285 bits (729), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 169/249 (67%), Gaps = 2/249 (0%)

Query: 77  IMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKYLVGSIGAWGAHVCAE 136
           +MTITYQ SF SV+ NT I TL  Y+ LL RIV F R+ +G++K+L+G IG WGAHVC E
Sbjct: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70

Query: 137 FTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHELRAILSWDESVIAKPF 196
           FTG+YGP P+ ID+  YFKPQLDNFN    LDL+GFETIPN HEL+AILSWDES+++KPF
Sbjct: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130

Query: 197 YVALSVHDAGTLRDGTPMX-XXXXXXXXXXPLNPNFLGLGINCSSLSRTXXXXXXXXXXX 255
           Y+ LSVH+ G LRDGT M             +NPNFL LGINC S +++           
Sbjct: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190

Query: 256 XXXXMTIYPNSGEIYDPVKKVW-NASPHVVDWGAVVASYIRSGARIIGGCCRTIPNDIRQ 314
               +  YPNSGE+YD  KK+W   S  +  W  VV  YI SGARIIGGCCRT P DI++
Sbjct: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250

Query: 315 IADAVRTHA 323
           ++ AV+ + 
Sbjct: 251 VSAAVKKYT 259

>Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  239 bits (610), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 134/200 (67%), Gaps = 1/200 (0%)

Query: 78  MTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKYLVGSIGAWGAHVCAEF 137
           MT TYQ S+ SV+ NT I TL +YN LL RIV F R  +G+DKYL+G IG WGAH+C EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRVCIGEDKYLIGCIGPWGAHICCEF 60

Query: 138 TGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHELRAILSWDESVIAKPFY 197
           TGDYGP P  ID+  YFKPQLDNFN    LDLIGFETIPN HELRAILSWDES+++KPFY
Sbjct: 61  TGDYGPDPQSIDFYKYFKPQLDNFNKSDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 198 VALSVHDAGTLRDGTPMXXXXXXXX-XXXPLNPNFLGLGINCSSLSRTXXXXXXXXXXXX 256
           + LSVH+ G LRDGT M             +NPNF  LGINC S +++            
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQVLP 180

Query: 257 XXXMTIYPNSGEIYDPVKKV 276
              +  YPNSGE+YD  KK+
Sbjct: 181 NMALLAYPNSGEVYDTEKKI 200

>Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  239 bits (609), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 113/200 (56%), Positives = 136/200 (68%), Gaps = 1/200 (0%)

Query: 78  MTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKYLVGSIGAWGAHVCAEF 137
           MT TYQ S+ SV+ NT I TL +YN LL RIV F R+ +G++KYL+G IG WGAH+C EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRDCIGENKYLIGCIGPWGAHICREF 60

Query: 138 TGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHELRAILSWDESVIAKPFY 197
           TGDYGP P+ ID+  YFKPQLDNFN    LDLIGFETIPN HELRAILSWDES+++KPFY
Sbjct: 61  TGDYGPDPESIDFYEYFKPQLDNFNKNDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 198 VALSVHDAGTLRDGTPMXXXXXXXX-XXXPLNPNFLGLGINCSSLSRTXXXXXXXXXXXX 256
           + LSVH+ G LRDGT M             +NPNF  LGINC S +++            
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQALP 180

Query: 257 XXXMTIYPNSGEIYDPVKKV 276
              +  YPNSGE+YD  KK+
Sbjct: 181 DMALLAYPNSGEVYDTEKKI 200

>SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar to
           uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 326

 Score =  236 bits (601), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 131/334 (39%), Positives = 188/334 (56%), Gaps = 26/334 (7%)

Query: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
           M R PI +YLE   + +LV+DGGQGTE+E RGI V  P+WS  PF+      + +     
Sbjct: 1   MRRQPIAEYLE---SSILVLDGGQGTEMERRGIDVIHPLWSTLPFI------KKNPTHLN 51

Query: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVT--TNTGITTLQDYNALLDRIVGFCR-ETVG 117
            +  +  DF  +GA  + TITYQASF ++   ++  + T Q Y   L+ I+GF R + + 
Sbjct: 52  HIKGMYHDFSTSGARALSTITYQASFATLKQYSDGQVVTEQQYQQFLNDIIGFTRDQCIS 111

Query: 118 DDKYLVGSIGAWGAHVC--AEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETI 175
           D +YL+G +G + A++C  AE++GDYG   + ID+  YFKPQLD F+    +D++GFETI
Sbjct: 112 DSQYLIGCVGPYAAYLCNGAEYSGDYGS--EKIDFKQYFKPQLDVFSRDDRIDMVGFETI 169

Query: 176 PNAHELRAILSWDESVI--AKPFYVALSVHDAGTLRDGTPMXXXXXXXXXXXPLN-PNFL 232
           PN  EL+ +LS D + +   KPFY+++S    G LRDGTP+               PN L
Sbjct: 170 PNIEELKTLLSKDFTSMLGTKPFYISISTDSNGNLRDGTPVAKICETIKDADKSTPPNLL 229

Query: 233 GLGINC----SSLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVWNASPHV---VD 285
            LGINC     S +                   +YPNSGEIYD     W+ +  +   + 
Sbjct: 230 FLGINCVDYHHSYNILSRLNGGLGDDCSLLFKAVYPNSGEIYDGNTHTWHTNSEIAPELT 289

Query: 286 WGAVVASYIRSGARIIGGCCRTIPNDIRQIADAV 319
           W  +V+ +     ++IGGCCRT P+DI+QIADAV
Sbjct: 290 WNYLVSKFAEQKCQLIGGCCRTTPDDIKQIADAV 323

>AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 370

 Score =  210 bits (535), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 125/330 (37%), Positives = 177/330 (53%), Gaps = 24/330 (7%)

Query: 3   RIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERAIV 62
           +  I ++LE +   VLVMDGG G ELE RG+ V SP+WS APFL      + D      +
Sbjct: 48  KCAITEFLERN---VLVMDGGMGVELERRGMDVKSPLWSTAPFL------RGDRAALDTI 98

Query: 63  ASVLRDFVAAGAEVIMTITYQASFTSVTTNTG-ITTLQDYNALLDRIVGFC-RETVGDDK 120
             + R+F AAG+  I T+TYQASF S+   +G +++  DY   L+++V F  RE V   +
Sbjct: 99  RGLYREFRAAGSRGISTLTYQASFHSMVKYSGSVSSRADYEKFLEQVVDFTYRECVDPAR 158

Query: 121 -YLVGSIGAWGAHVC--AEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPN 177
            Y++GS+G + A +C  AE+TGDYG   + I++  YF+PQ+  F   P +D I FET+PN
Sbjct: 159 DYIIGSVGPYAAFLCNGAEYTGDYG--FETINFFNYFEPQVSKFATDPRIDAIAFETVPN 216

Query: 178 AHELRAIL--SWDESVIAKPFYVALSVHDAGTLRDGTPMXXX-XXXXXXXXPLNPNFLGL 234
             EL A+L   +   +  KPFY+++S  D   LRDGTP+             L PN L  
Sbjct: 217 VVELMAMLQPEFHALLKNKPFYISISAKDEHVLRDGTPLAVVGQLIRERMDDLPPNLLCF 276

Query: 235 GINCSSLSRTXXXXXXXXXXXX---XXXMTIYPNSGEIYDPVKKVWNASP--HVVDWGAV 289
           G+NC  L+R+                    IYPN   ++D     W  S     + W   
Sbjct: 277 GLNCVDLTRSAAMLAELNMQLQDCPIKFQAIYPNGTSVFDESLSAWRPSKDAESLTWAEA 336

Query: 290 VASYIRSGARIIGGCCRTIPNDIRQIADAV 319
           V  Y+    R+IGGCC T P D+RQIA+A+
Sbjct: 337 VKLYLNQDCRMIGGCCGTTPQDMRQIAEAL 366

>Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MHT1)
           - S-methylmethionine:homocysteine S-methyltransferase
           [contig 86] FULL
          Length = 332

 Score =  199 bits (505), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 113/335 (33%), Positives = 178/335 (53%), Gaps = 29/335 (8%)

Query: 3   RIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERAIV 62
           R+ + +YL+ +   +L++DGGQGTELE RGI +A P+WS  P++        D +   I+
Sbjct: 2   RLQLEEYLKHE---ILLLDGGQGTELEKRGINIAHPLWSTLPYV------TKDKKHLKII 52

Query: 63  ASVLRDFVAAGAEVIMTITYQASFTSVTTNTG--ITTLQDYNALLDRIVGFCR-ETVGDD 119
             +   F +AG   +MTITYQASF S+  ++   I   ++Y   LD ++ +   + +  +
Sbjct: 53  KEMYSAFESAGCNALMTITYQASFLSMKNHSDGLINNEKEYTRFLDYVIDYTENQCISPN 112

Query: 120 KYLVGSIGAWGAHVC--AEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPN 177
            YLVGS+G + A++   AE++G Y    D+ID++ +F+PQ+ +F     +DLIG ETIPN
Sbjct: 113 SYLVGSVGPYAAYLSNGAEYSGHY--IEDNIDFIEFFRPQVQHFAVSSRIDLIGIETIPN 170

Query: 178 AHELRAILSWDESVIA--KPFYVALSVHDAGTLRDGTP-MXXXXXXXXXXXPLNPNFLGL 234
             E +A+L  + S +   KP+Y++++  + G LRDGT               L PN +  
Sbjct: 171 FEEFKALLRPEFSRLCALKPYYISITTDNEGNLRDGTARQDICETIKRSAQDLPPNLVFF 230

Query: 235 GINCSSLSRTXXXXXXXXXXXXXXXM-------TIYPNSGEIYDPVKKVWNASPHV---V 284
           GINC S +                 +        +YPNSGE+Y      W  +P +    
Sbjct: 231 GINCVSFAHCADILKLLNDSLDDIGVENRLRFRAVYPNSGEVYHGDTHSWGPNPEIGPAD 290

Query: 285 DWGAVVASYIRSGARIIGGCCRTIPNDIRQIADAV 319
            W  + +  ++ G  +IGGCCRT P D+RQIA  V
Sbjct: 291 TWENLASKVVQQGCLMIGGCCRTSPADLRQIASVV 325

>KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 348

 Score =  199 bits (505), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 117/352 (33%), Positives = 185/352 (52%), Gaps = 30/352 (8%)

Query: 3   RIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERAIV 62
           R P++++ + +   +L++DGGQGTELE +G+ ++ P+WS  PF+        +      +
Sbjct: 2   RKPLKEFFKNN---ILLLDGGQGTELEKKGVSISHPLWSTLPFI------IKNKTHLEAI 52

Query: 63  ASVLRDFVAAGAEVIMTITYQASFTSVTTNTG--ITTLQDYNALLDRIVGFC-RETVGDD 119
             + RDF  AG+  +MTITYQASF+S+   +   + + +DY A LD ++GF  RE +  D
Sbjct: 53  KEMYRDFAEAGSNALMTITYQASFSSMKKYSEGLVNSEEDYAAFLDYVIGFTDRECITPD 112

Query: 120 KYLVGSIGAWGAHVC--AEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPN 177
           KYLVGS+G +   +   AE++G YG     ID++ Y+ PQ+ +F   P +DLIG ETIPN
Sbjct: 113 KYLVGSVGPYAGLLSNGAEYSGYYGE--GKIDFIDYYSPQVKHFALSPRIDLIGIETIPN 170

Query: 178 AHELRAILSWDESVI--AKPFYVALSVHDAGTLRDGTPMXXXXXXXXXXXPLNP-NFLGL 234
             E +A+LS + S +  +KP+Y++++  + G LRDGT +            L P NF+  
Sbjct: 171 IDEFKALLSPEFSRLSFSKPYYISVTTDNNGCLRDGTSLNEICRAIKQSASLLPDNFVFF 230

Query: 235 GINCSSLSRTXXXXXXXXXXXXXXXMT-------IYPNSGEIYDPVKKVWNASPHVV--- 284
            INC                     +         YPNSGEIY      W+++P+     
Sbjct: 231 AINCVEFLHCVEILQSLNDCLEMQGVDRRFRFRGAYPNSGEIYHGGTHSWSSNPYAGPED 290

Query: 285 DWGAVVASYIRSGARIIGGCCRTIPNDIRQIADAVRTHAR-ASSTDVPGHAS 335
            W  +    +     ++GGCCRT   +IRQ+A   + ++  A+    P  AS
Sbjct: 291 TWENLTLGLLSQECLMLGGCCRTGSEEIRQMALTTKKNSTVAAMKAFPSKAS 342

>Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)
          Length = 96

 Score =  119 bits (297), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 53/95 (55%), Positives = 69/95 (72%)

Query: 1  MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60
          M R+P++Q LE++P +VLV+DGGQGTELENRGI VA+PVWS  PF+  + W    S  R 
Sbjct: 1  MVRLPLKQLLEDNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWSDESSANRK 60

Query: 61 IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGI 95
          IV  +  DF+ AGAE++MT TYQ S+ SV+ NT I
Sbjct: 61 IVKGMFNDFLNAGAEILMTTTYQTSYKSVSENTPI 95

>YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON}
           Putative protein of unknown function; proposed to be a
           palmitoylated membrane protein
          Length = 105

 Score = 90.1 bits (222), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 57/97 (58%), Gaps = 1/97 (1%)

Query: 227 LNPNFLGLGINCSSLSRTXXXXXXXXXXXXXXXMTIYPNSGEIYDPVKKVW-NASPHVVD 285
           +NPN   LGINC S +++               +  YPNSGE+YD  KK+W   S  +  
Sbjct: 8   INPNLSFLGINCVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNS 67

Query: 286 WGAVVASYIRSGARIIGGCCRTIPNDIRQIADAVRTH 322
           W  VV  YI SGARIIGGCCRT P DI++I+ AV+ +
Sbjct: 68  WDTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKKY 104

>KLLA0E24795g Chr5 (2195975..2197783) [1809 bp, 602 aa] {ON} similar
           to uniprot|Q02981 Saccharomyces cerevisiae YPL109C
           Hypothetical ORF
          Length = 602

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 51/110 (46%), Gaps = 9/110 (8%)

Query: 6   IRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSA-APFLDAAAWQQPDSRERAIVAS 64
           +++  EE   +V ++D G  TEL +R  V    +++A A F    A +    R R    +
Sbjct: 453 MKRVFEEYEPQVCLIDAGLVTELNDRNRVNFIALFNALAKFDGYRAGELMIERSRTPETA 512

Query: 65  VLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRE 114
           + +D  A   E ++    + +FT  T + G         LLD+++G  R+
Sbjct: 513 IDKDLFALKVEKLVNKVKKQTFTLGTVSIG--------ELLDKMLGMVRQ 554

>CAGL0I02552g Chr9 (227257..230274) [3018 bp, 1005 aa] {ON} weakly
           similar to uniprot|P38699 Saccharomyces cerevisiae
           YHR178w STB5 SIN3 binding protein
          Length = 1005

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 69/174 (39%), Gaps = 21/174 (12%)

Query: 48  AAAWQQPDSRERAIVASVLRDFVAAGAE-------VIMTITYQASFTSVTTNTGITTLQD 100
           + +W   D   + I  S+L  FV+A  E       ++  +T+     ++ +   I  L  
Sbjct: 386 STSWVNEDGSPKPIKKSLLEKFVSAYFEHNHRLFPMVDKVTFLKKLATINSFESIEMLAV 445

Query: 101 YNALLDRIVGFCRETVGDDKYLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAY--FKPQL 158
            N  L +   F       + Y++ +IG        + T D G   +H+ YLA   F+  L
Sbjct: 446 NNPELPKTFIF-------EIYMIMAIGCTTLQRAGKLTTDEGHLYEHLAYLAMRNFRDIL 498

Query: 159 --DNFNAQPALDLIGFETIPNAHELRAILSWDESVIAKPFYVALSVHDAGTLRD 210
              +      L L+G  +     E + + SW  S IA    + L ++   T ++
Sbjct: 499 HQQDITTLRCLILLGIYSF---FEPKGVSSWTISGIAMRLAIELGLNRPLTAKE 549

>AAR056C Chr1 complement(442171..442638) [468 bp, 155 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNR024W
          Length = 155

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 21/46 (45%)

Query: 45 FLDAAAWQQPDSRERAIVASVLRDFVAAGAEVIMTITYQASFTSVT 90
          F+D++ W  P  RER       R  VA G  VI TI  Q    S T
Sbjct: 42 FIDSSEWSIPGRRERLRQIPTPRPVVAVGHTVIRTIDAQGGQASAT 87

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,983,409
Number of extensions: 1272957
Number of successful extensions: 2391
Number of sequences better than 10.0: 41
Number of HSP's gapped: 2330
Number of HSP's successfully gapped: 41
Length of query: 336
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 226
Effective length of database: 40,868,139
Effective search space: 9236199414
Effective search space used: 9236199414
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)