Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ABL124W8.842ON48548526080.0
Ecym_46138.842ON52448916910.0
YML115C (VAN1)8.842ON53542316000.0
Suva_13.288.842ON53042315970.0
SAKL0D01430g8.842ON44742315740.0
KLLA0D01529g8.842ON50148515700.0
KAFR0A028308.842ON50742315630.0
Kpol_541.158.842ON49842815610.0
KLTH0C03828g8.842ON40440615490.0
Smik_13.198.842ON53641415570.0
TDEL0B005608.842ON50942415470.0
Skud_13.268.842ON53941515470.0
NDAI0E002908.842ON52243415450.0
ZYRO0G14234g8.842ON50944315430.0
KNAG0G034208.842ON51142315430.0
NCAS0B003008.842ON52343415300.0
TBLA0B032708.842ON52041915110.0
TPHA0C047808.842ON52543014570.0
CAGL0B02321g8.842ON51242514440.0
Kwal_27.102468.842ON33934013860.0
KLTH0C03432g1.479ON4893669551e-124
CAGL0L01331g1.479ON4473659481e-123
Kwal_27.101571.479ON4763659501e-123
YEL036C (ANP1)1.479ON5003609521e-123
Smik_5.571.479ON4913609501e-123
SAKL0D11792g1.479ON4833659441e-122
Suva_5.331.479ON4953609451e-122
Ecym_35731.479ON4473659371e-122
KAFR0I027701.479ON4553659371e-122
Skud_5.541.479ON4913609401e-122
KNAG0I003001.479ON4573679351e-121
NCAS0G041101.479ON4943659371e-121
NDAI0B012501.479ON4463659301e-121
TBLA0B021701.479ON5723659381e-120
NDAI0G003401.479ON5043579321e-120
KLLA0E22155g1.479ON4503659151e-118
Kpol_370.51.479ON6453579281e-118
TDEL0C026001.479ON4623669111e-118
TPHA0O004301.479ON5483569191e-118
ZYRO0F05170g1.479ON6083599211e-117
AFR357W1.479ON4343669031e-117
KLLA0E12849g8.500ON3923634661e-52
CAGL0L12804g8.500ON3934054382e-48
SAKL0H11110g8.500ON3933654372e-48
NDAI0E030208.500ON3963634321e-47
Smik_16.1868.500ON3953684275e-47
ZYRO0F08492g8.500ON3963684268e-47
TDEL0B013708.500ON3963664251e-46
TPHA0L013708.500ON3923534242e-46
Suva_16.2658.500ON3953684223e-46
NCAS0C023308.500ON3933684223e-46
Kwal_27.118648.500ON4533554245e-46
KAFR0H013908.500ON3983644206e-46
TBLA0H033408.500ON3933644197e-46
KNAG0A021508.500ON3963664181e-45
Skud_16.2328.500ON3953684171e-45
KLTH0E11616g8.500ON3943664172e-45
Kpol_1031.788.500ON3923704153e-45
YPL050C (MNN9)8.500ON3953684153e-45
AGL259C8.500ON3893484083e-44
NCAS0B024408.500ON4003483935e-42
Ecym_25508.500ON3903543723e-39
NDAI0C052508.500ON4023453708e-39
KNAG0A039908.500ON3571752234e-19
SAKL0H20438gsingletonON5652031713e-12
ZYRO0G12540g3.295ON95073880.041
Ecym_23898.683ON1102149780.67
NDAI0B043502.149ON445112770.79
TBLA0B054602.503ON27448741.2
TBLA0C00180singletonON41481732.1
KLLA0F11748g3.295ON91363723.3
AAL088W8.683ON1104173705.1
ACR207Wna 1ON49189697.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL124W
         (485 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...  1009   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   655   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   620   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   619   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   610   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   609   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   606   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   605   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   601   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   604   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   600   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   600   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   599   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   598   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   598   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   593   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   586   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   565   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   560   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   538   0.0  
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   372   e-124
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   369   e-123
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   370   e-123
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   371   e-123
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   370   e-123
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   368   e-122
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   368   e-122
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   365   e-122
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   365   e-122
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   366   e-122
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   364   e-121
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    365   e-121
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   362   e-121
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   365   e-120
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   363   e-120
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   357   e-118
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   362   e-118
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   355   e-118
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   358   e-118
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   359   e-117
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   352   e-117
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   184   1e-52
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   173   2e-48
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   172   2e-48
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   171   1e-47
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   169   5e-47
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   168   8e-47
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   168   1e-46
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   167   2e-46
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   167   3e-46
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   167   3e-46
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   167   5e-46
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   166   6e-46
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   166   7e-46
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   165   1e-45
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   165   1e-45
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   165   2e-45
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   164   3e-45
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   164   3e-45
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   161   3e-44
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   155   5e-42
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   147   3e-39
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   147   8e-39
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...    91   4e-19
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    70   3e-12
ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} simila...    39   0.041
Ecym_2389 Chr2 (753049..756357) [3309 bp, 1102 aa] {ON} similar ...    35   0.67 
NDAI0B04350 Chr2 complement(1089949..1091286) [1338 bp, 445 aa] ...    34   0.79 
TBLA0B05460 Chr2 complement(1299725..1300549) [825 bp, 274 aa] {...    33   1.2  
TBLA0C00180 Chr3 (25369..26613) [1245 bp, 414 aa] {ON}                 33   2.1  
KLLA0F11748g Chr6 complement(1082975..1085716) [2742 bp, 913 aa]...    32   3.3  
AAL088W Chr1 (185828..189142) [3315 bp, 1104 aa] {ON} Syntenic h...    32   5.1  
ACR207W Chr3 (709648..711123) [1476 bp, 491 aa] {ON} NOHBY330; N...    31   7.4  

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score = 1009 bits (2608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/485 (100%), Positives = 485/485 (100%)

Query: 1   MNYKLKHVAMFVWVMICGTLVVRQLVGSGEREVILVDREVPMEEREVFVDVSDDERAAEW 60
           MNYKLKHVAMFVWVMICGTLVVRQLVGSGEREVILVDREVPMEEREVFVDVSDDERAAEW
Sbjct: 1   MNYKLKHVAMFVWVMICGTLVVRQLVGSGEREVILVDREVPMEEREVFVDVSDDERAAEW 60

Query: 61  EPQVLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQISRDDPEFEEQMEELVSATV 120
           EPQVLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQISRDDPEFEEQMEELVSATV
Sbjct: 61  EPQVLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQISRDDPEFEEQMEELVSATV 120

Query: 121 EQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDC 180
           EQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDC
Sbjct: 121 EQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDC 180

Query: 181 SENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMV 240
           SENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMV
Sbjct: 181 SENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMV 240

Query: 241 RDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTAN 300
           RDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTAN
Sbjct: 241 RDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTAN 300

Query: 301 ALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIE 360
           ALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIE
Sbjct: 301 ALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIE 360

Query: 361 STDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAK 420
           STDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAK
Sbjct: 361 STDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAK 420

Query: 421 LFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRER 480
           LFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRER
Sbjct: 421 LFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRER 480

Query: 481 ENRRS 485
           ENRRS
Sbjct: 481 ENRRS 485

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/489 (63%), Positives = 382/489 (78%), Gaps = 21/489 (4%)

Query: 1   MNYKLKHVAMFVWVMICGTLVVRQLV---GSGEREVILVDREVPMEEREVFVDVSDDERA 57
           ++YKLK+V + +  + C   +++Q +   GS  R                 + +SD    
Sbjct: 53  LSYKLKNVIVSLLTIACIFFLIKQTMDRNGSTPRSY------------AGLLSISD---- 96

Query: 58  AEWEPQVLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQISRDDPE-FEEQMEELV 116
             ++  VL++ EYY++E+     + + +YD+GF+H  + +DG ++ +  E FEE ++ L+
Sbjct: 97  -SYDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGTLNSNQEEGFEEHLDMLL 155

Query: 117 SATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFL 176
           S TVE YDL  Y GT NGAENREHVLIC+PLRNA  VLP+MF+HLMNLTYPHELID+AFL
Sbjct: 156 STTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFL 215

Query: 177 VSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEY 236
           VSDCS++D T+ SL+ YA  LQKGTL+  L  ++A     K+K  N  GDL+LKYM+++Y
Sbjct: 216 VSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYKMHKKSKSKNKEGDLHLKYMNKDY 275

Query: 237 LQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNW 296
           L MV +A   P+H+NY+KPFRSVQ+F+KDFGQ IGQGFSDRHHVKVQG RR+LMG+ARNW
Sbjct: 276 LNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNW 335

Query: 297 LTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLN 356
           LTANALKPYHSWVYWRD DVELCPGSVIEDLMS+GYDVIVPNVWRPLPEFLG +Q YDLN
Sbjct: 336 LTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLN 395

Query: 357 SWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSIL 416
           SWIES +ALNLAK L+EDDVIVEGYAEYATWRFHL   R+ +GN  +V+DLDGVGGVSIL
Sbjct: 396 SWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSIL 455

Query: 417 AKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIA 476
           AKAKLFR G HF AFAFENHAETEAFGKMAKKMGY+VGGL HYTLWHIYEPS+DD+M+IA
Sbjct: 456 AKAKLFRNGVHFAAFAFENHAETEAFGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIA 515

Query: 477 RRERENRRS 485
           R+ER +RRS
Sbjct: 516 RKERSSRRS 524

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/423 (68%), Positives = 340/423 (80%), Gaps = 7/423 (1%)

Query: 65  LDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVSATVE 121
           L+D EYYDY+F     E ++K+D+G +HY +++ G      +DD +++ ++  L  +TVE
Sbjct: 114 LEDEEYYDYDFEDIDPEVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVE 173

Query: 122 QYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCS 181
           +YDL N+EG PNG E R+H+L+CIPLRNA  VLP+MFKHLMNLTYPHELID+AFLVSDCS
Sbjct: 174 EYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCS 233

Query: 182 ENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVR 241
           E D TL +L+ Y+ +LQ GTL+ +      EI  +      G   LYLKYMD+ Y+  V 
Sbjct: 234 EGDTTLDALIAYSRHLQNGTLSQIFQ----EIDAVIDSQTKGTDKLYLKYMDEGYINRVH 289

Query: 242 DAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANA 301
            AFSPP+HENY+KPFRSVQ+F+KDFGQ IGQGFSDRH VKVQGIRR+LMGRARNWLTANA
Sbjct: 290 QAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 349

Query: 302 LKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIES 361
           LKPYHSWVYWRD DVELCPGSVI+DLMS  YDVIVPNVWRPLP FLG +Q YDLNSW+ES
Sbjct: 350 LKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMES 409

Query: 362 TDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKL 421
            +AL LAK L+EDDVIVEGYAEY TWR HL   R+A+G+P E +DLDGVGGVSILAKAK+
Sbjct: 410 QEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKI 469

Query: 422 FRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRERE 481
           FR G  F AF FENHAETEAFGKMAKKMGY+VGGLPHYT+WHIYEPSDDD+ +IA RERE
Sbjct: 470 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASRERE 529

Query: 482 NRR 484
            RR
Sbjct: 530 KRR 532

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/423 (68%), Positives = 341/423 (80%), Gaps = 7/423 (1%)

Query: 65  LDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVSATVE 121
           L+D EYY+Y+F     E ++K+D+G +HY +T+ G       D+ +++E+M  L+ +TVE
Sbjct: 110 LEDEEYYNYDFEDIDPEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVE 169

Query: 122 QYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCS 181
           +YDL N+EG PNG E R+H+L+CIPLRNA  VLP+MFKHLMNLTYPHELID+AFLVSDCS
Sbjct: 170 KYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCS 229

Query: 182 ENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVR 241
           E D TL +L+ Y+  LQ GTL+ +      EI  +      G   LYLKYMD++Y+  V 
Sbjct: 230 EGDTTLDALIAYSRQLQNGTLSEIFQ----EIDAVIDSQTKGTDKLYLKYMDEDYINRVH 285

Query: 242 DAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANA 301
            AFSPP+H+NY+KPFRSVQVF+KDFGQ IGQGFSDRH VKVQGIRR+LMGRARNWLTANA
Sbjct: 286 QAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 345

Query: 302 LKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIES 361
           LKPYHSWVYWRD DVELCPGSVI+DLMS  YDVIVPNVWRPLP FL  +Q YDLNSW+ES
Sbjct: 346 LKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMES 405

Query: 362 TDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKL 421
            +AL+LAK L+EDDVIVEGYAEY TWR HL   R+A G+P EV+DLDGVGGVSILAKAK+
Sbjct: 406 GEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKI 465

Query: 422 FRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRERE 481
           FR G  F AF FENHAETEAFGKMAKKMGY+VGGLPHYT+WHIYEPSDDD+ +IA RERE
Sbjct: 466 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATRERE 525

Query: 482 NRR 484
            RR
Sbjct: 526 KRR 528

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/423 (68%), Positives = 342/423 (80%), Gaps = 6/423 (1%)

Query: 65  LDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVSATVE 121
           L D EYY+Y+F     + + KYD+G EH+ +++ G       D+  +E+++E L+ ATV+
Sbjct: 27  LKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEMLLGATVD 86

Query: 122 QYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCS 181
            YDL  YEG+ NGAENR+HVL+C+PLRNA  VLP+MFKHLMNLTYPHELID+AFLVSDCS
Sbjct: 87  VYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCS 146

Query: 182 ENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVR 241
           E+D TL +L+ Y+  LQ GTL+ + A ++   ++   K   G  DLYLKYM+Q+YL MV 
Sbjct: 147 EDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIK---GSPDLYLKYMNQDYLNMVE 203

Query: 242 DAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANA 301
            AF PP+H++Y+KPFRSVQVF+KDFGQ IGQGFSDRH V VQGIRR+LMGRARNWLTANA
Sbjct: 204 MAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANA 263

Query: 302 LKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIES 361
           LKPYHSWVYWRDVD+ELCPGSVIEDLMS+  DV VPNVWRPLPEFLGG+Q YDLNSW+ES
Sbjct: 264 LKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVES 323

Query: 362 TDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKL 421
            +AL LA  L+EDDVIVEGYAEY TWR HL   R    NP E++DLDGVGGVSILAKAKL
Sbjct: 324 GEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKL 383

Query: 422 FRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRERE 481
           FR G HF AF FENHAETEAFGKMAKKM Y+VGGLPHYT+WHIYEPSDDD+ +IA++ERE
Sbjct: 384 FRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDLKEIAKKERE 443

Query: 482 NRR 484
            RR
Sbjct: 444 KRR 446

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/485 (59%), Positives = 366/485 (75%), Gaps = 33/485 (6%)

Query: 4   KLKHVAMFVWVMICGTLVVRQLVGSGEREVILVDREVPMEEREVFVDVSDDERAAEWEPQ 63
           K + V +F  V++   L++ +LVG                          +    ++ P 
Sbjct: 45  KSRIVFLFALVLVSTFLLLSKLVGG-------------------------NVNLMQYIPT 79

Query: 64  VLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ--ISRDDPE-FEEQMEELVSATV 120
            LD+ EYYDY+F     + + KYDEG  HY +++ G   +S +D E FE + + L+++T 
Sbjct: 80  SLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALSSEDKEAFEREADMLLASTT 139

Query: 121 EQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDC 180
           + YDL  Y G  NGA NR+HVL+C+PLR+A  +LPM+FK+LMNLTYPHELID+AFLVSDC
Sbjct: 140 DLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDC 199

Query: 181 SENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMV 240
           ++N +T+ SL++++  LQ GTL+  L   EA+  +     GN    LYLKYM ++YL+MV
Sbjct: 200 TDNGRTMSSLLDFSKELQNGTLSKTLQDFEADKDK-----GNSAEQLYLKYMGKDYLKMV 254

Query: 241 RDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTAN 300
           ++AF+PP+H++Y+KPFRS+Q+F+KDFGQ+IGQGFSDRH VKVQG+RR+LMGRARNWLTAN
Sbjct: 255 KNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTAN 314

Query: 301 ALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIE 360
           ALKPYHSWVYWRDVDVELCPG+VIEDLM   YDVIVPNVWRPLP FLGG Q YDLNSW+E
Sbjct: 315 ALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVE 374

Query: 361 STDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAK 420
           S +A+ LAK L+EDDVIVEGYAEY TWR HL   R+  GNP +++DLDGVGGVSILA+A+
Sbjct: 375 SNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPDDLLDLDGVGGVSILARAQ 434

Query: 421 LFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRER 480
           LFR+G HF AF FENHAETEAFGKMAKKMG+KVGGL HYTLWHIYEPSDDD+ +IA+ ER
Sbjct: 435 LFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLER 494

Query: 481 ENRRS 485
           E+RR+
Sbjct: 495 ESRRN 499

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/423 (67%), Positives = 343/423 (81%), Gaps = 7/423 (1%)

Query: 65  LDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ--ISRDDPE-FEEQMEELVSATVE 121
           L D EYY+++F       + K+D+G +HY +++ G   ++ +D E +E +M  L  +T+E
Sbjct: 89  LSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYDSTIE 148

Query: 122 QYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCS 181
            YDL+++ G PNGAENR+HVL+CIPLR+A  VLP+MF+HLMNLTYPHELID+AFLVSDCS
Sbjct: 149 TYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSDCS 208

Query: 182 ENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVR 241
           END TL +L+E++  LQ GTL+ VL     EI     +  +   +L+LKYMD EYL+ V+
Sbjct: 209 ENDNTLDALIEFSKNLQNGTLSQVLN----EIDAFTKEETSTKSNLHLKYMDPEYLKRVQ 264

Query: 242 DAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANA 301
            AFSPP+HE+Y+KPFRSVQ+F+K+FGQ IGQGFSDRH VKVQGIRR+LMGRARNWLTANA
Sbjct: 265 KAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 324

Query: 302 LKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIES 361
           LKPYHSWVYWRD D+ELCPGSVIEDLM+  YDVIVPNVWRPLP FL G+Q YDLNSW ES
Sbjct: 325 LKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRES 384

Query: 362 TDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKL 421
            +AL LA+ L+EDDVIVEGYAEY TWR HL   R+ +GNP EV+D+DGVGGVSILAKAKL
Sbjct: 385 AEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPDEVVDIDGVGGVSILAKAKL 444

Query: 422 FRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRERE 481
           FR G  F AF FENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDD+ ++A +ERE
Sbjct: 445 FRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKERE 504

Query: 482 NRR 484
            RR
Sbjct: 505 ERR 507

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/428 (64%), Positives = 344/428 (80%), Gaps = 9/428 (2%)

Query: 61  EPQVLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVS 117
           E ++L+D EYYDY+F       + K+D+G +HY +++ G       D   +E++++EL+S
Sbjct: 77  EAKILEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLS 136

Query: 118 ATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLV 177
            TV+ YDL  Y GT NG +NREHVL+C+PLR+A  VLP+MFK++MNLTYPHELID+AFLV
Sbjct: 137 TTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLV 196

Query: 178 SDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYL 237
           SDC+E D TL+SL+ Y+ +LQ GTL  +    + +  +  ++       LYLKYM+++YL
Sbjct: 197 SDCTEGDHTLESLIAYSRHLQDGTLAGLFQEMDKDDSKKDSEK------LYLKYMNKDYL 250

Query: 238 QMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWL 297
           +MV DA+SPP+H +YEKPFRSVQ+F+KDFGQ++GQGF++RH VKVQGIRR+LMGRARNWL
Sbjct: 251 KMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWL 310

Query: 298 TANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNS 357
             NALKPYH+WVYWRD DVELCPG+VIEDLMS  +DV+VPNVWRPLPEFL  +Q YDLNS
Sbjct: 311 MTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNS 370

Query: 358 WIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILA 417
           W+ES +AL LAK L+EDDVIVEGYAEY TWR HL   RE  GNP +V+DLDGVGGVSIL 
Sbjct: 371 WMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILV 430

Query: 418 KAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIAR 477
           KAKLFR G HF AF FENHAETEAFGKMAKKMG++VGGLPHYTLWHIYEPSDDD+++IA 
Sbjct: 431 KAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIAS 490

Query: 478 RERENRRS 485
           +EREN RS
Sbjct: 491 KERENNRS 498

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/406 (69%), Positives = 335/406 (82%), Gaps = 6/406 (1%)

Query: 83  LAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVSATVEQYDLRNYEGTPNGAENRE 139
           L K+D G EHY +++ GQ    S D   +EE+++ L+ +TVE YDLR++EG+  G  NRE
Sbjct: 2   LRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNRE 61

Query: 140 HVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCSENDKTLQSLMEYATYLQK 199
           HVL+ +PLRNA  VLP+MFK+LMNLTYPHELID+AFLVSDCSE+DKTL++L+EY   LQ 
Sbjct: 62  HVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQS 121

Query: 200 GTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSV 259
           GTL++V A   ++ + +K K   G  DL+LKYM   YL+MV+DA+SPP+H+ Y+KPFRSV
Sbjct: 122 GTLSDVFAAHSSDEELIKEK---GTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSV 178

Query: 260 QVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVELC 319
           Q+F+KDFGQ IGQGFSDRH VKVQGIRR+LMGRARNWLTANALKPYHSWVYWRD DVELC
Sbjct: 179 QIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 238

Query: 320 PGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIESTDALNLAKKLEEDDVIVE 379
           PGSVI+DLMS  +DV VPNVWRPLPEFL G+Q YDLNSWIES  AL LA+ L+EDDVIVE
Sbjct: 239 PGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVE 298

Query: 380 GYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAET 439
           GYAEY TWR HL   R+   NP+++I+LDGVGGVSILAKAKLFR G HF AF FENHAET
Sbjct: 299 GYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAET 358

Query: 440 EAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRERENRRS 485
           EAFGKMAKKMGY+V GLPHYTLWHIYEPSDDD++ IA RERE +RS
Sbjct: 359 EAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKRS 404

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/414 (67%), Positives = 331/414 (79%), Gaps = 7/414 (1%)

Query: 65  LDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVSATVE 121
           L+D EYYDY+F     E ++K+D G EHY +++ G      +DD +++ ++  L+ +TVE
Sbjct: 114 LEDEEYYDYDFEDIDPEVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVE 173

Query: 122 QYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCS 181
           +YDL  +EG  NG E R+H+L+C+PLRNA  VLP+MFKHLMNLTYPHELID+AFLVSDCS
Sbjct: 174 KYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCS 233

Query: 182 ENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVR 241
           E+D TL +L+ Y+  LQ GTL+ +      EI  +      G   LYL+YMDQ Y+  VR
Sbjct: 234 EDDTTLDALIAYSRQLQNGTLSQIFQ----EIDAVIDSQTKGTDKLYLQYMDQNYINRVR 289

Query: 242 DAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANA 301
            AFSPP+HENY+KPFRSVQ+F+KDFGQ IGQGFSDRH VKVQGIRR+LMGRARNWLTANA
Sbjct: 290 QAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 349

Query: 302 LKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIES 361
           LKPYHSWVYWRD DVELCPGS+I+DLMS  YDVIVPNVWRPLP FL  +Q YDLNSW+ES
Sbjct: 350 LKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMES 409

Query: 362 TDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKL 421
            + L LAK L+EDDVIVEGYAEY TWR HL   R+A+G+P EVIDLDGVGGVSILAKAKL
Sbjct: 410 KEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKL 469

Query: 422 FRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDI 475
           FR G  F AF FENHAETEAFGKMAKKMGY+VGGLPHYT+WHIYEPSDDD+ +I
Sbjct: 470 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/424 (66%), Positives = 341/424 (80%), Gaps = 7/424 (1%)

Query: 64  VLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQISRDDP---EFEEQMEELVSATV 120
            L D  YYDY+F     + + K+D G  +Y +T+ G+ +       +FE+++  L+ +TV
Sbjct: 89  TLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSMLLDSTV 148

Query: 121 EQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDC 180
           E+YD+  + GT N AEN+EHVL+C+PLR+A  VLP+MFKHLMN+TYPHELID+AFLVSDC
Sbjct: 149 EKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDC 208

Query: 181 SENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMV 240
           SE D TL +L+ Y+  LQ GTL+ V A  E   K  K     GG +LYL+YMDQ+YLQ V
Sbjct: 209 SEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERK----KGGENLYLQYMDQDYLQRV 264

Query: 241 RDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTAN 300
           +D+FSPP+HENY+K FRSVQ+F+KDFGQKIGQGFSDRH VKVQG+RR+LM RARNWLTAN
Sbjct: 265 KDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTAN 324

Query: 301 ALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIE 360
           ALKPYHSWVYWRD DVELCPGSVI+DLM+  YDV+VPNVWRPLP FL G+Q YDLNSWIE
Sbjct: 325 ALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIE 384

Query: 361 STDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAK 420
           S +AL+LAK L+EDDVIVEGYAEY TWR HL   R+A G+P EV++LDGVGGVSILA+A+
Sbjct: 385 SREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARAR 444

Query: 421 LFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRER 480
           LFR G HF AF FENHAETEAFGKMAKKMG++VGGLPHYTLWHIYEPSDDD+ +I  +ER
Sbjct: 445 LFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKER 504

Query: 481 ENRR 484
           E RR
Sbjct: 505 EKRR 508

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/415 (66%), Positives = 334/415 (80%), Gaps = 7/415 (1%)

Query: 65  LDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVSATVE 121
           L+D EYY+Y+F     E ++K+D G +HY +++ G       ++ E+++++  L+ +TVE
Sbjct: 114 LEDEEYYNYDFEDIDPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVE 173

Query: 122 QYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCS 181
           +YDL ++EG PNG E R+H+L+CIPLRNA  VLP+MFKHLMNLTYPHELID+AFLVSDCS
Sbjct: 174 KYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCS 233

Query: 182 ENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVR 241
           E D TL +L+ Y+  LQ GTL+ +      +I  +      G   LYLKYMD++Y+  V 
Sbjct: 234 EGDTTLDALIAYSRQLQNGTLSQIFQ----DIDAIIDSQTKGTDKLYLKYMDEDYINRVH 289

Query: 242 DAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANA 301
            AFSPP+H+NY+KPFRSVQ+F+KDFGQ IGQGFSDRH VKVQGIRR+LMGRARNWLTANA
Sbjct: 290 QAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 349

Query: 302 LKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIES 361
           LKPYHSWVYWRD DVELCPGSVIEDLMS  YDV+VPNVWRPLP FL  +Q YDLNSW+ES
Sbjct: 350 LKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMES 409

Query: 362 TDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKL 421
            +AL LAK L+EDDVIVEGYAEY TWR HL   R+A+GNP EV+DLDGVGGVSILAKAK+
Sbjct: 410 REALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKI 469

Query: 422 FRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIA 476
           FR G  F AF FENHAETEAFGKMAKKMGY+VGGLPHYT+WHIYEPSDDD+ +IA
Sbjct: 470 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/434 (63%), Positives = 350/434 (80%), Gaps = 4/434 (0%)

Query: 53  DDERAAEWEPQVLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFE 109
           +++ +  ++   L D EYY+Y+F    A+ L K++ G +HY ++  G      +D  ++E
Sbjct: 87  NNKVSTSYKTTELSDKEYYNYDFENIEADVLGKFENGVQHYLISEFGTDVLTPKDKEQYE 146

Query: 110 EQMEELVSATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHE 169
           +++  L+ A+VE+YDL+ ++G+ NGAENR+H+L+C+PLR+A  VLP+MFKHLMN+TYPHE
Sbjct: 147 KELAMLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHE 206

Query: 170 LIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYL 229
           LID+AFLVSDCS+ D TL++L++Y+ +LQ GTL+ V  ++  E +   +    G  +L+L
Sbjct: 207 LIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVF-QDMDEYQYEHSDDTRGTKNLHL 265

Query: 230 KYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRL 289
           KYM+QEYL+MV  AF+ P HENY+KPFRSVQ+F+KDFGQ IGQGFSDRH VKVQGIRR+L
Sbjct: 266 KYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKL 325

Query: 290 MGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGG 349
           MGRARNWL ANALKPYHSWVYWRD D+ELCPG+++ED+M+  YDV+VPNVWRPLPEFL  
Sbjct: 326 MGRARNWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDS 385

Query: 350 KQGYDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDG 409
           +Q YDLNSWIES +AL LAK L EDDVIVEGYAEY TWR HL   REA+G+P  V+DLDG
Sbjct: 386 EQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSVVDLDG 445

Query: 410 VGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSD 469
           VGGVSILAKAKLFR G HF AF FENHAETE FGKMAK+MGY+VGGLPHYT+WHIYEPSD
Sbjct: 446 VGGVSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSD 505

Query: 470 DDIMDIARRERENR 483
           DD+ +IA +ER++R
Sbjct: 506 DDLKEIANKERQSR 519

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/443 (65%), Positives = 347/443 (78%), Gaps = 6/443 (1%)

Query: 45  REVFVDVSDDERAAEWEPQVLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---I 101
           REV   V  +  + +   QVL++  YYDY+F     + + K+D G +HY +T+ G     
Sbjct: 69  REVMKTVGSNTSSND--GQVLEEDAYYDYDFEDIDPKVIEKFDGGVQHYLITQFGNDVLT 126

Query: 102 SRDDPEFEEQMEELVSATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHL 161
            +D   FE + + L+S+TVE YDL  + G+ NGA N EHVL+C+PLR+A  VLP+MFKHL
Sbjct: 127 PQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHL 186

Query: 162 MNLTYPHELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHG 221
           MNLTYPHELID+AFLVSDC+E+DKTL +L+ Y+  LQ GTL+ V A  +        +  
Sbjct: 187 MNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFADMDQAAAE-AEQAS 245

Query: 222 NGGGDLYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVK 281
            G   LYLKYM+ +YL+ V+++FSPP+HENY+KPFRSVQVF+KDFGQ IGQGFSDRH VK
Sbjct: 246 KGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVK 305

Query: 282 VQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWR 341
           VQGIRR+LMGRARNWLTANALKPYHSWVYWRD DVELCPGSVIEDLMS  YDV VPNVWR
Sbjct: 306 VQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWR 365

Query: 342 PLPEFLGGKQGYDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNP 401
           PLP+FL G+Q YDLNSW+ES +ALNLAK L+EDDVIVEGYAEY T+R HL   R+   +P
Sbjct: 366 PLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDP 425

Query: 402 REVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTL 461
            E++DLDGVGGVSILAKA+LFR+G  F AF FENHAETE FGKMAKKMGY+VGGLPHYTL
Sbjct: 426 NEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTL 485

Query: 462 WHIYEPSDDDIMDIARRERENRR 484
           WHIYEPSDDD+ +IA +ERE+RR
Sbjct: 486 WHIYEPSDDDLREIANKERESRR 508

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/423 (65%), Positives = 338/423 (79%), Gaps = 4/423 (0%)

Query: 65  LDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVSATVE 121
           L + EYY+Y+F       + K+D+G +HY ++  G      +D   +E ++++L  +TV+
Sbjct: 89  LQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQLFDSTVQ 148

Query: 122 QYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCS 181
           +YDL  + G+P+G  NR+HVLIC+PLR+A  VLP+MFKHLMNLTYPHELIDVAFLVSDCS
Sbjct: 149 RYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSDCS 208

Query: 182 ENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVR 241
           ++D TL++L+ Y+  LQ GTL+ +    +A    L AK       LYLKYM QEYL  V 
Sbjct: 209 DDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAK-DRKNNKLYLKYMKQEYLNKVE 267

Query: 242 DAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANA 301
            AF+PPYHENY+KPFRSVQ+F+K+FGQ IGQGFSDRH VKVQGIRR+LMGR+RNWLTANA
Sbjct: 268 KAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTANA 327

Query: 302 LKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIES 361
           LKPYHSWVYWRD D+ELCPGSVI+D+M+  YDV+VPNVWRPLPEFL G+Q YDLNSW+ES
Sbjct: 328 LKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWMES 387

Query: 362 TDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKL 421
            +AL LA+ L+EDDVIVEGYAEY TWR HL   R+ +G+P EV+DLDGVGGVSILA+AKL
Sbjct: 388 PEALELAETLDEDDVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAKL 447

Query: 422 FRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRERE 481
           FR G  F AF FENHAETEAFGKMA+K+G++VGGLPHYTLWHIYEPSDDD+ +IA +ERE
Sbjct: 448 FRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKERE 507

Query: 482 NRR 484
            RR
Sbjct: 508 KRR 510

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/434 (62%), Positives = 344/434 (79%), Gaps = 4/434 (0%)

Query: 54  DERAAEWEPQVLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEE 110
           + + A ++ + L + EYYD++F       + K+D G +HY +++ G       D+  + +
Sbjct: 90  NTKTASYKTKQLTENEYYDHDFEDIEPAVVKKFDNGVQHYLISQYGTDVLTPSDNEVYAK 149

Query: 111 QMEELVSATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHEL 170
           +++ ++ A+VE+YDL  + G+ NGA NR+H+L+C+PLR+A  VLP+MFKHLMNLTYPHEL
Sbjct: 150 ELQMVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHEL 209

Query: 171 IDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLK 230
           ID+AFLVSDCSE D+TL +L+ Y+ +LQ GTL+ V   E  + +   +K   G  +L+LK
Sbjct: 210 IDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFT-EMDQYEMDHSKKSKGTKNLHLK 268

Query: 231 YMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLM 290
           YM+ +YL++V  +F    H NY+KPFRS+QVF+KDFGQ IGQGFSDRH VKVQGIRR+LM
Sbjct: 269 YMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLM 328

Query: 291 GRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGK 350
           GRARNWL ANALKPYH+WVYWRD D+ELCPGSVIEDLMS  YDVIVPNVWRPLPEFL G+
Sbjct: 329 GRARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGE 388

Query: 351 QGYDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGV 410
           Q YDLNSWIES +AL LAK L+EDDVIVEGYAEY TWR HL   R+A G+P EV+DLDGV
Sbjct: 389 QPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGV 448

Query: 411 GGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDD 470
           GGVSILAKAK+FR G  F AF FENHAETEAFGKMA+KMG++VGGLPHYT+WHIYEPSDD
Sbjct: 449 GGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDD 508

Query: 471 DIMDIARRERENRR 484
           D+M+IA +ER+N+R
Sbjct: 509 DLMEIANKERQNKR 522

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/419 (66%), Positives = 331/419 (78%), Gaps = 4/419 (0%)

Query: 65  LDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVSATVE 121
           L+D EYYDY+F +        +D+G +HY +T+ G     S+D   + ++ME L+S++V+
Sbjct: 97  LEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVD 156

Query: 122 QYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCS 181
           +YDL  +EGT NGAENREH+L   PLR+A  VLPMMFKHLMNLTYPHELID+AFLVSDCS
Sbjct: 157 KYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCS 216

Query: 182 ENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVR 241
           E DKTL +L+ +A +LQ GTL ++    +A I + + K+ N     YLK+MDQ Y++M  
Sbjct: 217 EGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKH-YLKFMDQNYIKMAD 275

Query: 242 DAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANA 301
            +F+ P+H  Y KPFRSVQ+F+KDFGQ IGQGFSDRH VKVQGIRR+LMGRARNWLTANA
Sbjct: 276 ASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 335

Query: 302 LKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIES 361
           LKPYHSWVYWRD DVELCPGSVI+DLMS  YDVIVPNVWRPLPEFL  +Q YDLNSW+ES
Sbjct: 336 LKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMES 395

Query: 362 TDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKL 421
            +AL LAK L+EDDVIVEGYAEY TWR HL   R+  G+P + +D+DGVGGVSILAKAKL
Sbjct: 396 GEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKL 455

Query: 422 FRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRER 480
           FR G HF AF FENHAETEAFGKMAKKMGY VGGLP+Y LWHIYEPSDDD+ D+A  ER
Sbjct: 456 FRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/430 (64%), Positives = 344/430 (80%), Gaps = 9/430 (2%)

Query: 60  WEPQVLDDPEYYDYEFAAASAERLAKYDEGFEHYFV----TRD-GQISRDDPE-FEEQME 113
           ++ QVL  PEYY+Y+F   + + ++KYD+G   Y +    T D  Q+S    E ++ ++ 
Sbjct: 94  FDTQVLTAPEYYNYDFHDYNLDTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELP 153

Query: 114 ELVSATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDV 173
           +L+S++V+ YD++++ GT +G  +REHVL+CIPLR+A  VLP+MFK+LMNLTYPHELIDV
Sbjct: 154 KLLSSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDV 213

Query: 174 AFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGD--LYLKY 231
           AFLVSDCSEND TL+SL++Y  +LQ GTL +V   E  ++  +  K      D  LYLKY
Sbjct: 214 AFLVSDCSENDHTLESLLQYTRFLQNGTLPDVF-EEMDKLDEMTDKVVENADDSKLYLKY 272

Query: 232 MDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMG 291
           M +EYLQ V++AF  P+HENY+KPFRS+Q++KKDFGQ +GQ FSDRH VKVQGIRR+LMG
Sbjct: 273 MKKEYLQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMG 332

Query: 292 RARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQ 351
           RARNWL  NALKPYHSWVYWRD DVELCPG+VIEDLMS  +DVIVPNVWRPLPEF+  +Q
Sbjct: 333 RARNWLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQ 392

Query: 352 GYDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVG 411
            YDLNSW+ES +A++LAKKL ED+VIVEGYAEY TWR HL   RE  G+P +V+D+DGVG
Sbjct: 393 PYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKDGDPNQVVDVDGVG 452

Query: 412 GVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDD 471
           GVSILA+A+LFR G HF AF FENHAETEAFGKMAKKMG++VGGLPHYTLWHIYEPSDDD
Sbjct: 453 GVSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDD 512

Query: 472 IMDIARRERE 481
           +M IA +E+E
Sbjct: 513 LMAIATKEKE 522

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/425 (61%), Positives = 332/425 (78%), Gaps = 9/425 (2%)

Query: 59  EWEPQVLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEEL 115
           E+ P    D  Y+ ++F     + ++K+D+G  +Y ++  G       D  E+ + ++ L
Sbjct: 92  EYLPFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQML 151

Query: 116 VSATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAF 175
           + +TVE+YDL N++G+ +G E +EH+L+C+PLR+A  VLP+MFK+LMNLTYPHELID+AF
Sbjct: 152 LDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAF 211

Query: 176 LVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQE 235
           LVSDCSE DKTL++L  Y+  LQ+G L ++LA  +   K      G     ++LKYM+ +
Sbjct: 212 LVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNK------GKSNESIHLKYMEPD 265

Query: 236 YLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARN 295
           YL+ V+ A+ PP+H NY KPFRSVQ+F+KDFGQ IGQGFSDRH VKVQGIRR+LMGRARN
Sbjct: 266 YLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARN 325

Query: 296 WLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDL 355
           WL +NALKPYHSWVYWRD DVELCPGSVIEDLM   YDVIVPNVWRPLP+FL   Q YDL
Sbjct: 326 WLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDL 385

Query: 356 NSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSI 415
           NSW+ES +AL LAK L+EDDVIVEGYAEY T+R HL   RE  G+P +V+DLDGVGGVSI
Sbjct: 386 NSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSI 445

Query: 416 LAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDI 475
           LA+A++FR+G HF+AF FENHAETEAFGKMAKK+G++VGGLPHYTLWHIYEPSDDD++ +
Sbjct: 446 LARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAM 505

Query: 476 ARRER 480
           A+ E+
Sbjct: 506 AKLEK 510

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/340 (73%), Positives = 287/340 (84%), Gaps = 3/340 (0%)

Query: 145 IPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNN 204
           +PLRNA  VLP+MFK+LMNLTYPHELID+AFLVSDCSE+D+T ++L+EYA  LQ GTL+ 
Sbjct: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61

Query: 205 VLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKK 264
           V A   +    L+ +   G  DL+LKYM   YL+MV+DAF+PP+H+NY+KPFRSVQ+F+K
Sbjct: 62  VFASHNSGENVLREE---GSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQK 118

Query: 265 DFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVI 324
           +FGQ IGQ FSDRH VKVQG RR+LMGRARNWLTANALKPYHSWVYWRD DVELCPGSVI
Sbjct: 119 NFGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVI 178

Query: 325 EDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIESTDALNLAKKLEEDDVIVEGYAEY 384
           EDLM+ GYDV VPNVWRPLPEFL G+Q YDLNSW+ES  AL+LAK+L+EDDVIVEGYAEY
Sbjct: 179 EDLMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEY 238

Query: 385 ATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGK 444
            TWR HL   RE  G+P+  IDLDGVGGVSILAKA+LFR G HF AF FENHAETEAFGK
Sbjct: 239 PTWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGK 298

Query: 445 MAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRERENRR 484
           MAKKMGY V GLPHYTLWHIYEPSDDD++ +  RERE++R
Sbjct: 299 MAKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKR 338

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  372 bits (955), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 189/366 (51%), Positives = 239/366 (65%), Gaps = 51/366 (13%)

Query: 119 TVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVS 178
            V+ YDLRNY+G  +G +  +HVL  +PLR+A   LPM F H+  ++YPH LID++FLVS
Sbjct: 52  NVQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVS 111

Query: 179 DCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQ 238
           D S  D T+  L+EY   LQK                                       
Sbjct: 112 DSS--DDTMGVLLEY---LQK--------------------------------------- 127

Query: 239 MVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLT 298
               A S P   +  + F ++++++KDFGQ IGQ FSDRH    QG RR+LMGRARNWL 
Sbjct: 128 ----AQSKP---DRTQRFGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLG 180

Query: 299 ANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSW 358
           + ALKPYHSWVYWRDVDVE  P +++EDLM    DVIVPNVWRPLP++LG  Q YDLNSW
Sbjct: 181 SVALKPYHSWVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSW 240

Query: 359 IESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAK 418
            ES   L LA+ L+ED VIVEGY EYATWR HL   R+  G+P + ++LDG+GGVSIL+K
Sbjct: 241 QESEGGLQLAESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELDGIGGVSILSK 300

Query: 419 AKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARR 478
           AK+FR G+HF AF+FE HAETEAFGK+++++GY V GLPHY +WHIYEPS DD+  +A  
Sbjct: 301 AKVFRAGSHFPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPSSDDLKHMAWM 360

Query: 479 ERENRR 484
             E +R
Sbjct: 361 AEEEKR 366

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  369 bits (948), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 185/365 (50%), Positives = 232/365 (63%), Gaps = 53/365 (14%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           VE YDL +Y G P+G +  + +L C+PLR+A   LPM F HL  +TYPH LID++FLVSD
Sbjct: 54  VEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVSD 113

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQM 239
            S+N  T+  LM +    QK                                        
Sbjct: 114 SSDN--TMGVLMHHLQQAQK---------------------------------------- 131

Query: 240 VRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTA 299
                      +  K F ++++F+KDFGQ IGQ FSDRH    QG RR+LM RARNWL +
Sbjct: 132 -----------DKNKRFGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGS 180

Query: 300 NALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWI 359
            A+KPYHSWVYWRDVDVE+ P S++EDLM    DVIVPNVWRPLP++LG  Q YDLNSW+
Sbjct: 181 VAIKPYHSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWV 240

Query: 360 ESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKA 419
           ES   L LA  L ED VIVEGY EYATWR HL   R+  GNP + + LDG+GGVSIL+KA
Sbjct: 241 ESEGGLQLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILSKA 300

Query: 420 KLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRE 479
           ++FR G+HF AF+F+ HAETEAFGK++++MG+ V GLPHY +WHIYEPS DD+  +A   
Sbjct: 301 RVFRAGSHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDLKYMAWMA 360

Query: 480 RENRR 484
            E +R
Sbjct: 361 EEEKR 365

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  370 bits (950), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 185/365 (50%), Positives = 235/365 (64%), Gaps = 51/365 (13%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           VE YDLRNY+G  +G +  + VL  +PLR+A   LPM F H+  ++YPH LID++FLVSD
Sbjct: 53  VEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVSD 112

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQM 239
            S  D T+  L+++    Q  T                                      
Sbjct: 113 SS--DDTMGVLLDHLKKAQSKT-------------------------------------- 132

Query: 240 VRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTA 299
                      + +K F ++++F+KDFGQ IGQ FSDRH    QG RR+LMGRARNWL +
Sbjct: 133 -----------DRKKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGS 181

Query: 300 NALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWI 359
            ALKPYHSWVYWRDVDVE  P +++EDLM    DVIVPNVWRPLP++LG  Q YDLNSW 
Sbjct: 182 VALKPYHSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQ 241

Query: 360 ESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKA 419
           ES   + LA+ L+ED VIVEGY EYATWR HL   R+  GNP + ++LDG+GGVSIL+KA
Sbjct: 242 ESEGGMQLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELDGIGGVSILSKA 301

Query: 420 KLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRE 479
           K+FR G+HF AF+FE HAETEAFGK+++++GY V GLPHY +WHIYEPS DD+  +A   
Sbjct: 302 KVFRAGSHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPSSDDLKHMAWMA 361

Query: 480 RENRR 484
            E +R
Sbjct: 362 EEEKR 366

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  371 bits (952), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 185/360 (51%), Positives = 234/360 (65%), Gaps = 51/360 (14%)

Query: 117 SATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFL 176
           + +VE YDLRNY+G  +G +  + +L C+PLR+A   LPM F HL  +TYPH LID++FL
Sbjct: 59  TPSVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFL 118

Query: 177 VSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEY 236
           VSD S+N                 T+  +L+                             
Sbjct: 119 VSDSSDN-----------------TMGVLLSN---------------------------- 133

Query: 237 LQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNW 296
           LQM +        ++  K F ++++++KDFGQ IGQ FSDRH    QG RR+LM RARNW
Sbjct: 134 LQMAQS------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNW 187

Query: 297 LTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLN 356
           L + ALKPYHSWVYWRDVDVE  P +++EDLM    DVIVPNVWRPLP++LG  Q YDLN
Sbjct: 188 LGSVALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLN 247

Query: 357 SWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSIL 416
           SW ES   L LA  L+ED VIVEGY EYATWR HL   R+  GNP + ++LDG+GGVSIL
Sbjct: 248 SWKESEGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSIL 307

Query: 417 AKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIA 476
           AKAK+FR G+HF AF+FE HAETEAFG+++++M Y V GLPHY +WHIYEPS DD+  +A
Sbjct: 308 AKAKVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  370 bits (950), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 184/360 (51%), Positives = 232/360 (64%), Gaps = 51/360 (14%)

Query: 117 SATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFL 176
           +  VE YDLRNY+G  +G +  + +L C+PLR+A   LPM F HL  +TYPH LID++FL
Sbjct: 59  TPDVEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFL 118

Query: 177 VSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEY 236
           VSD S+N                G L + L + +++                        
Sbjct: 119 VSDSSDN--------------TMGVLLSNLHKAQSQ------------------------ 140

Query: 237 LQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNW 296
                        ++  K F ++++++KDFGQ IGQ FSDRH    QG RR+LM RARNW
Sbjct: 141 -------------QDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNW 187

Query: 297 LTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLN 356
           L + ALKPYHSWVYWRDVDVE  P +++EDLM    DVIVPNVWRPLP++LG  Q YDLN
Sbjct: 188 LGSVALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLN 247

Query: 357 SWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSIL 416
           SW ES   L LA  LEED VIVEGY EYATWR HL   R+  GNP + ++LDG+GGVSIL
Sbjct: 248 SWKESEGGLQLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSIL 307

Query: 417 AKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIA 476
           AKAK+FR G+HF AF+FE HAETEAFG+++++M Y V GLPHY +WHIYEPS DD+  +A
Sbjct: 308 AKAKVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  368 bits (944), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 185/365 (50%), Positives = 233/365 (63%), Gaps = 51/365 (13%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           VE YDL NY+G  +G +  + VL C+PLR+A   LPM FKH+  ++YPH LID++FLVSD
Sbjct: 82  VEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFFKHMDEISYPHNLIDLSFLVSD 141

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQM 239
            S  D T+  L+   + L+K   N                                    
Sbjct: 142 SS--DDTMGVLL---SSLKKAQSN------------------------------------ 160

Query: 240 VRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTA 299
                     ++  + F ++++F+KDFGQ IGQ FSDRH    QG RR+LM RARNWL +
Sbjct: 161 ----------QDKSQRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGS 210

Query: 300 NALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWI 359
            ALKPYHSWVYWRDVDVE  P +++EDLM    DVIVPNVWRPLP++LG  Q YDLNSW 
Sbjct: 211 VALKPYHSWVYWRDVDVETIPRTILEDLMHHNKDVIVPNVWRPLPDWLGNIQPYDLNSWK 270

Query: 360 ESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKA 419
           ES   L LA  LEED VIVEGY EYATWR HL   R+  G+P   ++LDG+GGVSIL+KA
Sbjct: 271 ESEGGLQLADSLEEDAVIVEGYPEYATWRTHLAYMRDPSGDPEAEMELDGIGGVSILSKA 330

Query: 420 KLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRE 479
           K+FR G+HF AF+FE HAETEAFGK++++M Y V GLPHY +WH+YEPS DD+  +A   
Sbjct: 331 KVFRTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMA 390

Query: 480 RENRR 484
            E +R
Sbjct: 391 EEEKR 395

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  368 bits (945), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 184/360 (51%), Positives = 234/360 (65%), Gaps = 51/360 (14%)

Query: 117 SATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFL 176
           +  VE YDLRNY+G  +G +  + +L C+PLR+A   LPM F HL  ++YPH LID++FL
Sbjct: 59  TPGVEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYPHNLIDLSFL 118

Query: 177 VSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEY 236
           VSD S+N                 T+  +L++                            
Sbjct: 119 VSDSSDN-----------------TMGVLLSK---------------------------- 133

Query: 237 LQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNW 296
           LQM +        ++  K F ++++++KDFGQ IGQ FSDRH    QG RR+LM RARNW
Sbjct: 134 LQMAQS------QQDKTKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNW 187

Query: 297 LTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLN 356
           L + ALKPYHSWVYWRDVDVE  P +++EDLM    DVIVPNVWRPLP++LG  Q YDLN
Sbjct: 188 LGSVALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLN 247

Query: 357 SWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSIL 416
           SW ES   L LA  L+ED VIVEGY EYATWR HL   R+  GNP + ++LDG+GGVSIL
Sbjct: 248 SWKESEGGLQLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSIL 307

Query: 417 AKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIA 476
           AKAK+FR G+HF AF+FE HAETEAFG+++++M Y V GLPHY +WHIYEPS DD+  +A
Sbjct: 308 AKAKVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  365 bits (937), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 181/365 (49%), Positives = 235/365 (64%), Gaps = 51/365 (13%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           V+ YDL NY+G  +G +  + VL C+PLR+A   LPM FKHL ++TYPH LID++FLVSD
Sbjct: 50  VDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVSD 109

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQM 239
            +  D T+  L+         +L+++ ++ +                             
Sbjct: 110 ST--DDTMGVLL--------NSLHDLQSQADGT--------------------------- 132

Query: 240 VRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTA 299
                         K F  +++F+KDFGQ IGQ FSDRH    QG RR+LM RARNWL +
Sbjct: 133 --------------KRFGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGS 178

Query: 300 NALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWI 359
            A+KPYHSWVYWRDVDVE  P +++EDLM    D+IVPNVWRPLP++L   Q YDLNSW+
Sbjct: 179 AAIKPYHSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLNYIQPYDLNSWV 238

Query: 360 ESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKA 419
           ES   L LA  L+EDDVIVEGY EYATWR HL   R+  G+P   ++LDG+GGVSIL+KA
Sbjct: 239 ESEGGLQLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSKA 298

Query: 420 KLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRE 479
           K+FR G+HF AF+FE HAETEAFGK++++M Y V GLPHY +WH+YEPS DD+  +A   
Sbjct: 299 KVFRTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMA 358

Query: 480 RENRR 484
            E +R
Sbjct: 359 EEEQR 363

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  365 bits (937), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 186/365 (50%), Positives = 235/365 (64%), Gaps = 51/365 (13%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           VE YDLRNY+G  +G +  + +L C+PLR+A   LPM F+HL  +TYPH  ID++FLVSD
Sbjct: 62  VEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVSD 121

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQM 239
            S  D T+  L+   ++LQ                                 MD+     
Sbjct: 122 SS--DDTMGVLL---SHLQSAQ----------------------------SQMDKS---- 144

Query: 240 VRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTA 299
                         K F ++++++KDFGQ IGQ FSDRH    QG RR+LM RARNWL +
Sbjct: 145 --------------KRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGS 190

Query: 300 NALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWI 359
            ALKPYHSWVYWRDVDVE  P +++EDLM    DVIVPNVWRPLP++LG  Q YDLNSW 
Sbjct: 191 VALKPYHSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQ 250

Query: 360 ESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKA 419
           ES   L LA+ LEED VIVEGY EYATWR HL   R+  G+P E ++LDG+GGVSIL+KA
Sbjct: 251 ESEGGLQLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKA 310

Query: 420 KLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRE 479
           K+FR G+HF AF+FE HAETEAFG+++++M Y V GLPHY +WHIYEPS +D+  +A   
Sbjct: 311 KVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMA 370

Query: 480 RENRR 484
            E +R
Sbjct: 371 EEEKR 375

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  366 bits (940), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 181/360 (50%), Positives = 231/360 (64%), Gaps = 51/360 (14%)

Query: 117 SATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFL 176
           +  VE YDLRNY+G  +G +  + +L C+PLR+A   LPM F HL  ++YPH LID++FL
Sbjct: 59  TPDVEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYPHNLIDLSFL 118

Query: 177 VSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEY 236
           VSD S+N                G L + L   +++                        
Sbjct: 119 VSDSSDN--------------TMGVLLSSLQTAQSQ------------------------ 140

Query: 237 LQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNW 296
                        ++  K F ++++++KDFGQ IGQ FSDRH    QG RR+LM RARNW
Sbjct: 141 -------------QDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNW 187

Query: 297 LTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLN 356
           L + ALKPYHSWVYWRDVDV+  P +++EDLM    DVIVPNVWRPLP++LG  Q YDLN
Sbjct: 188 LGSVALKPYHSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLN 247

Query: 357 SWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSIL 416
           SW ES   L LA  L+ED VIVEGY EYATWR HL   R+  GNP + ++LDG+GGVSIL
Sbjct: 248 SWKESEGGLQLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSIL 307

Query: 417 AKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIA 476
           AKAK+FR G+HF AF+FE HAETEAFG+++++M Y V GLPHY +WHIYEPS DD+  +A
Sbjct: 308 AKAKVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  364 bits (935), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 185/367 (50%), Positives = 232/367 (63%), Gaps = 51/367 (13%)

Query: 118 ATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLV 177
           A  E YDL+NY G  NG +  + +L C+PLR+A   LPM FKHL  +TYPH L+D++FLV
Sbjct: 65  ANTEFYDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLV 124

Query: 178 SDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYL 237
           SD    D T+            G L + L   +++  R                      
Sbjct: 125 SDS--KDDTM------------GVLLSNLQTAQSQKDR---------------------- 148

Query: 238 QMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWL 297
                           K F +++ F+KDFGQ IGQ FSDRH    QG RR+LM RARNWL
Sbjct: 149 ---------------SKRFGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWL 193

Query: 298 TANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNS 357
            + A+KPYHSWVYWRDVDVE  P +++EDLM  G DVIVPNVWRPLPE+LG  Q YDLNS
Sbjct: 194 GSVAIKPYHSWVYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLNS 253

Query: 358 WIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILA 417
           W ES   L LA  L++D VIVEGY EYATWR HL   R+  G+P   ++LDG+GGVSIL+
Sbjct: 254 WQESDAGLELADSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILS 313

Query: 418 KAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIAR 477
           KA++FR G+HF AF+FE HAETEAFGK++++MGY V GLPHY +WHIYEPS +D+  +A 
Sbjct: 314 KARVFRSGSHFPAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDLKHMAW 373

Query: 478 RERENRR 484
              E +R
Sbjct: 374 MAEEEQR 380

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  365 bits (937), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 183/365 (50%), Positives = 232/365 (63%), Gaps = 51/365 (13%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           VE YDL NY+G  +G +  + +L C+PLR+A   LPM F HL  +TYPH LID++FLVSD
Sbjct: 82  VEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVSD 141

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQM 239
            S+N                G L + L   +++  R                        
Sbjct: 142 SSDN--------------TMGVLLSNLQNAQSQQDR------------------------ 163

Query: 240 VRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTA 299
                         K F ++++F+KDFGQ IGQ FSDRH  K QG RR+LM RARNWL +
Sbjct: 164 -------------SKRFGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRKLMARARNWLGS 210

Query: 300 NALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWI 359
            A+KPYHSWVYWRDVDVE  P +++EDLM    DVIVPNVWRPLP++LG  Q YDLNSW 
Sbjct: 211 VAIKPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQ 270

Query: 360 ESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKA 419
           ES   L LA  L+ED VIVEGY EYATWR HL   R+  GNP + ++L+G+GGVSIL+KA
Sbjct: 271 ESEGGLQLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELNGIGGVSILSKA 330

Query: 420 KLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRE 479
           K+FR G+HF AF+FE HAETEAFGK++++M + V GLPHY +WHIYEPS +D+  +A   
Sbjct: 331 KVFRSGSHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPSKEDLKHMAWMA 390

Query: 480 RENRR 484
            E +R
Sbjct: 391 EEEKR 395

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  362 bits (930), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 182/365 (49%), Positives = 234/365 (64%), Gaps = 51/365 (13%)

Query: 119 TVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVS 178
           +VE YD+ NY+G  +G      +LIC+PL++A   LP+ FK L  +TYPHELID++FLVS
Sbjct: 54  SVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTLEKMTYPHELIDLSFLVS 113

Query: 179 DCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQ 238
           D S+N                 T+ N+L      +KRL+   G  G              
Sbjct: 114 DSSDN-----------------TMYNLLNM----LKRLQIDGGTSGK------------- 139

Query: 239 MVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLT 298
                            F ++++++KDFGQ IGQGFSDRH    QG RR+LMG+ARNWL 
Sbjct: 140 -----------------FGNIEIYEKDFGQVIGQGFSDRHGFAAQGPRRKLMGKARNWLN 182

Query: 299 ANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSW 358
             A+KPYHSWVYWRDVDVE+ P +++EDLM    DVIVPNVWRPLP++LG  Q YDLNSW
Sbjct: 183 TVAIKPYHSWVYWRDVDVEIIPETILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSW 242

Query: 359 IESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAK 418
            ES   L L+  L ED VIVEGY EYATWR HL   R+  G+P   ++LDGVGGVSIL+K
Sbjct: 243 KESEAGLALSNSLGEDAVIVEGYPEYATWRSHLAYMRDPNGDPEREMELDGVGGVSILSK 302

Query: 419 AKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARR 478
           A +FR G+HF AF+F+ HAETEAFGK++K M + V GLP+Y +WHIYEPS +D+  +A+ 
Sbjct: 303 ANVFRSGSHFPAFSFKKHAETEAFGKLSKHMNFTVIGLPNYVVWHIYEPSKEDLQYMAKL 362

Query: 479 ERENR 483
           E + R
Sbjct: 363 EEKER 367

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  365 bits (938), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 183/365 (50%), Positives = 228/365 (62%), Gaps = 51/365 (13%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           V  YDL NY G  +G +  + +L C+PLR+A   LP  F HL  +TYPH LID++FLVSD
Sbjct: 72  VHFYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFLVSD 131

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQM 239
               D T+  L+ +    Q                                         
Sbjct: 132 SK--DDTMGVLLSHLQTAQS---------------------------------------- 149

Query: 240 VRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTA 299
                     +N  K F ++++++KDFGQ IGQ FSDRH    QG RR+LM RARNWL +
Sbjct: 150 ---------QQNKLKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGS 200

Query: 300 NALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWI 359
            ALKPYHSWVYWRDVDVE CP +++EDLM  G DVIVPNVWRPLP++LG  Q YDLNSW 
Sbjct: 201 VALKPYHSWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDLNSWQ 260

Query: 360 ESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKA 419
           ES   L LA  L+ED VIVEGY EYATWR HL   R+  G+P E ++LDG+GGVSIL+KA
Sbjct: 261 ESEGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKA 320

Query: 420 KLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRE 479
           K+FR G+HF AF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +D+  +A   
Sbjct: 321 KVFRSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMAWMA 380

Query: 480 RENRR 484
            E +R
Sbjct: 381 EEEKR 385

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  363 bits (932), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 228/357 (63%), Gaps = 51/357 (14%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           VE YDL NY+G  +G +  + +L C+PLR+A   LPM F HL  ++YPH  ID++FLVSD
Sbjct: 87  VEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFLVSD 146

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQM 239
            S  D T+  L+          L N  ++++                             
Sbjct: 147 SS--DDTMGVLLS--------NLQNAQSQQDKS--------------------------- 169

Query: 240 VRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTA 299
                         K F ++++F+KDFGQ IGQ FSDRH    QG RR+LM RARNWL +
Sbjct: 170 --------------KRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGS 215

Query: 300 NALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWI 359
            A+KPYHSWVYWRDVDVE  P +++EDLM    DVIVPNVWRPLP++LG  Q YDLNSW 
Sbjct: 216 VAIKPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWK 275

Query: 360 ESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKA 419
           ES   L LA  L EDDVIVEGY EYATWR HL   R+  GNP + ++LDG+GGVSILAKA
Sbjct: 276 ESEGGLQLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILAKA 335

Query: 420 KLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIA 476
           K+FR G+HF AF+FE HAETEAFGK+++KM Y V GLPHY +WHIYEPS +D+  +A
Sbjct: 336 KVFRTGSHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDLKHMA 392

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  357 bits (915), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 180/365 (49%), Positives = 231/365 (63%), Gaps = 51/365 (13%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           VE YDL NY+G  NG +  + V+ C+PLR+A   L M F  L  LTYPH LID++FLVSD
Sbjct: 57  VEYYDLINYQGNANGWQTGDRVVFCVPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVSD 116

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQM 239
            S  D T+++L+   ++L++   N   +R                               
Sbjct: 117 SS--DDTMKTLL---SHLRRAQSNQDKSRR------------------------------ 141

Query: 240 VRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTA 299
                           F ++++F+KDFGQ +GQ FSDRH    QG RR+ M RARNWL +
Sbjct: 142 ----------------FANIEIFEKDFGQSVGQSFSDRHGFAAQGPRRKSMARARNWLGS 185

Query: 300 NALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWI 359
            ALKPYHS+VYWRDVDV+  P +++EDLM    DVIVPNVWRPLP++LG  Q YDLNSW+
Sbjct: 186 AALKPYHSYVYWRDVDVQTIPNTILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWV 245

Query: 360 ESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKA 419
           ES   L LA  L+ED  IVEGY EYATWR HL   R+  G+P   ++LDG+GGVSIL+KA
Sbjct: 246 ESEGGLQLADSLDEDACIVEGYPEYATWRTHLAYMRDPSGDPEVEMELDGIGGVSILSKA 305

Query: 420 KLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRE 479
           K+FR G+HF AF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS DD+  +A   
Sbjct: 306 KVFRTGSHFPAFSFEKHAETEAFGKLSRRMQYSVVGLPHYVIWHIYEPSSDDLKHMAWMA 365

Query: 480 RENRR 484
            E +R
Sbjct: 366 EEEKR 370

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  362 bits (928), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 177/357 (49%), Positives = 231/357 (64%), Gaps = 51/357 (14%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           VE YDL NY+G  +G +  + +L CIPLR+A   LPM F H+  +TYPH L+D++FLVSD
Sbjct: 66  VEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYPHNLVDLSFLVSD 125

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQM 239
            S  D T+  L+ +                                           LQ 
Sbjct: 126 SS--DDTMGVLLSH-------------------------------------------LQT 140

Query: 240 VRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTA 299
           V+        ++  K F ++++++KDFGQ IGQ FSDRH    QG RR+LM +ARNWL +
Sbjct: 141 VQS------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMAKARNWLGS 194

Query: 300 NALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWI 359
            ALKPYHSWVYWRDVD+E  P +++EDLM    D+IVPNVWRPLP++LG  Q YDLNSW 
Sbjct: 195 VALKPYHSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQ 254

Query: 360 ESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKA 419
           ES   L LA +L+E+ VIVEGY EYATWR HL   R+  G+P + ++LDG+GGVSIL+KA
Sbjct: 255 ESEGGLQLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELDGIGGVSILSKA 314

Query: 420 KLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIA 476
           K+FR G+HF AF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +D+  +A
Sbjct: 315 KVFRSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMA 371

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  355 bits (911), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 182/366 (49%), Positives = 227/366 (62%), Gaps = 52/366 (14%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           VE YDLRNY+G  +G +    +L  +PLR+A   LP  F H+  L+YPH LID++FLVSD
Sbjct: 57  VEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVSD 116

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQM 239
            S  D T+  L+ +    Q     N                                   
Sbjct: 117 SS--DDTMGELLHHLQIAQSQKDRN----------------------------------- 139

Query: 240 VRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTA 299
                         K F ++++F+KDFGQ IGQ FSDRH    QG RR+LM RARNWL +
Sbjct: 140 --------------KRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGS 185

Query: 300 NALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWI 359
             LKPYHSWVYWRDVDVE+ P S++EDLM    DVIVPNVWRPLP++LG  Q YDLNSW 
Sbjct: 186 VTLKPYHSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWK 245

Query: 360 ESTDALNLAKKL-EEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAK 418
           ES   + LA  L +ED VIVEGY E+ATWR HL   R+  GNP + ++LDG+GGVSILAK
Sbjct: 246 ESEAGIQLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSILAK 305

Query: 419 AKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARR 478
           AK+FR G+HF AF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +D+  +A  
Sbjct: 306 AKVFRTGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWM 365

Query: 479 ERENRR 484
             E +R
Sbjct: 366 AEEEKR 371

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  358 bits (919), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 179/356 (50%), Positives = 231/356 (64%), Gaps = 51/356 (14%)

Query: 117 SATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFL 176
           +  VE YDLRNY+G  +G +  + ++ C+PLR+A   LP  F HL  ++YPH LID++FL
Sbjct: 62  TPNVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFL 121

Query: 177 VSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEY 236
           VSD S  D T+  L           L+N+   + A+ +R K+K                 
Sbjct: 122 VSDSS--DDTMGVL-----------LSNL---QTAQSQRDKSKR---------------- 149

Query: 237 LQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNW 296
                              F ++++++KDFGQ IGQ FSDRH    QG RR+LM RARNW
Sbjct: 150 -------------------FGNIEIYEKDFGQVIGQSFSDRHGFAGQGPRRKLMARARNW 190

Query: 297 LTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLN 356
           L + ALKPYHSWVYWRDVD+E  P +++EDLM    D+IVPNVWRPLP++LG  Q YDLN
Sbjct: 191 LGSVALKPYHSWVYWRDVDIETAPRTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLN 250

Query: 357 SWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSIL 416
           SW ES   L LA +L ED VIVEGY EYATWR HL   R+  G+P   ++LDG+GGVSIL
Sbjct: 251 SWQESEGGLQLANQLNEDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSIL 310

Query: 417 AKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDI 472
           +KA +FR G+HF AF+FE HAETEAFGK++++MGY V GLPHY +WHIYEPS +D+
Sbjct: 311 SKANVFRSGSHFPAFSFEKHAETEAFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDL 366

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  359 bits (921), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 181/359 (50%), Positives = 228/359 (63%), Gaps = 52/359 (14%)

Query: 119 TVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVS 178
            VE YDLRNY+G P+G +    +L  +PLR+A   LP  F H+  +TYPH LID +FLVS
Sbjct: 62  NVEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVS 121

Query: 179 DCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQ 238
           D S  D T+ +L+   ++L+K   N    R                              
Sbjct: 122 DSS--DDTMGALL---SHLEKAQSNKDKTRR----------------------------- 147

Query: 239 MVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLT 298
                            F ++++++KDFGQ IGQ FSDRH    QG RR+LM RARNWL 
Sbjct: 148 -----------------FGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRKLMARARNWLG 190

Query: 299 ANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSW 358
             ALK YHSWVYWRDVDVELCP S++EDLM    DVIVPNVWRPLP++LG  Q YDLNSW
Sbjct: 191 TVALKAYHSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSW 250

Query: 359 IESTDALNLAKKLEEDD-VIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILA 417
            ES   + LA  L +DD VIVEGY +Y+TWR HL   R+  GNP + ++LDG+GGVSIL+
Sbjct: 251 KESEVGVQLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELELDGIGGVSILS 310

Query: 418 KAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIA 476
           K K+FR G+HF AF+FE HAETEAFGK++++MGY V GLPHY +WHIYEPS +D+  +A
Sbjct: 311 KGKVFRTGSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEPSTEDLQHMA 369

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  352 bits (903), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 181/366 (49%), Positives = 227/366 (62%), Gaps = 52/366 (14%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           VE +DL    G  +G    + VL C+PLR+A   LPM FKHL  +TYPH L+D++FLVSD
Sbjct: 42  VEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVSD 101

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQM 239
               D+T+  L ++   LQ    N   AR+                              
Sbjct: 102 S--KDETMSVLRQHVRELQSQPDN---ARQ------------------------------ 126

Query: 240 VRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTA 299
                           F ++++F+KDFGQ IGQ FSDRH    QG RR+LM RARNWL +
Sbjct: 127 ----------------FGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGS 170

Query: 300 NALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWI 359
            ALKPYHSWVYWRDVDVE  P ++IEDLM    DVIVPNVWRPLP++LG  Q YDLNSW+
Sbjct: 171 VALKPYHSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWLGDIQPYDLNSWV 230

Query: 360 ESTDALNLAKKL-EEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAK 418
           ES   L LA    +ED VIVEGY EYATWR HL   R+  G+P   ++LDG+GGVSIL++
Sbjct: 231 ESEGGLQLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSR 290

Query: 419 AKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARR 478
           A++FR G+HF AF+F+ HAETE FGK+++ MGY V GLPHY +WHIYEPS DD+  +A  
Sbjct: 291 ARVFRSGSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYEPSSDDLKHMAWM 350

Query: 479 ERENRR 484
             E +R
Sbjct: 351 AEEEQR 356

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  184 bits (466), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 119/363 (32%), Positives = 183/363 (50%), Gaps = 57/363 (15%)

Query: 108 FEEQMEELV-SATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTY 166
           F +++++L+    +  YDL   + T N   N+E VLI  P++  H      + +L++LTY
Sbjct: 83  FNDKVDDLIPEGHIAHYDLNKLKSTSNALVNKERVLILTPMQTFHQ---QYWNNLLSLTY 139

Query: 167 PHELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGD 226
           P  LI++ F++   +  D  LQ L      +Q G  +   A+                  
Sbjct: 140 PRALIELGFIIPRTASGDAALQKLESAVREVQTGKQDKRFAK------------------ 181

Query: 227 LYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIR 286
                     + ++R A                Q F +  G+K      DRH ++VQ  R
Sbjct: 182 ----------ITILRQA---------------SQSFDR-LGEK------DRHALEVQKER 209

Query: 287 RRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEF 346
           R  M  ARN L  + + P+ SW+ W D D+   P +VI+DL S    V+  NV++   + 
Sbjct: 210 RAAMALARNELLFSTIGPHTSWILWLDADIVETPVTVIQDLTSHNKPVLAANVYQKFYDK 269

Query: 347 LGGKQG---YDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPRE 403
              K+    YD N+W ES   L LA++L ++++IVEGY+E AT+R  +    +A G    
Sbjct: 270 DQKKESIRPYDFNNWAESEIGLKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNS 329

Query: 404 VIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWH 463
           +++LDGVGG   L KA++ R GA FT F F +  ETEAF KMAK++GY V GLP+Y ++H
Sbjct: 330 LMELDGVGGGCTLVKAEVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYH 389

Query: 464 IYE 466
           I E
Sbjct: 390 IEE 392

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  173 bits (438), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 121/405 (29%), Positives = 189/405 (46%), Gaps = 76/405 (18%)

Query: 73  YEFAAASAERLAKYDEGFEHYFVTRDGQISRDDPEFEEQMEELVSATVEQYDLRNYEGTP 132
           + F  +S  ++ KY      Y V     + RD+ +     + + +  V +YDL     T 
Sbjct: 57  FYFPYSSKFKMPKYS-----YKVKSRNWMFRDNKD-----DRIPNGHVAKYDLNKLHSTS 106

Query: 133 NGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCSENDKTLQSLME 192
           + A N+E VLI  P++  H      + +L+ LTYP +L+++ F++   +  D  L+ L  
Sbjct: 107 DAAVNKEQVLILTPMQTFHQA---YWDNLLQLTYPRDLLELGFIIPKSASGDAALKQL-- 161

Query: 193 YATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVRDAFSPPYHENY 252
                            EA +KR +    N                              
Sbjct: 162 -----------------EAAVKRAQTDKKNNR---------------------------- 176

Query: 253 EKPFRSVQVFKKDFGQKIGQGF-----SDRHHVKVQGIRRRLMGRARNWLTANALKPYHS 307
              F  V + ++D      +GF      +RH + VQ  RR  M  ARN L  + + P+ S
Sbjct: 177 ---FGKVTILRQD-----SKGFDKLQEKERHALAVQKERRSAMALARNELLFSTIGPHTS 228

Query: 308 WVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGK---QGYDLNSWIESTDA 364
           WV W D D+     S+I+D+ ++   V+  NV++   +    K   + YD N+W +S  A
Sbjct: 229 WVLWLDADIIETKPSLIQDMTALNKPVLAANVYQRYFDEAENKPSIRPYDFNNWADSQIA 288

Query: 365 LNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKLFRQ 424
             L  K+ +D++IVEGYAE AT+R  +       G P E++ LDGVGG   L KA++ R 
Sbjct: 289 QELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDGPPNELMSLDGVGGGCTLVKAEVHRD 348

Query: 425 GAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSD 469
           GA F  F F +  ETE F KMAK++ Y+V GLP+Y ++HI E +D
Sbjct: 349 GAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVFHIEERND 393

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  172 bits (437), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 117/365 (32%), Positives = 177/365 (48%), Gaps = 61/365 (16%)

Query: 108 FEEQMEELVSAT-VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTY 166
           F +++E+++ A  +  YDL     T N A N+E VLI  P++N H      + +L+ LTY
Sbjct: 82  FNDKIEDVIPAGHIAHYDLNKLTSTQNAALNKEQVLILTPMQNFHQ---KYWDNLLQLTY 138

Query: 167 PHELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKA--KHGNGG 224
           P ELI++ F+V                    + G+ N  L + EA +K+++   K    G
Sbjct: 139 PRELIELGFIVP-------------------RTGSGNVALEQLEAAVKKVQTGKKEDRFG 179

Query: 225 GDLYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQG 284
               L+   Q + +++                                   +RH ++VQ 
Sbjct: 180 KITILRQASQSFDKLLE---------------------------------KERHALEVQK 206

Query: 285 IRRRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLP 344
            RR  M  ARN L  + + PY SW+ W D D+   P SVIED+ +    V+  NV++   
Sbjct: 207 ERRAAMALARNELLFSTIGPYTSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQRYY 266

Query: 345 EFLGGKQG---YDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNP 401
           +    K+    YD N+W ES   L LA ++  D+++VEGY E AT+R  +    E     
Sbjct: 267 DQEQKKESIRPYDYNNWAESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYEDSAPA 326

Query: 402 REVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTL 461
              ++LDGVGG   L KA + R GA F  F F +  ETE F KMAK++GY+V GLP+Y +
Sbjct: 327 TVEMELDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLV 386

Query: 462 WHIYE 466
           +HI E
Sbjct: 387 YHIDE 391

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  171 bits (432), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 110/363 (30%), Positives = 175/363 (48%), Gaps = 57/363 (15%)

Query: 108 FEEQMEELVS-ATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTY 166
           F E ++E++S   + ++DL     T + + N+E VLI  PL+  H      +++++ L+Y
Sbjct: 84  FNEHIDEIISEGHIAEFDLNKLHSTKDASINKEKVLILTPLQKFHQ---EYWENILQLSY 140

Query: 167 PHELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGD 226
           P ELI++ F+V      D  LQSL                   E  +++ +    N    
Sbjct: 141 PRELIELGFIVPRTQTGDLALQSL-------------------EKAVEKTQTDKKN---- 177

Query: 227 LYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIR 286
                                      + F  V + ++D          +RH + VQ  R
Sbjct: 178 ---------------------------QRFAKVTILRQDSESFNKLAEKERHALNVQKER 210

Query: 287 RRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPL--- 343
           R  M  ARN L  + + P+ SWV W D D+   P ++I+D+ +    V+  NV++     
Sbjct: 211 RSSMALARNELLFSTIGPHTSWVLWLDADIVETPSTLIQDMTAHDKSVLAANVFQRYYDD 270

Query: 344 PEFLGGKQGYDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPRE 403
            +     + YD N+W ES   L LA K+ +D++IVEGY+E AT+R  +    +      E
Sbjct: 271 EKKASATRPYDFNNWQESEIGLELASKMNDDEIIVEGYSEIATYRPLMAYFHDTTKPVSE 330

Query: 404 VIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWH 463
            + LDGVGG   L KA++ R GA F +F F +  ETE F KMAK++GY++ GLP+Y ++H
Sbjct: 331 EMILDGVGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMAKRLGYEIFGLPNYLVYH 390

Query: 464 IYE 466
           I E
Sbjct: 391 IEE 393

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  169 bits (427), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 110/368 (29%), Positives = 176/368 (47%), Gaps = 67/368 (18%)

Query: 108 FEEQMEELV-SATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTY 166
           F + +E+++    +  YDL     TP+ A N+EHVLI  P++  H      + +L+ LTY
Sbjct: 83  FNDHVEDIIPEGHIAHYDLNKLHSTPDAAANKEHVLILTPMQTFHQ---QYWDNLLQLTY 139

Query: 167 PHELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGD 226
           P ELI++ F+    +  D  L+ L                   E  +K+++A        
Sbjct: 140 PRELIELGFITPRTATGDLALKKL-------------------ENAVKKVQA-------- 172

Query: 227 LYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGF-----SDRHHVK 281
                                  +   + F  + + +++      Q F      +RH + 
Sbjct: 173 -----------------------DKKAQRFSKITIMRQN-----SQSFDKLMEKERHALD 204

Query: 282 VQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWR 341
           VQ  RR  M  ARN L  + + P+ SWV W D D+   P ++I+D+      V+  N+++
Sbjct: 205 VQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQ 264

Query: 342 PL---PEFLGGKQGYDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAK 398
                 +     + YD N+W ES   L +A ++++D++IVEGYAE AT+R  +     A 
Sbjct: 265 RFYDQEKKQSSIRPYDFNNWQESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYSAN 324

Query: 399 GNPREVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPH 458
             P + + LDGVGG   L KA++ R GA F  F F +  ETE F KMAK++ Y+V GLP+
Sbjct: 325 ELPSKEMVLDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPN 384

Query: 459 YTLWHIYE 466
           Y ++HI E
Sbjct: 385 YLVYHIEE 392

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  168 bits (426), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 111/368 (30%), Positives = 175/368 (47%), Gaps = 67/368 (18%)

Query: 108 FEEQMEELVSAT-VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTY 166
           F +++E+++    +  YDL     T   A N+EHVLI  P++  H      + +L+ LTY
Sbjct: 84  FNDRVEDIIPENHIAHYDLNKLHSTAEAALNKEHVLILTPMQTFHQ---EYWDNLLQLTY 140

Query: 167 PHELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGD 226
           P E  ++ F++   S  D  L  L                   EA +K+++    N    
Sbjct: 141 PREFTELGFILPRTSSGDIALSKL-------------------EAAVKKVQTDKKN---- 177

Query: 227 LYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGF-----SDRHHVK 281
                                      + F  + + +++       GF      +RH ++
Sbjct: 178 ---------------------------QRFSKITILRQN-----SAGFDKLMEKERHALE 205

Query: 282 VQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWR 341
           VQ  RR  M  ARN L  ++L P  SWV W D D+   P ++I+D+ S    V+  NV++
Sbjct: 206 VQKERRSAMASARNELLFSSLGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQ 265

Query: 342 PLPEFLGGK---QGYDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAK 398
              +    K   + YD N+W ES  AL LAK++ +D+++VEGY + AT+R  +    +A 
Sbjct: 266 KYYDDQAKKVQIRPYDFNNWQESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYDAT 325

Query: 399 GNPREVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPH 458
           G     ++LDGVGG   L KA + R GA F  F F +  ETE F KMA+++ Y + GLP+
Sbjct: 326 GATNAEMNLDGVGGGCTLVKADVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPN 385

Query: 459 YTLWHIYE 466
           Y ++HI E
Sbjct: 386 YLVYHIEE 393

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  168 bits (425), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 111/366 (30%), Positives = 174/366 (47%), Gaps = 57/366 (15%)

Query: 108 FEEQMEELV-SATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTY 166
           F +++E+++    +  YDL     T   A N+E VLI  P++  H      + +L+ LTY
Sbjct: 84  FNDRVEDIIPEGHIAHYDLNKLHSTAKAALNKEQVLILTPMQTFHE---QYWDNLLQLTY 140

Query: 167 PHELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGD 226
           P ELI++ F+V      D  L                   A+ E  +K+++    N    
Sbjct: 141 PRELIELGFIVPRTQSGDVAL-------------------AKLEEAVKKVQTDKKN---- 177

Query: 227 LYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIR 286
                                      + F  V + ++D          +RH + VQ  R
Sbjct: 178 ---------------------------QRFVKVTILRQDSKSFDKLQEKERHALAVQKER 210

Query: 287 RRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPL--- 343
           R  M  ARN L  + + P+ SWV W D D+   P ++I+D+ +    V+  NV++     
Sbjct: 211 RAAMALARNELLFSTIGPHTSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQRYYDE 270

Query: 344 PEFLGGKQGYDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPRE 403
            +     + YD N+W ES   L LA ++ ED++IVEGY+E AT+R  +    +A G+P  
Sbjct: 271 EKKESSIRAYDFNNWAESETGLELASQMAEDEIIVEGYSELATYRPLMAYYYDANGSPGA 330

Query: 404 VIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWH 463
            + LDGVGG   L +A + R GA F  F F +  ETE F KMAK++ ++V GLP+Y ++H
Sbjct: 331 EMALDGVGGGCTLVQADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGLPNYLVYH 390

Query: 464 IYEPSD 469
           I E +D
Sbjct: 391 IEEWND 396

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  167 bits (424), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 164/353 (46%), Gaps = 62/353 (17%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           +  YDL     T +  + +EHVLI  P++  H      + +L+ ++YP  L+++ F++  
Sbjct: 96  IAHYDLNKLHSTKDAMKLKEHVLIATPMQTFHDAY---WSNLLKMSYPRSLLELGFIIPR 152

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQM 239
               D+TL+ L      +Q G +                                     
Sbjct: 153 TPTGDETLKKLEAAVKNVQTGKV------------------------------------- 175

Query: 240 VRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTA 299
                        E  F  + + ++D       G  +RH + VQ  RR  M  ARN L  
Sbjct: 176 -------------EDRFAKITILRQDSQSFDKLGEKERHSLAVQKERRSAMALARNELLF 222

Query: 300 NALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQG------Y 353
           +++ P  SWV W D D+   P +VI+D+ +    V+  NV++    F   ++       Y
Sbjct: 223 SSIGPSTSWVLWLDADIVETPATVIQDMTNHNKPVLAANVYQ---RFFDKEKNENSIRPY 279

Query: 354 DLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGV 413
           D N+W ES   L +AK + ED++IVEGYAE AT+R  +    +  G    ++ LDGVGG 
Sbjct: 280 DFNNWAESEKGLEIAKNMNEDEIIVEGYAEIATYRPLMAHFYDKAGKIDALMALDGVGGG 339

Query: 414 SILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYE 466
             L KA++ R GA F  F F +  ETE F KMAK++ Y++ GLP+Y ++HI E
Sbjct: 340 CTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIFGLPNYLVYHIEE 392

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  167 bits (422), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 109/368 (29%), Positives = 175/368 (47%), Gaps = 67/368 (18%)

Query: 108 FEEQMEELV-SATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTY 166
           F + +E+++    +  YDL     TP+ A N+EH+LI  P++  H      + +L+ L Y
Sbjct: 83  FNDHVEDIIPEGHIAHYDLNKLHSTPDAAVNKEHILILTPMQTFHQ---QYWDNLLQLNY 139

Query: 167 PHELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGD 226
           P ELI++ F+    +  D  L+ L                   E+ IK+++         
Sbjct: 140 PRELIELGFITPRTATGDSALKKL-------------------ESAIKKVQT-------- 172

Query: 227 LYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGF-----SDRHHVK 281
                                  +   + F  + + +++      Q F      +RH ++
Sbjct: 173 -----------------------DKKTQRFSKITILRQN-----SQSFDKLMEKERHALE 204

Query: 282 VQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWR 341
           VQ  RR  M  ARN L  + + P+ SWV W D D+   P S+I+D+      V+  N+++
Sbjct: 205 VQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQ 264

Query: 342 PL---PEFLGGKQGYDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAK 398
                 +     + YD N+W ES   L++A ++ +D++IVEGYAE AT+R  +    +A 
Sbjct: 265 RFYDQEKKQASIRPYDFNNWQESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFDAS 324

Query: 399 GNPREVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPH 458
               E + LDGVGG   L KA++ R GA F  F F +  ETE F KMAK++ Y V GLP+
Sbjct: 325 KPQNEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPN 384

Query: 459 YTLWHIYE 466
           Y ++HI E
Sbjct: 385 YLVYHIEE 392

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  167 bits (422), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 112/368 (30%), Positives = 180/368 (48%), Gaps = 67/368 (18%)

Query: 108 FEEQMEELV-SATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTY 166
           F++ ++E++    +  YDL     T + A N+E +LI  P++  H      +++L+ LTY
Sbjct: 81  FDDHVDEIIPEGHIAHYDLNKLHSTSDAAINKEKILILTPIQKFHQ---EYWENLLQLTY 137

Query: 167 PHELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGD 226
           P ELI++ F+       D+ L +L                   EA + ++++   N    
Sbjct: 138 PRELIELGFIAPRTPTGDQALAAL-------------------EAAVDKVQSDKKN---- 174

Query: 227 LYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFS-----DRHHVK 281
                                      + F  V + ++D       GF+     +RH ++
Sbjct: 175 ---------------------------QRFSKVTILRQD-----SVGFNKLTEKERHALE 202

Query: 282 VQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWR 341
           VQ  RR  M  ARN L  + + P+ SWV W D D+   P S+I+D+ +    V+  NV++
Sbjct: 203 VQKERRASMALARNELLFSTIGPHTSWVLWLDADIIETPASLIQDMTAHDRAVLSANVFQ 262

Query: 342 PLPEFLGGKQG---YDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAK 398
              +    ++    YD N+W ES   L LA K+++D++IVEGYAE AT+R  +    +  
Sbjct: 263 RYYDEEKKQKAIRPYDFNNWQESDTGLELASKMKDDEIIVEGYAEIATYRPLMAYFHDPD 322

Query: 399 GNPREVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPH 458
            +  E + LDGVGG   L KA++ R GA F  F F +  ETE F KMAK++ Y+V GLP+
Sbjct: 323 NSVAEEMRLDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPN 382

Query: 459 YTLWHIYE 466
           Y ++HI E
Sbjct: 383 YLVYHIEE 390

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  167 bits (424), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 109/355 (30%), Positives = 171/355 (48%), Gaps = 66/355 (18%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           +  YDL     T N A N+E VLI  P++  H      + +L+ LTYP EL+++ F++  
Sbjct: 155 ITHYDLNKLTSTANAALNKEQVLILTPMQTFHE---EYWNNLLQLTYPRELLELGFIIPR 211

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQM 239
            +  D  L+ L                   EA +K+ +           L   DQ +L+ 
Sbjct: 212 TTSGDNALRKL-------------------EAAVKKTQ-----------LSKKDQRFLK- 240

Query: 240 VRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGF-----SDRHHVKVQGIRRRLMGRAR 294
                              + + ++D      Q F      DRH ++VQ  RR  M  AR
Sbjct: 241 -------------------ITILRQD-----SQSFDLLKEKDRHALEVQKKRRSAMALAR 276

Query: 295 NWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQG-- 352
           N L  + + PY SWV W D D+   P ++I+D+ +    V+  NV++   +   G++   
Sbjct: 277 NELLFSTIGPYTSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKKTGQKTKG 336

Query: 353 -YDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVG 411
            YD N+W +S  AL +A  + +D V+ EGY E AT+R  +    +   +P   + LDGVG
Sbjct: 337 PYDFNNWADSDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLDGVG 396

Query: 412 GVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYE 466
           G   L KA++ R GA F +F F +  ETE F KMA+++ Y++ GLP+Y ++HI E
Sbjct: 397 GGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHIEE 451

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  166 bits (420), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 112/364 (30%), Positives = 173/364 (47%), Gaps = 59/364 (16%)

Query: 108 FEEQMEELV-SATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTY 166
           F + +++++    +  YDL     T   A N+E VLI  P++  H      +++L+ LTY
Sbjct: 86  FNDHVDDIIPEGHIAHYDLNKLRSTAYAAVNKERVLILTPMQTFHK---QYWENLLQLTY 142

Query: 167 PHELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGD 226
           P ELI++ F++      +  L+ L                   E  IK++++   N    
Sbjct: 143 PRELIELGFIIPRTKTGENALKEL-------------------EIAIKKVQSDKKN---- 179

Query: 227 LYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQ-GFSDRHHVKVQGI 285
                                      + F  + + ++D  Q   Q    DRH + VQ  
Sbjct: 180 ---------------------------QRFAKITILRQD-SQSFDQLAEKDRHSILVQKE 211

Query: 286 RRRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPE 345
           RR  M  ARN L  + L P+ +WV W D D+   P +VI+D+ S    V+  NV++   +
Sbjct: 212 RRAAMALARNELLFSTLGPHTAWVLWLDADIIETPPTVIQDMTSHDKSVLAANVYQKYFD 271

Query: 346 FLGGKQG---YDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPR 402
               K     YD N+W ES   L +A  ++E+++IVEGY+E AT+R  +     A G   
Sbjct: 272 NDEKKMAIRPYDFNNWRESDIGLEIAANMDENEIIVEGYSEIATYRPLMAHFYNADGQVT 331

Query: 403 EVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLW 462
           + ++LDGVGG   L KA + R GA F  F F +  ETE F KMAK++ Y V GLP+Y ++
Sbjct: 332 DEMELDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLPNYLVY 391

Query: 463 HIYE 466
           HI E
Sbjct: 392 HIEE 395

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  166 bits (419), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 112/364 (30%), Positives = 174/364 (47%), Gaps = 59/364 (16%)

Query: 108 FEEQMEELVSAT-VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTY 166
           F   +E+++    +  YDL     T + A N+E VLI  P++  H      +++L+ LTY
Sbjct: 81  FNRHVEDIIPENHIAHYDLNKLHSTSDAAVNKEQVLILTPMQTFHDEF---WQNLLQLTY 137

Query: 167 PHELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGD 226
           P ELI++ F++      D  L++L                   EA +K+++    N    
Sbjct: 138 PRELIELGFILPRSDSGDAALKAL-------------------EAAVKKVQTDKKN---- 174

Query: 227 LYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGF-SDRHHVKVQGI 285
                                      + F  + + ++D  Q  GQ    +RH + VQ  
Sbjct: 175 ---------------------------QRFSKITILRQD-SQGFGQLMEKERHALHVQKE 206

Query: 286 RRRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVW-RPLP 344
           RR  M  ARN L  + + P+ SWV W D D+   P +VI+D+ +    V+  NV+ R   
Sbjct: 207 RRAAMALARNELLFSTIGPHTSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQRYFD 266

Query: 345 EFLGGK--QGYDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPR 402
           E    K  + YD N+W ES   L +A  + +D++IVEGY+E AT+R  +    +   +  
Sbjct: 267 EEKKEKSIRAYDFNNWQESDTGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYDPTASVN 326

Query: 403 EVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLW 462
             + LDGVGG   L KA + R GA F  F F +  ETE F KMAK++ Y+V GLP+Y ++
Sbjct: 327 SEMMLDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVY 386

Query: 463 HIYE 466
           H+ E
Sbjct: 387 HMEE 390

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  165 bits (418), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 113/366 (30%), Positives = 171/366 (46%), Gaps = 63/366 (17%)

Query: 108 FEEQMEELVSAT-VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTY 166
           F + +++++    +  YDL     T   A N+E VLI  P++  H      + +++++TY
Sbjct: 84  FNDHVDDIIPENHIAHYDLNKLHSTKQAAVNKERVLILTPMQTFHE---QYWDNILHMTY 140

Query: 167 PHELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGD 226
           P ELI++ F+       D  L+ L                   EA IK++++   N    
Sbjct: 141 PRELIELGFIAPRTPTGDAALKKL-------------------EAAIKKIQSGKKN---- 177

Query: 227 LYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIR 286
                                      + F  + + +++          DRH + VQ  R
Sbjct: 178 ---------------------------ERFAKIIILRQESQSFDMLAEKDRHALAVQKQR 210

Query: 287 RRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEF 346
           R  M  ARN L  + L P+ SWV W D D+   P +VI+DL +    V+  NV++    F
Sbjct: 211 RSAMALARNELLFSTLGPHTSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ---RF 267

Query: 347 LGGK------QGYDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGN 400
              +      + YD N+W ES   L LA  L  D++IVEGYAE AT+R  +    +    
Sbjct: 268 FNDELSKADIRPYDFNNWQESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFDESKP 327

Query: 401 PREVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYT 460
             E + LDGVGG   L KA++ R GA F  F F +  ETE F KMAK++GY+V GLP+Y 
Sbjct: 328 VSEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYL 387

Query: 461 LWHIYE 466
           ++HI E
Sbjct: 388 VYHIEE 393

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  165 bits (417), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 110/368 (29%), Positives = 174/368 (47%), Gaps = 67/368 (18%)

Query: 108 FEEQMEELV-SATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTY 166
           F + +E+++    +  YDL     T + A N+EHVLI  P++  H      + +L+ L+Y
Sbjct: 83  FNDHVEDIIPEGHIAHYDLNKLHSTSDAAVNKEHVLILTPMQTFHQ---QYWDNLLQLSY 139

Query: 167 PHELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGD 226
           P ELI++ F+    +  D  L++L                   E  IK+++         
Sbjct: 140 PRELIELGFITPRTATGDLALKNL-------------------ENAIKKVQT-------- 172

Query: 227 LYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGF-----SDRHHVK 281
                                  +   + F  + + +++      Q F      +RH + 
Sbjct: 173 -----------------------DKKTQRFSKITILRQN-----SQSFDKLMEKERHALD 204

Query: 282 VQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWR 341
           VQ  RR  M  ARN L  + + P+ SW+ W D D+   P S+I+D+      V+  N+++
Sbjct: 205 VQKERRAAMALARNELLFSTIGPHTSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQ 264

Query: 342 PLPEFLGGK---QGYDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAK 398
              +    +   + YD N+W ES   L +A ++ +D++IVEGYAE AT+R  +     A 
Sbjct: 265 RFYDQEKKQPSIRPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYNAD 324

Query: 399 GNPREVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPH 458
           G P E + LDGVGG   L KA + R GA F  F F +  ETE F KMAK++ Y V GLP+
Sbjct: 325 GLPNEEMALDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGLPN 384

Query: 459 YTLWHIYE 466
           Y ++HI E
Sbjct: 385 YLVYHIEE 392

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  165 bits (417), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 108/366 (29%), Positives = 175/366 (47%), Gaps = 63/366 (17%)

Query: 108 FEEQMEELVSAT-VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTY 166
           F + +E+ + A  +  YDL     T     N+E VLI  P++  H      + +L+ LTY
Sbjct: 83  FSDTVEDNIPAGHISHYDLNKLTSTDKAFANKEQVLILTPMQTFHD---QYWDNLLQLTY 139

Query: 167 PHELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGD 226
           P +LI++ F++   +  D  L+ L                   EA +KR +         
Sbjct: 140 PRDLIELGFIIPRTATGDTALRKL-------------------EAAVKRTQ--------- 171

Query: 227 LYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIR 286
             L   DQ                     F  + + ++D          +RH +KVQ  R
Sbjct: 172 --LGKKDQR--------------------FSKITILRQDSQSFDSLQEKERHALKVQKER 209

Query: 287 RRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEF 346
           R  M  ARN L  + + P+ SW+ W D D+   P S+I+D+ +    V+  NV++   ++
Sbjct: 210 RAAMALARNELLFSTIGPHTSWILWLDADIIETPPSLIQDMTAHNKPVLAANVYQ---KY 266

Query: 347 LG------GKQGYDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGN 400
           +        ++ YD N+W +S  AL +A  + +D+V+ EGYAE  T+R  +    +A G+
Sbjct: 267 MNEETKKIAERPYDFNNWADSEKALQMAAGMADDEVLFEGYAELPTYRTLMAHMYDASGS 326

Query: 401 PREVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYT 460
               + LDGVGG   L KA++ R GA F +F F +  ETE F KMA+++ Y++ GLP+Y 
Sbjct: 327 QAAEMSLDGVGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEIFGLPNYL 386

Query: 461 LWHIYE 466
           ++HI E
Sbjct: 387 VYHIEE 392

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  164 bits (415), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 112/370 (30%), Positives = 173/370 (46%), Gaps = 71/370 (19%)

Query: 108 FEEQMEELV-SATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTY 166
           F +++E+++    +  YDL     T +   ++EHVL+  P++  H      +++L+ L+Y
Sbjct: 83  FNDRVEDIIPEGHIAHYDLNKLHSTSDSISDKEHVLVLTPMQTFHE---KYWENLLKLSY 139

Query: 167 PHELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGD 226
           P ELI++ F++      D  L+ L                   E  +K +++   N    
Sbjct: 140 PRELIELGFIIPRSDAGDAALKKL-------------------ETAVKNVQSDKKNNR-- 178

Query: 227 LYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGF-----SDRHHVK 281
                                        F  + + +++      Q F      +RH + 
Sbjct: 179 -----------------------------FSKITILRQE-----SQSFDKLEEKERHSLA 204

Query: 282 VQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWR 341
           VQ  RR  M  ARN L  + L P+ SWV W D D+   P +VIE +      V+  NV++
Sbjct: 205 VQKERRAAMALARNELLFSTLGPHTSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQ 264

Query: 342 PLPEFLGGKQG-----YDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITARE 396
               F   KQ      YD N+W ES   L LA K+ +D++IVEGYAE AT+R  +     
Sbjct: 265 RF--FDNDKQQDSIRPYDFNNWAESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYN 322

Query: 397 AKGNPREVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGL 456
             G+  E + LDGVGG   L KA++ R GA F  F F +  ETE F KMAK++ Y+V GL
Sbjct: 323 PSGDVGEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGL 382

Query: 457 PHYTLWHIYE 466
           P++ ++HI E
Sbjct: 383 PNFLVYHIEE 392

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  164 bits (415), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 109/368 (29%), Positives = 172/368 (46%), Gaps = 67/368 (18%)

Query: 108 FEEQMEELV-SATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTY 166
           F + +E+++    +  YDL     T   A N+EH+LI  P++  H      + +L+ L Y
Sbjct: 83  FNDHVEDIIPEGHIAHYDLNKLHSTSEAAVNKEHILILTPMQTFHQ---QYWDNLLQLNY 139

Query: 167 PHELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGD 226
           P ELI++ F+    +  D  L+ L                   E  IK+++         
Sbjct: 140 PRELIELGFITPRTATGDLALKKL-------------------ENAIKKVQT-------- 172

Query: 227 LYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGF-----SDRHHVK 281
                                  +   + F  + + +++      Q F      +RH + 
Sbjct: 173 -----------------------DKKTQRFSKITILRQN-----SQSFDKLMEKERHALD 204

Query: 282 VQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWR 341
           VQ  RR  M  ARN L  + + P+ SWV W D D+   P S+I+D+      ++  N+++
Sbjct: 205 VQKERRAAMALARNELLFSTIGPHTSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQ 264

Query: 342 PL---PEFLGGKQGYDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAK 398
                 +     + YD N+W ES   L +A ++ +D++IVEGYAE AT+R  +    +A 
Sbjct: 265 RFYDEEKKQPSIRPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDAN 324

Query: 399 GNPREVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPH 458
           G P E + LDGVGG   L KA++ R GA F  F F +  ETE F KMAK++ Y V GLP+
Sbjct: 325 GVPGEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPN 384

Query: 459 YTLWHIYE 466
           Y ++HI E
Sbjct: 385 YLVYHIEE 392

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  161 bits (408), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 111/348 (31%), Positives = 161/348 (46%), Gaps = 59/348 (16%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           + +YDL   + T   A N E VLI  P++  H      + +L+ LTYP + I + FL+  
Sbjct: 94  LREYDLNTLQSTAMAAANGEQVLILTPMQIFHQ---QYWDNLLLLTYPRKYIHLGFLLPR 150

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQM 239
            S  +  L+ L +    +Q G                                DQ     
Sbjct: 151 TSSGNTALRKLEKAVRKVQTGP------------------------------KDQR---- 176

Query: 240 VRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTA 299
                           F  + + ++DF        S RH   VQ  RR  M  ARN L  
Sbjct: 177 ----------------FGKITILRQDFASFNKLSQSARHRFHVQKERRSAMALARNELLF 220

Query: 300 NALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGK---QGYDLN 356
           + + PY SWV W D D+   P ++IED+ S    ++  NV++   E   G+   + YDLN
Sbjct: 221 STIGPYTSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQRYVE--NGEPAIRAYDLN 278

Query: 357 SWIESTDALNLAKKLEEDDVIVEGYA-EYATWRFHLITAREAKGNPREVIDLDGVGGVSI 415
           +W ES   L +A +L ED +IVEGY  E+AT+R  +      K    E++ LDGVGG   
Sbjct: 279 NWAESELGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRPKDELMALDGVGGGCT 338

Query: 416 LAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWH 463
           L KA++ R GA F  F F +  ETE F KMAK++ Y++ GLP+Y ++H
Sbjct: 339 LVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYH 386

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  155 bits (393), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 103/348 (29%), Positives = 171/348 (49%), Gaps = 57/348 (16%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           +  YDL   + + N AEN+EHVLI  PL++        + +L+ L+YP + I++ F++  
Sbjct: 103 IAHYDLNKLQSSANAAENKEHVLILTPLKSFEQ---GYWDNLLKLSYPRDAIELGFIIPR 159

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLK-AKHGNGGGDLYLKYMDQEYLQ 238
             + D +L+ L                   E+ IK+++ AK G+    + +   + +  +
Sbjct: 160 TKKGDHSLKKL-------------------ESAIKKVQTAKQGDKFSKITILRQNSKGFE 200

Query: 239 MVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLT 298
            V +                    KK+  +           ++ +   R  M  ARN L 
Sbjct: 201 TVPE--------------------KKEVSE-----------IEYEKQIRAEMALARNELL 229

Query: 299 ANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGK---QGYDL 355
           A+ L P  +W+ W D D+   P S+I+D+      V+  NV+    +   G+   + YD 
Sbjct: 230 ASTLGPQTAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYERYKDRESGELSIRPYDF 289

Query: 356 NSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSI 415
            +WIEST+AL LA  ++ED++IVEG A  +T R  +    +  G+P   I LDGVG   +
Sbjct: 290 RNWIESTEALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDGSPSSEISLDGVGASCL 349

Query: 416 LAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWH 463
           L K+++ R GA F  F F +  E+E F KMAK++ Y+V GLP+Y ++H
Sbjct: 350 LVKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNYLVYH 397

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  147 bits (372), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 98/354 (27%), Positives = 162/354 (45%), Gaps = 65/354 (18%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           + +YD+     T +   N+E VLI  P++  H      +++L++LTYP +L  + F++  
Sbjct: 95  IMKYDMNTLTTTSSPLANKEIVLILTPMQKFHD---KYWENLLSLTYPRKLTQLGFIIPR 151

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQM 239
               D  ++ L +    +Q G  N                              Q +L+ 
Sbjct: 152 TPTGDVAMKRLEDAVKKVQSGKEN------------------------------QRFLK- 180

Query: 240 VRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFS-----DRHHVKVQGIRRRLMGRAR 294
                              + + ++D      Q F+     +RH   VQ  RR  M  AR
Sbjct: 181 -------------------ITILRQD-----SQSFNKLDEKERHAFNVQKERRAAMALAR 216

Query: 295 NWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGK--QG 352
           N L  + + P  SW+ W D D+   P +VI+D+ +    ++  NV++   +    +  + 
Sbjct: 217 NELVFSTIGPSTSWILWLDADIVETPATVIQDMAAHDKAILAANVFQRYIDDQNQENIRP 276

Query: 353 YDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGG 412
           YD N+W ES   L +A  +++D++IVE Y E  T+R  +    +  G+P   + LDGVGG
Sbjct: 277 YDFNNWQESQTGLEIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGG 336

Query: 413 VSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYE 466
              L KA++ R GA F  F F +  ETE F  MAK++ Y+V GLP+Y ++H  E
Sbjct: 337 GCTLVKAQVHRDGAMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  147 bits (370), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 101/345 (29%), Positives = 170/345 (49%), Gaps = 48/345 (13%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           +  YDL     + N  EN+EHVLI  PL++        +++L+NL+YP +LI++ F+V +
Sbjct: 102 IAHYDLNKLVSSANALENKEHVLILTPLQSFDE---KYWENLLNLSYPRDLIELGFMVPN 158

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQM 239
             + D+ L+ L E A    +G    + + + A+I  L+ K        + K+ D++  + 
Sbjct: 159 TKKGDQILKQL-ENAVKNVQGIDKKLGSNKFAKITILRQKDSG-----FHKFNDRKDKKE 212

Query: 240 VRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTA 299
           + D                                     ++++  +R  M  ARN L +
Sbjct: 213 MND-------------------------------------IELEKEKRAEMALARNELLS 235

Query: 300 NALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLP--EFLGGKQGYDLNS 357
           + L    +W+ W D +V   P ++I+D+      V+  NV+      +     + YD  +
Sbjct: 236 STLSHSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVYMKDSNDKDKANIRPYDFRN 295

Query: 358 WIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILA 417
           WIES  AL LA ++ ED++IVEG A  AT R  +    E+ G+P E + LDG+G    L 
Sbjct: 296 WIESDTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYESDGSPTEELALDGIGAACTLV 355

Query: 418 KAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLW 462
           K+++ R GA F  F F +  E+E F KMAK++ Y+V GLP+Y ++
Sbjct: 356 KSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score = 90.5 bits (223), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 88/175 (50%), Gaps = 3/175 (1%)

Query: 287 RRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEF 346
           R+ +   +N L  + L PY SWV W D  +   P ++++DL + G  ++  +++      
Sbjct: 183 RKQLAALKNQLLFSTLPPYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHIFN---NS 239

Query: 347 LGGKQGYDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVID 406
            G      LN+W+ S    +LA  +    V++EG +   T R  +    +A  +    ++
Sbjct: 240 DGSPDSETLNNWVASDTWRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAASVLTEME 299

Query: 407 LDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTL 461
           LD V     L KA++ R GA F  FAF +  ETE F +MA+ + ++  GLP+Y +
Sbjct: 300 LDSVSTACTLVKAEVHRDGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYVV 354

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 60/134 (44%), Gaps = 16/134 (11%)

Query: 120 VEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSD 179
           +  Y+L     +P+   + EH+L+ IPL N +      F++L  LTYP +LID+  +V D
Sbjct: 79  ISYYNLNELAASPDAEGHSEHILVLIPLINFNS---RFFENLFALTYPKQLIDLGVIVPD 135

Query: 180 CSENDKTLQSLMEYATYLQKGTLNNVLAREEA---EIKRLKAKHGNGGGDLYLKYMDQEY 236
                  LQ+L E        TL  V A +     +I  LK  +  G  D  + Y  Q  
Sbjct: 136 SKNATGILQALQE--------TLAKVQANDSTRYNKITVLKDDNKWGNTDDPVAYRKQLA 187

Query: 237 LQMVRDAFS--PPY 248
               +  FS  PPY
Sbjct: 188 ALKNQLLFSTLPPY 201

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 89/203 (43%), Gaps = 21/203 (10%)

Query: 276 DRHHVKVQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVI 335
           DRH   VQ  RR+ + + RN+L  N       +    D D+ + P  ++E  + +G ++I
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFL-YNRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 336 VPNVWRPLPEFLGGKQGYDLNSWI-ESTDALNLAKKLEEDDVI---VEGYAEYAT-WRFH 390
           VP + R     +G  + YD N+WI E T   + +K+   +  +   V G  ++       
Sbjct: 427 VPRILR-----VGSDREYDKNTWIGERTKPEDTSKQNNYESYVPRPVNGKTKFLQDCVDE 481

Query: 391 LITAREAKGNPREVIDLDGVGGVSILAKAKLFRQGAHFTAFAF----------ENHAETE 440
            IT    +     V++LD VGG  +    K+F QG  F  F             +  ETE
Sbjct: 482 KITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEGYDGVETE 541

Query: 441 AFGKMAKKMGYKVGGLPHYTLWH 463
                AK +GYK  G+P+    H
Sbjct: 542 GLCYQAKTLGYKCYGVPNVICRH 564

>ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} similar
           to uniprot|P38244 Saccharomyces cerevisiae YBR074W
           Hypothetical ORF
          Length = 950

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 404 VIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWH 463
           VI+L+G G   I  KA LFR     TA  ++N  ++  FG    + G+  GG+   T + 
Sbjct: 215 VINLEGTG---IGGKAVLFRTSDVSTAKIYQNAVKSNPFGNSLFQQGFYEGGVGSETDYR 271

Query: 464 IYEPSDDDIMDIA 476
           IYE +     DIA
Sbjct: 272 IYESNGLRGFDIA 284

>Ecym_2389 Chr2 (753049..756357) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AAL088W
          Length = 1102

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 61/149 (40%), Gaps = 28/149 (18%)

Query: 97  RDGQISRD-DPEFEEQMEELVSATVEQYDLRNYEGT-----------------PNGAENR 138
           R G+I+   D  FE++M  L+  T +QY+L NY+G                    G  +R
Sbjct: 810 RTGEITEFFDVAFEQEMNSLIEETYKQYELTNYKGALKFGLFDYQASRDYYRESCGIMHR 869

Query: 139 EHVLICIPLRN--AHPVLPMMFKHLMNLTYPHEL-IDVAFLVSDCSENDKTLQSLMEYAT 195
           + VL  I  +     P+ P    ++ +    H+  + VA       + D  + S +EY  
Sbjct: 870 DLVLRYIETQALMLAPIAPHFADYIYHEVLNHKTSVQVAKFPRASKQIDTGVLSALEYLR 929

Query: 196 YLQKGTLNNVLAREEAEIKRLKAKHGNGG 224
            LQ+          EAE + LK K G G 
Sbjct: 930 DLQRSI-------REAEGQALKKKKGKGS 951

>NDAI0B04350 Chr2 complement(1089949..1091286) [1338 bp, 445 aa]
           {ON} Anc_2.149 YHR118C
          Length = 445

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 46/112 (41%), Gaps = 22/112 (19%)

Query: 87  DEGFEHYFVTRDGQISRDDPEFEEQMEELVSATVEQYDLRNYEGTPNGAENREHVLICIP 146
           DEGFE        ++  DD + EE  E L+         +  + +PN    R +  +C+ 
Sbjct: 234 DEGFETANEDTPSRVDADDNDVEESPERLI---------KRRKRSPNKKTGRPYSKMCLL 284

Query: 147 LRNAHPVLPMMFKHLMN-LTYPHELIDVAFLVSDCSENDKTLQSLMEYATYL 197
            R  + V P+    L N    P    DVA+ V         L+  M YA+YL
Sbjct: 285 SRKYYKVKPIEVIELCNQFELPQ---DVAYNV---------LEQYMSYASYL 324

>TBLA0B05460 Chr2 complement(1299725..1300549) [825 bp, 274 aa] {ON}
           Anc_2.503 YKL007W
          Length = 274

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 251 NYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRL-MGRAR-NW 296
           N  +  ++++ F+ DF +++   F+D +  K + +RRRL + RAR NW
Sbjct: 210 NLSEILKTIKSFESDFEKQLDVSFNDLNEKKFKTLRRRLPVSRARVNW 257

>TBLA0C00180 Chr3 (25369..26613) [1245 bp, 414 aa] {ON} 
          Length = 414

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 13/81 (16%)

Query: 305 YHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNV-WRPLPEFLGGKQGYDLNSWIESTD 363
           ++ WV+  DV+ +       ED   I   +I  N  +  +P     K+ + + SWI+   
Sbjct: 124 HYDWVFLNDVEFD-------EDFKRITSSLISGNTKYGVIP-----KEHWSVPSWIDEEK 171

Query: 364 ALNLAKKLEEDDVIVEGYAEY 384
           A N  KK+EED VI  G   Y
Sbjct: 172 ATNARKKMEEDGVIYGGSLPY 192

>KLLA0F11748g Chr6 complement(1082975..1085716) [2742 bp, 913 aa]
           {ON} similar to uniprot|P38244 Saccharomyces cerevisiae
           YBR074W Hypothetical ORF
          Length = 913

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 3/63 (4%)

Query: 404 VIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWH 463
           VI+L+G G  S   KA LFR     TA  +E   + + FG    + G+    +   T + 
Sbjct: 218 VINLEGAGAGS---KAALFRTSDTATALLYEKSVKDQPFGNSIYQQGFYSRFVSSETDYK 274

Query: 464 IYE 466
           IYE
Sbjct: 275 IYE 277

>AAL088W Chr1 (185828..189142) [3315 bp, 1104 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL160W (CDC60)
          Length = 1104

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 65/173 (37%), Gaps = 40/173 (23%)

Query: 105 DPEFEEQMEELVSATVEQYDLRNYEGT-----------------PNGAENREHVL--ICI 145
           D  FE +M  L+  T +QY+L NY+G                    G  +R+ VL  I  
Sbjct: 821 DLAFENEMNALIEETYKQYELTNYKGALKFGLFDYQASRDYYRESCGVMHRDLVLRYIET 880

Query: 146 PLRNAHPVLPMMFKHLMNLTYPH-ELIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNN 204
            +    P+ P    ++      H E + VA         D  + S +EY   LQ+     
Sbjct: 881 QILMLAPIAPHFCDYIYREVLGHTESVQVAKFPRASKPVDAGVLSALEYLRDLQRSI--- 937

Query: 205 VLAREEAEIKRLKAKHGNGGG---------DLYLK----YMDQEYLQMVRDAF 244
                EAE + LK + G G            +Y+         +Y++MVR+ F
Sbjct: 938 ----REAEGQALKKRKGKGSDVDPTKPAKLSMYITESFPSWQTKYIEMVRELF 986

>ACR207W Chr3 (709648..711123) [1476 bp, 491 aa] {ON} NOHBY330; No
           homolog in Saccharomyces cerevisiae
          Length = 491

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 36/89 (40%), Gaps = 4/89 (4%)

Query: 121 EQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDC 180
           E  D  N  GT    E+   V I  P R   P + M  +  +   YP E ++V F V   
Sbjct: 32  ESSDCGNGAGTEE--ESEAAVSIIRPCRGIEPEMAMCLESCIKQEYPPEKLEVLFCVE-- 87

Query: 181 SENDKTLQSLMEYATYLQKGTLNNVLARE 209
           SE+D+ L  L           L  ++ RE
Sbjct: 88  SEDDECLPILTALLAQYPTRNLKVLVGRE 116

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,293,576
Number of extensions: 2418782
Number of successful extensions: 6731
Number of sequences better than 10.0: 85
Number of HSP's gapped: 6821
Number of HSP's successfully gapped: 129
Length of query: 485
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 371
Effective length of database: 40,409,475
Effective search space: 14991915225
Effective search space used: 14991915225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)