Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ABL123Cna 1ON49448024210.0
SAKL0D01408gna 1ON5064277452e-92
Ecym_4614na 1ON4814267284e-90
KLLA0D01507gna 1ON5153837167e-88
Kpol_1072.158.677ON3993252149e-18
KNAG0J017108.677ON4153252014e-16
TBLA0B038308.677ON4133222005e-16
Kpol_1013.68.677ON4023241952e-15
Smik_6.3518.677ON4053251934e-15
Suva_16.1568.677ON4063261925e-15
Ecym_23968.677ON4153221891e-14
CAGL0M02211g8.677ON4153241891e-14
Kwal_26.88028.677ON4123301882e-14
Skud_16.1288.677ON4053261872e-14
YPL154C (PEP4)8.677ON4053251872e-14
NDAI0E021058.677ON4083251873e-14
ZYRO0F07392g8.677ON4183261854e-14
KLTH0D11264g8.677ON4173231821e-13
SAKL0H06512g8.677ON4043251792e-13
NCAS0C013608.677ON4063271792e-13
TDEL0A062308.677ON4083261694e-12
KLLA0D05929g8.677ON4093261669e-12
TPHA0D012608.677ON4193261651e-11
KAFR0H024208.677ON4163261605e-11
ACR144W8.677ON4083251543e-10
SAKL0F07172g7.182ON5423521519e-10
CAGL0E01749gsingletonON4823031411e-08
YIL015W (BAR1)7.182ON5873731383e-08
Smik_65.1singletonON3422911346e-08
CAGL0E01771gsingletonON5193241322e-07
YIR039C (YPS6)singletonON5373131322e-07
ZYRO0E02266gsingletonON5063041277e-07
ACR143WsingletonON3933221213e-06
Suva_9.13singletonON4642991213e-06
AGR240W7.182ON4523581214e-06
Smik_5.7singletonON3041151194e-06
ZYRO0F10274gsingletonON5723141205e-06
KAFR0B06530singletonON5383591206e-06
Suva_79.1singletonON2271221158e-06
TPHA0C008408.318ON10003871199e-06
CAGL0E01881gsingletonON5083331171e-05
TPHA0A015808.318ON6004121171e-05
Skud_12.1938.319ON4973541171e-05
Skud_9.1547.182ON5163101171e-05
NCAS0A124607.182ON5402991162e-05
Kwal_33.14239singletonON6512901153e-05
SAKL0E15356gsingletonON5573781134e-05
AGL192W8.318ON4993461115e-05
Suva_16.14singletonON5402931116e-05
AGR407CsingletonON2681831088e-05
Suva_34.1singletonON3872961099e-05
CAGL0J02288g7.182ON5413611072e-04
NCAS0B035608.318ON5862911063e-04
CAGL0E01727gsingletonON5393001053e-04
CAGL0E01837gsingletonON5213041044e-04
ZYRO0F10252gsingletonON5513041045e-04
KNAG0I009008.319ON5312961035e-04
YLR121C (YPS3)8.319ON5083561027e-04
Ecym_42518.318ON5022221019e-04
KAFR0H023008.318ON5213471000.001
KLLA0D15917g7.182ON511313990.002
Smik_9.1757.182ON593302980.002
KNAG0I009108.318ON569323980.002
KNAG0I01200singletonON677360980.002
NDAI0B017207.182ON547199980.002
ZYRO0G02904gsingletonON531336930.010
Smik_12.1878.319ON507361920.010
Kpol_1063.227.182ON336257910.014
CAGL0E01419g8.318ON591310890.026
SAKL0H15664g8.318ON556309890.028
Kpol_543.618.318ON588396890.032
KAFR0B057108.318ON575298870.051
ZYRO0D15554g7.182ON521353870.054
Smik_4.3888.318ON597263860.059
CAGL0M04191g8.318ON601317860.071
NCAS0C033008.318ON559411850.085
KNAG0G024108.318ON530198850.092
Ecym_43947.182ON518371840.097
ZYRO0F10230g8.318ON580305840.100
CAGL0E01859gsingletonON505323840.11
TBLA0D00140singletonON607262830.14
KNAG0E03220singletonON540120830.15
ZYRO0F10318g8.319ON486378820.16
YDR144C (MKC7)8.318ON596364810.27
Skud_12.1928.318ON569296810.27
TBLA0E02630singletonON689275810.29
Suva_10.2128.319ON745346800.32
CAGL0E01793gsingletonON516322800.32
Suva_9.186singletonOFF54347800.36
Suva_9.1877.182ON33343790.40
YLR120C (YPS1)8.318ON569303780.66
KNAG0H027607.182ON563300770.68
ZYRO0F10296gsingletonON528320770.84
TBLA0A039108.318ON596285751.4
SAKL0C02970gsingletonON592313741.6
TBLA0D045807.182ON395135722.6
KLTH0F06754gsingletonON767224723.1
TDEL0H026507.182ON552283723.1
Kwal_56.239028.318ON629278713.7
KLLA0E08383g2.285ON70474714.2
TBLA0H012908.318ON667273705.7
KLTH0G10186g2.278ON360117696.9
KAFR0E03940singletonON63839698.1
Kwal_26.7254singletonON570228688.4
Kwal_23.50122.278ON361117688.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL123C
         (494 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON} N...   937   0.0  
SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly...   291   2e-92
Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {O...   285   4e-90
KLLA0D01507g Chr4 (133636..135183) [1548 bp, 515 aa] {ON} weakly...   280   7e-88
Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {O...    87   9e-18
KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8....    82   4e-16
TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {O...    82   5e-16
Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON} (10059.....    80   2e-15
Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C ...    79   4e-15
Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {...    79   5e-15
Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}...    77   1e-14
CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa] ...    77   1e-14
Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C...    77   2e-14
Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {...    77   2e-14
YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON} ...    77   2e-14
NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}     77   3e-14
ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly...    76   4e-14
KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly...    75   1e-13
SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {...    74   2e-13
NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {O...    74   2e-13
TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON} Anc_8...    70   4e-12
KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly...    69   9e-12
TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.6...    68   1e-11
KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {O...    66   5e-11
ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic ho...    64   3e-10
SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {...    63   9e-10
CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {...    59   1e-08
YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspart...    58   3e-08
Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)        56   6e-08
CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {...    55   2e-07
YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}  ...    55   2e-07
ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {...    54   7e-07
ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic ho...    51   3e-06
Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)    51   3e-06
AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic ...    51   4e-06
Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)        50   4e-06
ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {...    51   5e-06
KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON}             51   6e-06
Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C...    49   8e-06
TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8....    50   9e-06
CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} simila...    50   1e-05
TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.3...    50   1e-05
Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {...    50   1e-05
Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W ...    50   1e-05
NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa] ...    49   2e-05
Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144...    49   3e-05
SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weak...    48   4e-05
AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic ho...    47   5e-05
Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C (...    47   6e-05
AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON} ...    46   8e-05
Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR0...    47   9e-05
CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa] ...    46   2e-04
NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {O...    45   3e-04
CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} simila...    45   3e-04
CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {...    45   4e-04
ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {...    45   5e-04
KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON}               44   5e-04
YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON} ...    44   7e-04
Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}...    44   9e-04
KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.3...    43   0.001
KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]...    43   0.002
Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W ...    42   0.002
KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON}               42   0.002
KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON}               42   0.002
NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {O...    42   0.002
ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} simila...    40   0.010
Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {...    40   0.010
Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON} (50979....    40   0.014
CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} simila...    39   0.026
SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} simi...    39   0.028
Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {O...    39   0.032
KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa] ...    38   0.051
ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]...    38   0.054
Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON...    38   0.059
CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa] ...    38   0.071
NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON}               37   0.085
KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {O...    37   0.092
Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar t...    37   0.097
ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {...    37   0.100
CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {...    37   0.11 
TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON}                 37   0.14 
KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {O...    37   0.15 
ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {...    36   0.16 
YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}  ...    36   0.27 
Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {...    36   0.27 
TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {O...    36   0.29 
Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {...    35   0.32 
CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {...    35   0.32 
Suva_9.186 Chr9 (310161..310220,310267..310332,310362..310451,31...    35   0.36 
Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W ...    35   0.40 
YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON} ...    35   0.66 
KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.1...    34   0.68 
ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {...    34   0.84 
TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {O...    33   1.4  
SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some s...    33   1.6  
TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa] ...    32   2.6  
KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly...    32   3.1  
TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.1...    32   3.1  
Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {...    32   3.7  
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...    32   4.2  
TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.3...    32   5.7  
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...    31   6.9  
KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON}               31   8.1  
Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C...    31   8.4  
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...    31   8.7  

>ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
          Length = 494

 Score =  937 bits (2421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/480 (95%), Positives = 459/480 (95%)

Query: 1   MSWAKLVLVCSFTYALCLHLATQNRFLEATETSRIYKLLAPTRIVSEIKTSADDSTGSTL 60
           MSWAKLVLVCSFTYALCLHLATQNRFLEATETSRIYKLLAPTRIVSEIKTSADDSTGSTL
Sbjct: 1   MSWAKLVLVCSFTYALCLHLATQNRFLEATETSRIYKLLAPTRIVSEIKTSADDSTGSTL 60

Query: 61  LKYNRSGAETKKSAQCNSLTFRPNISLLKRDPLSRVHIIQATFGGVSYPLVLDTGSAISW 120
           LKYNRSGAETKKSAQCNSLTFRPNISLLKRDPLSRVHIIQATFGGVSYPLVLDTGSAISW
Sbjct: 61  LKYNRSGAETKKSAQCNSLTFRPNISLLKRDPLSRVHIIQATFGGVSYPLVLDTGSAISW 120

Query: 121 VYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLYTGTLSINGLKIQDF 180
           VYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLYTGTLSINGLKIQDF
Sbjct: 121 VYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLYTGTLSINGLKIQDF 180

Query: 181 RFGVAIGVPSLLDAYALSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSES 240
           RFGVAIGVPSLLDAYALSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSES
Sbjct: 181 RFGVAIGVPSLLDAYALSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSES 240

Query: 241 RNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPS 300
           RNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPS
Sbjct: 241 RNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPS 300

Query: 301 IDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSEPIHLELSKH 360
           IDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSEPIHLELSKH
Sbjct: 301 IDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSEPIHLELSKH 360

Query: 361 NWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGF 420
           NWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGF
Sbjct: 361 NWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGF 420

Query: 421 ANRNTKATLVHNEPQNYYEKNNSSLQMVXXXXXXXXXXXXXXXXXXXXXKNIAYTPRPHP 480
           ANRNTKATLVHNEPQNYYEKNNSSLQMV                     KNIAYTPRPHP
Sbjct: 421 ANRNTKATLVHNEPQNYYEKNNSSLQMVSTSSDTTSSAAATSLHVSSTSKNIAYTPRPHP 480

>SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A),
           required for the posttranslational precursor maturation
           of vacuolar proteinases; synthesized as a zymogen,
           self-activates
          Length = 506

 Score =  291 bits (745), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 164/427 (38%), Positives = 249/427 (58%), Gaps = 18/427 (4%)

Query: 15  ALCLHLATQNRFLEATETSRIYKLLAPTRIVSEIKTSADDSTGS--TLLKYNRSGAETKK 72
           AL     +++RFL+    +  Y++ A  +   E  TS  +  GS  T   Y  +      
Sbjct: 18  ALGFFPTSRDRFLQ---DNSCYEVNALNKQHEE-ATSLGNFAGSSYTPQHYKDTAVSNSS 73

Query: 73  SAQCNSLTFRPNISLLKRDPLSRVHIIQATFGGVSYPLVLDTGSAISWVYGVNSSSSANH 132
           +     +  +P IS+L+ D  S+ + +  T G V+YPL++DTGSA  WVYG +S +S++ 
Sbjct: 74  NETFAKIQVKPGISILQSDEHSQAYFVDVTIGDVAYPLIIDTGSAYLWVYG-DSCNSSSC 132

Query: 133 KARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLYTGTLSINGLKIQD-FRFGVAIGVPSL 191
           K R+ F   +    V    F++ Y SG A G +Y   + +N L   D F FGVA  VP +
Sbjct: 133 KGRKLFPTTNVLQDVAS--FSLAYTSGVAVGDVYHDRIIVNELATTDNFTFGVASEVPDI 190

Query: 192 LDAYALSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSES--------RNL 243
            + Y  SGIFGLPSD + S  +++  L+ S  I+ + FS+L+ HI +E         ++L
Sbjct: 191 FENYPASGIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDL 250

Query: 244 DDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDK 303
             N G+   G+ L  LY+GE+ Y  L+P+  ++W + I   Y+   +V     +N +  K
Sbjct: 251 TSNKGIFAIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTGSK 310

Query: 304 NIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSEPIHLELSKHNWT 363
           +   RS IID+G+TL++LP++DAL +H+YF +SI+DG NFAI CNS++ + LE    NWT
Sbjct: 311 SHNTRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIMCNSTQTLTLEFDNKNWT 370

Query: 364 ILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFANR 423
           I    ++G+ Y +DS Y GYCVSNIQG DI  +WILG+VFL+ +Y VFD+E +++GFA  
Sbjct: 371 IPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEG 430

Query: 424 NTKATLV 430
           N  A LV
Sbjct: 431 NENALLV 437

>Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {ON}
           similar to Ashbya gossypii ABL123C
          Length = 481

 Score =  285 bits (728), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 163/426 (38%), Positives = 238/426 (55%), Gaps = 17/426 (3%)

Query: 15  ALCLHLATQNRFLEATETSRIY--KLLAPTRIVSEIKTSADDSTGSTLLKYNRSGAETKK 72
           +L    +++ RFL   +  ++       P   V  ++   + S G          A+  K
Sbjct: 15  SLAFFPSSERRFLHNGKVGKVATADFWFPNEQVPSVRVGREFSFGD-------DSADAVK 67

Query: 73  SAQCNSLT-----FRPNISLLKRDPLSRVHIIQATFGGVSYPLVLDTGSAISWVYGVNSS 127
            A  + L        P I++L RD  S  +I+  T     Y L+LDTGSA  WVYG +S 
Sbjct: 68  QAADDVLDPTYVHLSPAITILTRDSNSHAYIVNVTISDEEYSLILDTGSAFPWVYG-DSC 126

Query: 128 SSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLYTGTLSINGLKIQD-FRFGVAI 186
           S    + R+ +       TV  S F + Y  G   G ++  +  IN L   + F FGVA 
Sbjct: 127 SLRACEGRKLYPTGGKQ-TVNGSTFRLDYPYGITSGAIFQDSFIINNLNTSETFAFGVAT 185

Query: 187 GVPSLLDAYALSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDN 246
            VP + + Y +SGI GLP++   +    + +L  SK I  + F++ L HI SE+  L+ N
Sbjct: 186 SVPQMFENYPVSGILGLPANSPGTVEPALSVLYRSKSIRSQKFTLYLDHIESENTTLNAN 245

Query: 247 NGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIG 306
           +GL   GEP+  LY+G++ Y+ LV NP N+WL+AI   +  S  V     +N +  ++  
Sbjct: 246 SGLFAIGEPITELYKGDIYYSELVVNPNNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRS 305

Query: 307 IRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSEPIHLELSKHNWTILP 366
            RSGIID+GST +VLP+ DAL +HSY   SI+DG  FA++CNS+  +  EL   NWTI  
Sbjct: 306 KRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDGNYFAVFCNSTVDLTFELGNKNWTIPA 365

Query: 367 SNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFANRNTK 426
           S+++GEPY + S Y GYCVSNI+G  I SSWILG+VF+++ YTVFD++ +QVGFA +N+ 
Sbjct: 366 SSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKNSN 425

Query: 427 ATLVHN 432
             LV N
Sbjct: 426 VNLVQN 431

>KLLA0D01507g Chr4 (133636..135183) [1548 bp, 515 aa] {ON} weakly
           similar to uniprot|Q12303 Saccharomyces cerevisiae
           YLR121C YPS3 Aspartic protease
          Length = 515

 Score =  280 bits (716), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 150/383 (39%), Positives = 232/383 (60%), Gaps = 13/383 (3%)

Query: 60  LLKYNRSGAETKKSAQCN-SLTFRPNISLLKRDPLSRVHIIQATFGGVSYPLVLDTGSAI 118
           L K    G  T KS+  N  +  +P +S+L  D  ++ + +  T G   YPLV+D+GSA 
Sbjct: 65  LSKQALQGQATAKSSTKNVEVPVKPGMSILSTDSNTQAYFVNVTIGDEIYPLVVDSGSAY 124

Query: 119 SWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLYTGTLSINGLKI- 177
            WVYG + +S +   + + F   +      +S F++ Y SGTA G +Y   + +N L   
Sbjct: 125 LWVYGSSCTSKS-CTSNKLFSTDNVKRAADESTFSLIYSSGTASGDVYEDRIIVNKLATT 183

Query: 178 QDFRFGVAIGVPSLLDAYALSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIP 237
           Q+F FGVA  VP + + Y +SGIFGLPS+ +D+  S++ +L  S  I+ + FS+++  + 
Sbjct: 184 QNFTFGVANEVPDIFENYPVSGIFGLPSNNSDNIESIISVLSESNAISMEKFSLIIGALN 243

Query: 238 SESRN----------LDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIG 287
           S+             L +N GL + G+ +  LY G++ Y  L+ N  ++W + I + Y+ 
Sbjct: 244 SKDNTTSEDSALQAPLTENKGLFIIGDLVEDLYTGDIHYASLITNENHYWQLKIDSVYVN 303

Query: 288 SERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYC 347
           S+ V   T++  +  ++  IRSGI+D+G+TL++LP +DAL LH++F +S+SDG NFAI C
Sbjct: 304 SQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLILPTQDALDLHTFFVNSVSDGTNFAIPC 363

Query: 348 NSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDL 407
           NS+E + LE++   W I    ++GE YP+DS Y GYCVSNIQG ++  SWILG VFL+D 
Sbjct: 364 NSTEILSLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWILGAVFLKDK 423

Query: 408 YTVFDIEGRQVGFANRNTKATLV 430
           Y VFD++ +Q G AN+N  A LV
Sbjct: 424 YAVFDVQNQQFGLANKNENAILV 446

>Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {ON}
           complement(35798..36997) [1200 nt, 400 aa]
          Length = 399

 Score = 87.0 bits (214), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 88/325 (27%), Positives = 138/325 (42%), Gaps = 36/325 (11%)

Query: 108 YPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLYT 167
           + ++LDTGS+  WV  V  SS A +   +   + S++     S F I Y SG+  G +  
Sbjct: 99  FKVILDTGSSNLWVPSVGCSSLACYLHSKYDHSLSSTYRSNGSDFVIQYGSGSLKGYISQ 158

Query: 168 GTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVGLLQG--SKLI 224
            TL+I  L I    F  A   P L  A+    GI GL  D    + +V  L       L+
Sbjct: 159 DTLTIGDLIIPQQDFAEATAEPGLAFAFGKFDGILGLAYDSISVNKAVPPLYNAIHRGLL 218

Query: 225 NKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAA 284
           +K  F+  L    S       N G   FG    + +EGE+ + P+    + +W V     
Sbjct: 219 DKPMFAFYLGDEKSSK-----NGGEATFGGYDPSRFEGEIKWLPV--RRKAYWEVQFDGI 271

Query: 285 YIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFA 344
            +G + ++L                  IDTG++L+ LP + A  L++      S    + 
Sbjct: 272 KLGDKFMKLEG------------HGAAIDTGTSLITLPSQIADFLNNEIGAKKSWNGQYT 319

Query: 345 IYCNSSE---PIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD----ISSSW 397
           I C   E    + L    HN+TI P ++  E        +G C+S I   D    +    
Sbjct: 320 IDCKKRESLPKLTLNFYNHNFTIDPFDYTLE-------ISGSCISAITPMDFPQPVGPLS 372

Query: 398 ILGEVFLQDLYTVFDIEGRQVGFAN 422
           I+G+ FL+  Y+++D+E   VG A 
Sbjct: 373 IIGDAFLRRFYSIYDLENNAVGLAK 397

>KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8.677
           YPL154C
          Length = 415

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 81/325 (24%), Positives = 139/325 (42%), Gaps = 35/325 (10%)

Query: 108 YPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLYT 167
           + ++LDTGS+  WV      S A     +   + S+S     + F+I Y SG+  G +  
Sbjct: 114 FKVILDTGSSNLWVPSSECGSLACFLHEKYDHSASSSYKANGTDFSIQYGSGSLEGYISQ 173

Query: 168 GTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVGLLQG--SKLI 224
            TLSI  L I    F  A   P L  A+    GI GL  D    D  V          L+
Sbjct: 174 DTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLAYDTISVDKVVPPFYNALEQDLL 233

Query: 225 NKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAA 284
           ++  F+  L     ++    ++ G  +FG    + Y G++++ P+    + +W V ++  
Sbjct: 234 DEAKFAFYLGDTNKDA----EDGGEAIFGGVDKSKYTGDVTWLPV--RRKAYWEVKLEGL 287

Query: 285 YIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFA 344
            +G E  EL +                IDTG++L+ LP   A  ++S           + 
Sbjct: 288 GLGDEYAELES------------HGAAIDTGTSLITLPSGLAEIINSEIGAKKGWTGQYT 335

Query: 345 IYCNSSEP---IHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD----ISSSW 397
           + CN+ +    +    + +N+TI P ++  E        +G C+S I   D    +    
Sbjct: 336 LECNTRDQLPDLTFNFNGYNFTIGPYDYTLE-------VSGSCISAITPMDFPEPVGPLA 388

Query: 398 ILGEVFLQDLYTVFDIEGRQVGFAN 422
           I+G+ FL+  Y+++D+E   VG A 
Sbjct: 389 IVGDAFLRKYYSIYDLEHNAVGLAK 413

>TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {ON}
           Anc_8.677 YPL154C
          Length = 413

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 83/322 (25%), Positives = 131/322 (40%), Gaps = 29/322 (9%)

Query: 107 SYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLY 166
           S+ +VLDTGS+  WV      S A +   +     S++     S F I Y SG+  G + 
Sbjct: 111 SFKVVLDTGSSNLWVPSKECGSLACYLHSKYNHDESSTYKANGSAFAIQYGSGSLEGYIS 170

Query: 167 TGTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVGLLQG--SKL 223
              + I  LKI    F  A   P +  A+    GI GL  D    +  V  +       L
Sbjct: 171 QDVMEIGDLKITKQDFAEATSEPGISFAFGKFDGILGLAYDTIAVNRVVPPVYNAINQGL 230

Query: 224 INKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKA 283
           +++  F+  L     ++    DN G  VFG      +EG++++ P+    + +W V ++ 
Sbjct: 231 LDEPKFAFYL----GDASKSKDNGGEAVFGGIDETKFEGDITWLPV--RRKAYWEVKLEG 284

Query: 284 AYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNF 343
             +G E  EL                  IDTG++L+ LP   A  ++S           +
Sbjct: 285 LGLGEEYTELEN------------HGAAIDTGTSLITLPSGLAEIINSEIGAKKGWTGQY 332

Query: 344 AIYCNSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD----ISSSWIL 399
            I C+        L    +T    NF   PY      +G C+S I   D    +    I+
Sbjct: 333 TIECDK----RASLPDMTFTFDGYNFTISPYDYTLEVSGSCISAITPMDFPEPVGPMAII 388

Query: 400 GEVFLQDLYTVFDIEGRQVGFA 421
           G+ FL+  Y+V+D+    VG A
Sbjct: 389 GDAFLRKYYSVYDLGNDAVGLA 410

>Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON}
           (10059..11267) [1209 nt, 403 aa]
          Length = 402

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 140/324 (43%), Gaps = 34/324 (10%)

Query: 107 SYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTD--SIFTIFYRSGTAHGP 164
           S+ ++LDTGS+  WV  V+ +S A +    A   HS+S T     + F+I Y SG+  G 
Sbjct: 101 SFKVILDTGSSNLWVPSVDCNSLACY--LHAKYDHSDSSTYKKNGTTFSIQYGSGSMEGY 158

Query: 165 LYTGTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVGLLQG--S 221
           +    L I  L I    F  A   P L  A+    GI GL  D    +  V         
Sbjct: 159 ISQDVLQIGDLVIPGQDFAEATSEPGLAFAFGKFDGILGLAYDTIAVNRVVPPFYNAINK 218

Query: 222 KLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAI 281
           KL+++  FS  L     ++++ D   G + FG    +L+ G++++ P+    + +W V  
Sbjct: 219 KLVDEPIFSFYLG---DDTKSED--GGQVTFGGYDSSLFTGDITWLPV--RRKAYWEVKF 271

Query: 282 KAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGK 341
            A  +G+E  +L                  IDTG++L+ LP   A  ++S      S   
Sbjct: 272 DAIALGNEVADLVN------------HGAAIDTGTSLITLPSGLAEVINSQIGAKKSWSG 319

Query: 342 NFAIYCNSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD----ISSSW 397
            + + C + +     L    +T    NF   PY      +G C+S I   D    +    
Sbjct: 320 QWIVDCKTRD----TLPDMTFTFDGYNFTITPYDYTLEVSGSCISAITPMDFPAPVGPLA 375

Query: 398 ILGEVFLQDLYTVFDIEGRQVGFA 421
           I+G+ FL+  Y+++D+    VG A
Sbjct: 376 IVGDAFLRRYYSIYDVGNNAVGLA 399

>Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C
           (REAL)
          Length = 405

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 80/325 (24%), Positives = 137/325 (42%), Gaps = 35/325 (10%)

Query: 107 SYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLY 166
           ++ ++LDTGS+  WV      S A     +     S+S     + F I Y +G+  G + 
Sbjct: 103 NFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGYIS 162

Query: 167 TGTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVGLLQG--SKL 223
             TLSI  L I    F  A   P L  A+    GI GL  D    D  V          L
Sbjct: 163 QDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDL 222

Query: 224 INKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKA 283
           +++K F+  L     +S    +N G   FG    + ++G++++ P+    + +W V  + 
Sbjct: 223 LDEKKFAFYLGDTSKDS----ENGGEATFGGIDESKFKGDITWLPV--RRKAYWEVKFEG 276

Query: 284 AYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNF 343
             +G E  EL +                IDTG++L+ LP   A  +++           +
Sbjct: 277 IGLGDEYAELES------------HGAAIDTGTSLITLPSGLAEMINAELGAKKGWTGQY 324

Query: 344 AIYCNSSEPIH---LELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD----ISSS 396
            + CN+ + +       + +N+TI P ++  E        +G C+S I   D    +   
Sbjct: 325 TLDCNTRDSLPDLIFNFNGYNYTIGPYDYTLE-------VSGSCISAITPMDFPEPVGPL 377

Query: 397 WILGEVFLQDLYTVFDIEGRQVGFA 421
            I+G+ FL+  Y+++D+    VG A
Sbjct: 378 AIIGDAFLRKYYSIYDLGNNAVGLA 402

>Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {ON}
           YPL154C (REAL)
          Length = 406

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 81/326 (24%), Positives = 137/326 (42%), Gaps = 35/326 (10%)

Query: 107 SYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLY 166
           ++ ++LDTGS+  WV      S A     +     S+S     + F I Y +G+  G + 
Sbjct: 104 NFKVILDTGSSNLWVPSTECGSLACFLHSKYDHEASSSYKPNGTEFAIQYGTGSLEGYIS 163

Query: 167 TGTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVGLLQG--SKL 223
             TLSI  L I    F  A   P L  A+    GI GL  D    D  V          L
Sbjct: 164 QDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDL 223

Query: 224 INKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKA 283
           +++K F+  L     +S    +N G   FG    + ++G++++ P+    + +W V  + 
Sbjct: 224 LDEKKFAFYLGDTSKDS----ENGGEATFGGIDKSKFKGDVTWLPV--RRKAYWEVKFEG 277

Query: 284 AYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNF 343
             +G E  EL                  IDTG++L+ LP   A  +++           +
Sbjct: 278 IGLGHEFAELEG------------HGAAIDTGTSLITLPSGLAEMINAEIGAKKGWSGQY 325

Query: 344 AIYCNSSE---PIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD----ISSS 396
           A+ CN+ +    +    + +N+TI P ++  E        +G C+S I   D    +   
Sbjct: 326 ALDCNTRDGLPDLTFNFNGYNFTIGPYDYTLE-------VSGSCISAITPMDFPEPVGPL 378

Query: 397 WILGEVFLQDLYTVFDIEGRQVGFAN 422
            I+G+ FL+  Y+++D+    VG A 
Sbjct: 379 AIIGDAFLRKYYSIYDLGNDAVGLAE 404

>Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii ACR144W ACR143W
          Length = 415

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 84/322 (26%), Positives = 142/322 (44%), Gaps = 27/322 (8%)

Query: 107 SYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLY 166
           S+ +V+DTGS+  WV   N  S A     +     S+S    DS F++ Y  G+  G + 
Sbjct: 113 SFKVVMDTGSSNLWVPNKNCVSEACLNHARFDHDRSSSYAKNDSRFSVSYGKGSMEGFVS 172

Query: 167 TGTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVGLLQG--SKL 223
             TL I  L I++  F  A   P     Y    GI GL  D    +  V    +     L
Sbjct: 173 YDTLKIGDLTIKNQGFAEATVEPGSAFVYGQFDGILGLAYDGLAVNHIVPPFYEAVHQGL 232

Query: 224 INKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKA 283
           +++  F+  LS    + +  D   G +VFG      + GE+S+ P++   + +W V + +
Sbjct: 233 LDEPVFAFYLS----DEKKGDSLAGEVVFGGYDETKFTGEISWLPVIR--KAYWEVELNS 286

Query: 284 AYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSIS--DGK 341
             +GS++ +L         +N G   G +DTG++ +  P E      S    ++   DG 
Sbjct: 287 ITLGSQKFQL---------QNYG---GALDTGTSFITFPSELYQEFVSKTGATVDPDDGH 334

Query: 342 NFAIYCNSSEP-IHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILG 400
             A    S  P +  EL+  ++TI  S++V +    D       ++ +  G      I+G
Sbjct: 335 IIAPCSGSGFPDLTFELAGRSFTISSSDYVVQ---WDDTTCAVAITPLDLGGAGKMVIIG 391

Query: 401 EVFLQDLYTVFDIEGRQVGFAN 422
           +VFL+  Y+++D+    VG A 
Sbjct: 392 DVFLRRWYSIYDLSKNAVGLAK 413

>CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa]
           {ON} similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154c PEP4 aspartyl protease Saccharopepsin precursor
          Length = 415

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 83/324 (25%), Positives = 137/324 (42%), Gaps = 26/324 (8%)

Query: 108 YPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLYT 167
           + ++LDTGS+  WV  V+  S A     +   + S++        +I Y SG+  G +  
Sbjct: 104 FKVILDTGSSNLWVPSVDCGSLACFLHNKYDHSQSSTYIKDGRPLSISYGSGSIEGYISE 163

Query: 168 GTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVGLLQG--SKLI 224
             L I  L IQ+ +FG     P L  A+    GI GL  D    D             L+
Sbjct: 164 DNLQIGDLTIQNQKFGETTSEPGLAFAFGKFDGILGLAYDTIAQDDITPPFYSAIQQHLL 223

Query: 225 NKKSFSVLLSHI--PSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIK 282
           ++  FS  L  +  P+       + G+   G    + ++G+L   PL    Q +W V + 
Sbjct: 224 DESKFSFYLKSVNDPAAEGGSASDGGVFTLGGVDSSKFKGDL--IPLHVRRQAYWEVPLN 281

Query: 283 AAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKN 342
           A  +G +     T K     +N G     IDTG++L+ LP + A  +++           
Sbjct: 282 AIKLGDQS----TGKL----ENTG---AAIDTGTSLITLPSDMAEIINAQIGAKKGWTGQ 330

Query: 343 FAIYCNSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD----ISSSWI 398
           + + C++      +L    +T+   +FV  P+      +G C+S I   D    I    I
Sbjct: 331 YTLECST----RAKLPDLTFTLDGHDFVLSPFEYTLEVSGSCISVITPMDFPEPIGRMAI 386

Query: 399 LGEVFLQDLYTVFDIEGRQVGFAN 422
           LG+ FL+  Y+VFD++   V  A 
Sbjct: 387 LGDAFLRRYYSVFDLDANVVSLAE 410

>Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C
           (PEP4) - vacuolar proteinase A [contig 68] FULL
          Length = 412

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 83/330 (25%), Positives = 137/330 (41%), Gaps = 43/330 (13%)

Query: 107 SYPLVLDTGSAISWVYGVNSSSSA-------NHKARQAFVAHSNSCTVTDSIFTIFYRSG 159
           S+ ++LDTGS+  WV      S A       +H A  ++ A+  S       F I Y SG
Sbjct: 110 SFKVILDTGSSNLWVPSDECGSLACFLHSKYSHDASSSYKANGTS-------FAIQYGSG 162

Query: 160 TAHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVGLL 218
           +  G +   TLSI  L I    F  A   P L  A+    GI GL  D    D  V  + 
Sbjct: 163 SLEGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLGYDTISVDKVVPPVY 222

Query: 219 QG--SKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNH 276
           +     L+++  F+  L++    + + +++ G + FG    + Y+G++++ P+    + +
Sbjct: 223 KAINDGLLDEPRFAFYLNN----ADDSEESTGEVTFGGIDSSKYKGDITWLPV--RRKAY 276

Query: 277 WLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDS 336
           W V      +G E  EL                  IDTG++L+ LP   A  L+S     
Sbjct: 277 WEVKFDGIGLGDEYAELQGT------------GAAIDTGTSLIALPSGLAEVLNSEIGAK 324

Query: 337 ISDGKNFAIYCNSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD---- 392
                 + + C S +    +L    +T    NF    Y      +G C+S     D    
Sbjct: 325 KGWTGQYTVDCESRD----QLPDLTFTFNGKNFTITAYDYTLEVSGSCISAFTPMDFPEP 380

Query: 393 ISSSWILGEVFLQDLYTVFDIEGRQVGFAN 422
           +    I+G+ FL+  Y+++D+    VG A 
Sbjct: 381 VGPLAIIGDAFLRKFYSIYDLGNNAVGLAQ 410

>Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {ON}
           YPL154C (REAL)
          Length = 405

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 80/326 (24%), Positives = 136/326 (41%), Gaps = 35/326 (10%)

Query: 107 SYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLY 166
           ++ ++LDTGS+  WV      S A     +     S+S     + F I Y +G+  G + 
Sbjct: 103 NFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGYIS 162

Query: 167 TGTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVGLLQG--SKL 223
             TLSI  L I    F  A   P L  A+    GI GL  D    D  V          L
Sbjct: 163 QDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDL 222

Query: 224 INKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKA 283
           +++K F+  L     +S    +N G   FG    + ++G++++ P+    + +W V  + 
Sbjct: 223 LDEKKFAFYLGDTSKDS----ENGGEATFGGIDESKFKGDITWLPV--RRKAYWEVKFEG 276

Query: 284 AYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNF 343
             +G E  EL                  IDTG++L+ LP   A  +++           +
Sbjct: 277 IGLGDEYAELEG------------HGAAIDTGTSLITLPSGLAEMINAELGAKKGWTGQY 324

Query: 344 AIYCNSSEPIH---LELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD----ISSS 396
            + CN+ + +       + +N+TI P ++  E        +G C+S I   D    +   
Sbjct: 325 TLDCNTRDSLPDLIFNFNGYNFTIGPYDYTLE-------VSGSCISAITPMDFPEPVGPL 377

Query: 397 WILGEVFLQDLYTVFDIEGRQVGFAN 422
            I+G+ FL+  Y+++D+    VG A 
Sbjct: 378 AIVGDAFLRKYYSIYDLGNDAVGLAK 403

>YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON}
           PEP4Vacuolar aspartyl protease (proteinase A), required
           for the posttranslational precursor maturation of
           vacuolar proteinases; important for protein turnover
           after oxidative damage; synthesized as a zymogen,
           self-activates
          Length = 405

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/325 (24%), Positives = 137/325 (42%), Gaps = 35/325 (10%)

Query: 107 SYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLY 166
           ++ ++LDTGS+  WV      S A     +     S+S     + F I Y +G+  G + 
Sbjct: 103 NFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGYIS 162

Query: 167 TGTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVGLLQG--SKL 223
             TLSI  L I    F  A   P L  A+    GI GL  D    D  V          L
Sbjct: 163 QDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDL 222

Query: 224 INKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKA 283
           +++K F+  L     ++    +N G   FG    + ++G++++ P+    + +W V  + 
Sbjct: 223 LDEKRFAFYLGDTSKDT----ENGGEATFGGIDESKFKGDITWLPV--RRKAYWEVKFEG 276

Query: 284 AYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNF 343
             +G E  EL +                IDTG++L+ LP   A  +++           +
Sbjct: 277 IGLGDEYAELES------------HGAAIDTGTSLITLPSGLAEMINAEIGAKKGWTGQY 324

Query: 344 AIYCNSSE---PIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD----ISSS 396
            + CN+ +    +    + +N+TI P ++  E        +G C+S I   D    +   
Sbjct: 325 TLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLE-------VSGSCISAITPMDFPEPVGPL 377

Query: 397 WILGEVFLQDLYTVFDIEGRQVGFA 421
            I+G+ FL+  Y+++D+    VG A
Sbjct: 378 AIVGDAFLRKYYSIYDLGNNAVGLA 402

>NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}
          Length = 408

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 78/325 (24%), Positives = 136/325 (41%), Gaps = 35/325 (10%)

Query: 107 SYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLY 166
           S+ ++LDTGS+  WV  V   S A +   +     S+S     + F I Y +G+  G + 
Sbjct: 106 SFKVILDTGSSNLWVPSVECGSLACYLHSKYDHDKSSSYKPNGTDFAIRYGTGSLEGYIS 165

Query: 167 TGTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVGLLQG--SKL 223
             TL+I  L I    F  A   P L  A+    GI GL  D    +  V         +L
Sbjct: 166 QDTLNIGDLNIPKQDFAEATSEPGLTFAFGKFDGILGLAYDSISVNKVVPPFYNAIEQEL 225

Query: 224 INKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKA 283
           +++K F+  L     +S    ++ G I  G      ++G++ + P+    + +W V  + 
Sbjct: 226 LDEKKFAFYLGDANKKS----EDGGEITIGGIDKTKFKGDIDWLPV--RRKAYWEVKFEG 279

Query: 284 AYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNF 343
             +G +  EL                  IDTG++L+ LP   A  +++           +
Sbjct: 280 IGLGDQFAELEN------------HGAAIDTGTSLIALPSGLAEIINTEIGAKKGWTGQY 327

Query: 344 AIYCNSSE---PIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD----ISSS 396
            + C++      +    +  N+TI P ++  E        +G C+S I   D    +   
Sbjct: 328 TVECDARPNLPDLTFNFNGKNFTIGPYDYTLE-------VSGSCISAIMPMDFPEPVGPM 380

Query: 397 WILGEVFLQDLYTVFDIEGRQVGFA 421
            I+G+ FL+  Y+++D+E   VG A
Sbjct: 381 AIIGDAFLRKYYSIYDLENNAVGLA 405

>ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 418

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 85/326 (26%), Positives = 138/326 (42%), Gaps = 36/326 (11%)

Query: 107 SYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLY 166
           ++ ++LDTGS+  WV     SS A     +     S+S     + F I Y SG+  G + 
Sbjct: 117 NFKVILDTGSSNLWVPSTECSSLACFLHSKYDHDSSSSYKPNGTEFAIRYGSGSLEGYIS 176

Query: 167 TGTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVGLLQGSK--L 223
             TL++  L I    F  A   P L  A+    GI GL  D    D  V       K  L
Sbjct: 177 QDTLNLGDLSITKQDFAEATSEPGLQFAFGKFDGILGLGYDTISVDGVVPPFYNAWKQGL 236

Query: 224 INKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKA 283
           +++  F+  L     ES++     G+  FG    + YEGE+++ P+    + +W V    
Sbjct: 237 LDEPKFAFYLGR-DGESQD----GGVATFGGVDDSKYEGEITWLPI--RRKAYWEVKFDG 289

Query: 284 AYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNF 343
             +G E  EL                  IDTG++L+ LP   A  +++      S    +
Sbjct: 290 IGLGEEYAELEN------------HGAAIDTGTSLIALPSGLAEIINAEIGAKKSWTGQY 337

Query: 344 AIYCN--SSEP-IHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD----ISSS 396
            + C   SS P +   L  HN+ +   +++ E        +G C+S I   D    +   
Sbjct: 338 TVECEARSSLPNMTFTLGGHNFELTAYDYILE-------VSGQCISAIFPMDFPEPVGPL 390

Query: 397 WILGEVFLQDLYTVFDIEGRQVGFAN 422
            I+G+ FL+  Y+++D+    VG A+
Sbjct: 391 AIIGDSFLRKYYSIYDLGNNAVGLAD 416

>KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 417

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 133/323 (41%), Gaps = 29/323 (8%)

Query: 107 SYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLY 166
           S+ ++LDTGS+  WV      S A     +     S+S     + F I Y SG+  G + 
Sbjct: 115 SFKVILDTGSSNLWVPSDECGSLACFLHSKYSHDASSSYKANGTNFAIQYGSGSLEGYIS 174

Query: 167 TGTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVGLLQG--SKL 223
             TLSI  L I    F  A   P L  A+    GI GL  D    D  V  + +     L
Sbjct: 175 QDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLGYDTIAVDKVVPPVYKAINDGL 234

Query: 224 INKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKA 283
           +++  F+  L++    + + +++ G + FG    + Y+G +++ P+    + +W V    
Sbjct: 235 LDEPRFAFYLNN----ADDSEESTGEVTFGGIDSSKYKGNITWLPV--RRKAYWEVKFDG 288

Query: 284 AYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNF 343
             +G E  EL                  IDTG++L+ LP   A  L++           +
Sbjct: 289 IGLGDEYAELEGT------------GAAIDTGTSLIALPSGLAEVLNAEIGAKKGWSGQY 336

Query: 344 AIYCNSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD----ISSSWIL 399
            + C S +    +L    +T    NF    Y      +G C+S     D    +    I+
Sbjct: 337 TVDCESRD----QLPDLTFTFNGKNFTISAYDYTLEVSGSCISAFTPMDFPEPVGPLAII 392

Query: 400 GEVFLQDLYTVFDIEGRQVGFAN 422
           G+ FL+  Y+V+D+    VG A 
Sbjct: 393 GDAFLRKFYSVYDLGNNAVGLAQ 415

>SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|P07267 Saccharomyces
           cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
           (proteinase A) required for the posttranslational
           precursor maturation of vacuolar proteinases synthesized
           as a zymogen self-activates
          Length = 404

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 82/325 (25%), Positives = 132/325 (40%), Gaps = 36/325 (11%)

Query: 108 YPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLYT 167
           + ++LDTGS+  WV      S A     +     S+S     S F I Y SG+  G +  
Sbjct: 104 FKVILDTGSSNLWVPSAECGSLACFLHAKYDHDSSSSYKANGSSFAIQYGSGSLEGYISQ 163

Query: 168 GTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVGLLQG--SKLI 224
            TLSI  L I    F  A   P L  A+    GI GL  D    D  V  +     + L+
Sbjct: 164 DTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLAYDSISVDKVVPPVYNAIHNGLL 223

Query: 225 NKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAA 284
           ++  FS  L +    +     + G   FG    + YEG +++ P+    + +W V     
Sbjct: 224 DEPKFSFYLGNADKST-----DGGEATFGGIDSSKYEGNITWLPV--RRKAYWEVKFDGI 276

Query: 285 YIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFA 344
            +G E   L                  IDTG++L+ LP   A  L++           ++
Sbjct: 277 GLGDEYAILDG------------HGAAIDTGTSLIALPSGLAEILNAEIGAKKGWSGQYS 324

Query: 345 IYCNSSEP---IHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD----ISSSW 397
           + C++ +    + L    +N+TI P ++  E        +G C+S     D    +    
Sbjct: 325 VECDTRDSLPDLTLNFGGYNFTITPYDYTLE-------VSGSCISAFTPMDFPEPVGPLA 377

Query: 398 ILGEVFLQDLYTVFDIEGRQVGFAN 422
           I+G+ FL+  Y+V+D+    VG A 
Sbjct: 378 IIGDAFLRKHYSVYDLGNDAVGLAK 402

>NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {ON}
           Anc_8.677
          Length = 406

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 78/327 (23%), Positives = 138/327 (42%), Gaps = 39/327 (11%)

Query: 107 SYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLY 166
           ++ ++LDTGS+  WV     +S A     +     S+S     + F I Y SG+  G + 
Sbjct: 104 NFKVILDTGSSNLWVPSSECNSLACFLHSKYDHDASSSYKANGTKFAIQYGSGSLEGYIS 163

Query: 167 TGTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVV----GLLQGS 221
             TL+I  L I    F  A   P L  A+    GI GL  D    D  V      + QG 
Sbjct: 164 QDTLNIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLAYDTISVDKVVPPFYNAIEQG- 222

Query: 222 KLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAI 281
            L+++K F+  L     +++  + N G I  G    + ++G++ + P+    + +W V  
Sbjct: 223 -LLDEKKFAFYLG----DTKKDEKNGGEITIGGIDESKFKGDIEWLPV--RRKAYWEVKF 275

Query: 282 KAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGK 341
           +   +G +   L                  IDTG++L+ LP   A  +++          
Sbjct: 276 EGIALGDQYAALEN------------HGAAIDTGTSLITLPSGLAEIINTEIGAKKGWTG 323

Query: 342 NFAIYCNSSE---PIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSW- 397
            + + C++ +    +    +  N+TI P ++  E        +G C+S I   D      
Sbjct: 324 QYTLDCDTRDGLPDLTFNFNGKNFTISPFDYTLE-------VSGSCISAIMPMDFPEPMG 376

Query: 398 ---ILGEVFLQDLYTVFDIEGRQVGFA 421
              I+G+ FL+  Y+++D++   VG A
Sbjct: 377 PMAIVGDAFLRKYYSIYDLDNHAVGLA 403

>TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON}
           Anc_8.677 YPL154C
          Length = 408

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 85/326 (26%), Positives = 138/326 (42%), Gaps = 32/326 (9%)

Query: 107 SYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLY 166
           ++ ++LDTGS+  WV  V+  S A     +   + S+S     + F I Y SG+  G + 
Sbjct: 103 NFKVILDTGSSNLWVPSVDCGSLACFLHSKYDHSASSSYKPNGTDFAIQYGSGSLEGYIS 162

Query: 167 TGTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVGLLQG--SKL 223
             TLS+  L I    F  A   P L  A+    GI GL  +    D  V          L
Sbjct: 163 QDTLSVGDLVIPKQDFAEATSEPGLAFAFGKFDGILGLAYNTISVDKVVPPFYNAIDQDL 222

Query: 224 INKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKA 283
           +++  F+  L    S+S +   + G+  FG    + ++GE+S+ P+    + +W V  + 
Sbjct: 223 LDEPRFAFYLGDS-SDSEDSSVSGGVATFGGIDKSKFKGEISWLPV--RRKAYWEVKFEG 279

Query: 284 AYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNF 343
             +G E   L                  IDTG++L+ LP   A  ++S           +
Sbjct: 280 IGLGDEFAILDG------------HGAAIDTGTSLITLPSGLAEIINSEIGAKKGWSGQY 327

Query: 344 AIYCN--SSEP-IHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD----ISSS 396
            + C   SS P +    S  N+TI P ++  E        +G C+S I   D    +   
Sbjct: 328 TVDCETRSSLPDLTFNFSGKNYTIGPYDYTLE-------VSGSCISAITPMDFPEPVGPL 380

Query: 397 WILGEVFLQDLYTVFDIEGRQVGFAN 422
            I+G+ FL+  Y+V+D+    VG A 
Sbjct: 381 AIVGDTFLRRFYSVYDLGNNAVGLAK 406

>KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 409

 Score = 68.6 bits (166), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 80/326 (24%), Positives = 132/326 (40%), Gaps = 36/326 (11%)

Query: 107 SYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLY 166
           S+ ++LDTGS+  WV      S A     +     S++     S F I Y SG+  G + 
Sbjct: 108 SFKVILDTGSSNLWVPSAECGSLACFLHTKYDHEASSTYKANGSEFAIQYGSGSLEGYVS 167

Query: 167 TGTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVGLLQG--SKL 223
              L+I  L I D  F  A   P L  A+    GI GL  D    +  V  +     +KL
Sbjct: 168 RDLLTIGDLVIPDQDFAEATSEPGLAFAFGKFDGILGLAYDSISVNRIVPPVYNAIKNKL 227

Query: 224 INKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKA 283
           ++   F+  L        +  ++ G   FG      Y GE+++ P+    + +W V  + 
Sbjct: 228 LDDPVFAFYLG-----DSDKSEDGGEASFGGIDEEKYTGEITWLPV--RRKAYWEVKFEG 280

Query: 284 AYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNF 343
             +G E   L                  IDTG++L+ LP   A  L++           +
Sbjct: 281 IGLGEEYATLEG------------HGAAIDTGTSLIALPSGLAEILNAEIGAKKGWSGQY 328

Query: 344 AIYCNSSEP---IHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD----ISSS 396
           ++ C S +    + L  + +N+TI   ++  E        +G C+S     D    +   
Sbjct: 329 SVDCESRDSLPDLTLNFNGYNFTITAYDYTLE-------VSGSCISAFTPMDFPEPVGPL 381

Query: 397 WILGEVFLQDLYTVFDIEGRQVGFAN 422
            I+G+ FL+  Y+++DI    VG A 
Sbjct: 382 AIIGDAFLRKYYSIYDIGHDAVGLAK 407

>TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.677
           YPL154C
          Length = 419

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 75/326 (23%), Positives = 140/326 (42%), Gaps = 36/326 (11%)

Query: 107 SYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLY 166
           ++ ++LDTGS+  WV   + +S A +   +     S +     + FTI Y SG+  G + 
Sbjct: 116 NFKVILDTGSSNLWVPSKDCTSLACYLHSKYDHDESTTYEKNGTKFTIQYGSGSMDGYIS 175

Query: 167 TGTLSI-NGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVGLLQGSK-- 222
             TL I + L I +  F  A   P L  A+    GI GL  D    +  V       K  
Sbjct: 176 RDTLIIGDDLVIPEQDFAEATSEPGLAFAFGKFDGILGLAYDTIAVNKVVPPFYNAIKQG 235

Query: 223 LINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIK 282
           ++++  F+  L     ++++     G   FG    + + G++++ P+    + +W V   
Sbjct: 236 ILDENKFAFYLGDTNKDNKS----GGEATFGGYDKSKFTGDITWLPV--RRKAYWEVKFD 289

Query: 283 AAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKN 342
           +  +G E   L                  IDTG++L+ LP   A  +++      S    
Sbjct: 290 SIALGDEVASLDG------------YGAAIDTGTSLITLPSGLAEVINTQIGAKKSWSGQ 337

Query: 343 FAIYCNSSEPI---HLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD----ISS 395
           + I C++ + +       + +N+T+ P ++  E        +G C+S I   D    +  
Sbjct: 338 YTIDCDTRDALPDMTFNFNGYNFTVSPYDYTLE-------MSGSCISAITPMDFPEPVGP 390

Query: 396 SWILGEVFLQDLYTVFDIEGRQVGFA 421
             I+G+ FL+  Y+++D++   VG A
Sbjct: 391 LAIIGDAFLRKYYSIYDLDNNAVGLA 416

>KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {ON}
           Anc_8.677 YPL154C
          Length = 416

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 136/326 (41%), Gaps = 50/326 (15%)

Query: 105 GVSYPLVLDTGSAISWVYGVNSSSSA-------NHKARQAFVAHSNSCTVTDSIFTIFYR 157
           G ++ +++DTGS+  WV  V+ +S A       +H+    +V +          F I Y 
Sbjct: 109 GQTFRVIMDTGSSNLWVPSVDCNSLACFLHNKYDHRVSSTYVRNGTR-------FAIRYG 161

Query: 158 SGTAHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYA-LSGIFGLPSDPTDSDTSVVG 216
           SG   G +   T+++  L+I    F  A   P L  A+    GIFGL  D    + +V  
Sbjct: 162 SGALEGYMSNDTVTVGDLQIPKQDFAEATSEPGLAFAFGKFDGIFGLAFDTISVNRAVPP 221

Query: 217 LLQG--SKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQ 274
                   L++   F+  L       + L    G + FG      + G +++ P+    +
Sbjct: 222 FYNAVNRGLLDAPQFAFYLG-----DKRLRKEGGEVTFGGYDETRFTGNITWLPV--RRE 274

Query: 275 NHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFD 334
            +W V       GS+   L TA   +           IDTG++L+ LP   A  L++   
Sbjct: 275 AYWEVDFNGISFGSQYAPL-TATGAA-----------IDTGTSLITLPSGLAEILNAQIG 322

Query: 335 DSISDGKNFAIYCN--SSEP-IHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGG 391
              +    + + C+  S+ P I   L   N++I P ++  E        +G C+S I   
Sbjct: 323 ARKNWSGQYVLDCSRRSTLPDITFNLGGSNFSIGPYDYTLEA-------SGTCISAIVPM 375

Query: 392 D----ISSSWILGEVFLQDLYTVFDI 413
           D    +    I+G+ FL+  Y+V+D+
Sbjct: 376 DFPEPVGPLAIIGDAFLRRWYSVYDL 401

>ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 408

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 79/325 (24%), Positives = 138/325 (42%), Gaps = 36/325 (11%)

Query: 108 YPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLYT 167
           + +V+DTGS+  WV G    + A    ++     S++     ++  + Y SG+  G +  
Sbjct: 106 FRVVVDTGSSTLWVPGKECRAMACRLHKRYDHDRSSTYKENGTLTGVTYGSGSIMGYVSE 165

Query: 168 GTLSINGLKIQDFRFGVAIGVP-SLLDAYALSGIFGL--PSDPTDSDTSVVGLLQGSKLI 224
            T  I+ L+I   +F      P S+    A  GI GL  PS           L++  KL+
Sbjct: 166 DTFRISDLEIPGQQFTETTDEPGSVFVFAAFDGILGLAYPSLGYGVTPPFQQLME-KKLV 224

Query: 225 NKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAA 284
            +  F + L  + +      + NG +V G      ++GE+++ P+    Q +W V   + 
Sbjct: 225 KEPVFGMYLDDMKT-----GEGNGQLVLGGYDETKFKGEIAWLPV--RRQAYWEVVFDSV 277

Query: 285 YIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGK-NF 343
            +G + + L         +N G     ID+G++L+  P E      S       D + N 
Sbjct: 278 TVGDDNIPL---------ENYG---AAIDSGTSLITFPSELFNQFISKLSGVTKDRQGNV 325

Query: 344 AIYC---NSSEPIHLELSKHNWTILPSNFVGEPYPKDSP-YNGYCVSNIQGGDISSSW-- 397
            + C    ++ P+      H ++I      GE Y    P  +  C+  I   DI S+   
Sbjct: 326 YVDCANKQTAPPLTFGFGGHKFSI-----SGEDYIISVPGQSARCMPAIVQLDIDSAGKV 380

Query: 398 -ILGEVFLQDLYTVFDIEGRQVGFA 421
            I+G+VFL+  Y+++D     VG A
Sbjct: 381 AIIGDVFLRRYYSIYDFGNNAVGLA 405

>SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {ON}
           some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 542

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 89/352 (25%), Positives = 146/352 (41%), Gaps = 61/352 (17%)

Query: 110 LVLDTGSAISWVYGV----------------NSSSSANHKARQAFVAHSNSCTVT--DSI 151
           ++LDTGS+  WV G                 N + S    +R       NS T +  DS 
Sbjct: 75  VLLDTGSSDLWVTGSDNPYCLSNETTTEPSKNITKSVVDCSRYGTFEKDNSLTFSQSDSR 134

Query: 152 FTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYA-----LSGIFGLPS 205
           F I Y   T A+G      +S     I D +F VA    S +         L  + G   
Sbjct: 135 FQINYADNTFANGYWAKDVVSFGDNFIADMQFAVANETNSTVGVLGIGFERLESVKGYEG 194

Query: 206 DPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELS 265
            P     +    L+ + +I+K ++S+ L        +LD ++G I+FG      Y G+L 
Sbjct: 195 APNTYYQNFPLALKNNGVIDKTAYSLYL-------NSLDSSSGSILFGGIDSNKYTGDLY 247

Query: 266 YTPLVP------NPQNHWLVAIKAAYI---GSERVELPTAKNPSIDKNIGIRSGIIDTGS 316
             PLV       N    + V ++   +   GSE+  L + K P++          +D+G+
Sbjct: 248 TFPLVNIHPSVVNKPAKFHVTVQGIGVQSSGSEQSILMSTKYPAL----------LDSGT 297

Query: 317 TLVVLPQEDALALHSYFDDSISDGKN-FAIYC---NSSEPIHLELSKHNWTILPSNFVGE 372
           TL+V PQE A ++ +Y + + +D +  + + C   N       +       +   NF+  
Sbjct: 298 TLLVAPQEFADSMANYVNATYNDLEGIYTMTCPPENDDTEFLFDFGDLKIKVPLKNFILA 357

Query: 373 PYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFANRN 424
           P  +D+ Y G+ V          + ILG++FL   Y V+D+E  +V  A  N
Sbjct: 358 P--EDNEYCGFGVL-----PTVDTMILGDMFLSAAYVVYDLESYEVSLAQAN 402

>CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 482

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 80/303 (26%), Positives = 123/303 (40%), Gaps = 59/303 (19%)

Query: 152 FTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYALSGIFGLPSDPTDS 210
           FT+ Y   T A GP    TLS NG+K+ +  FG+A    S    + +S    LP+  T +
Sbjct: 142 FTLSYADTTFASGPWGVDTLSFNGVKVDNVTFGLAAFSNSTTPVFGIS----LPARETTN 197

Query: 211 DTSVVG---------------LLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEP 255
             +  G               LL+   ++ K ++SV L+   S+        G I+FG  
Sbjct: 198 QLAANGSRIGPNSYEYSNFPMLLKEQGIVKKIAYSVYLNDTRSKY-------GSILFGAV 250

Query: 256 LGALYEGELSYTPLVPNPQNHWLVAIKAAY---IGSERVELPTAKNPSIDKNIGIR---- 308
             + Y G L   PLV    N     +   +   I    + L TA     DKN  +     
Sbjct: 251 DQSKYIGTLYTLPLV----NSLYKQVSKPFQFEITLNGIGLQTA-----DKNYTLYDQKL 301

Query: 309 SGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSEPIHLEL--SKHNWTILP 366
           + ++DTG T  VLP + A  + S  + +I D   F         I L+   +K     + 
Sbjct: 302 ATLLDTGVTTSVLPAKVAALVASKVNGTIDDDNGF---------IKLDKCPNKKEKRTVV 352

Query: 367 SNFVGEPYPKD-----SPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFA 421
            NF G     D         G C   +Q  D      LG++FL+ +Y V+++E  ++  A
Sbjct: 353 FNFGGAEISIDIRDLTRKIKGKCYLQMQARDDIEFAALGDIFLRHVYVVYNLEDEEISIA 412

Query: 422 NRN 424
           N N
Sbjct: 413 NAN 415

>YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspartyl
           protease secreted into the periplasmic space of mating
           type a cells, helps cells find mating partners, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest
          Length = 587

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 90/373 (24%), Positives = 155/373 (41%), Gaps = 76/373 (20%)

Query: 107 SYPLVLDTGSAISWVY---------GVNSSSSANHKARQAFVAHSNSCT----------- 146
           S  ++ DTGSA  WV            N+SS +N       V  S  C            
Sbjct: 57  SLTVLFDTGSADFWVMDSSNPFCLPNSNTSSYSNATYNGEEVKPSIDCRSMSTYNEHRSS 116

Query: 147 ----VTDSIFTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVA------------IGVP 189
               + +  F I Y  GT A G   T T+SING+ I + +FGVA            IG P
Sbjct: 117 TYQYLENGRFYITYADGTFADGSWGTETVSINGIDIPNIQFGVAKYATTPVSGVLGIGFP 176

Query: 190 SLLDAYALSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGL 249
                     + G    P +   +   +L+  K+I+  ++S+ L        + D   G 
Sbjct: 177 RR------ESVKGYEGAPNEYYPNFPQILKSEKIIDVVAYSLFL-------NSPDSGTGS 223

Query: 250 IVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRS 309
           IVFG    + + G+L   P+V    N +   + A    +  ++   A+N S  ++    +
Sbjct: 224 IVFGAIDESKFSGDLFTFPMV----NEYPTIVDAPATLAMTIQGLGAQNKSSCEHETFTT 279

Query: 310 G----IIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIY-CNSSEPIHLELSKHNW-- 362
                ++D+G++L+  P+  A  + S+ + S S+ +   I  C    P+ +   ++N+  
Sbjct: 280 TKYPVLLDSGTSLLNAPKVIADKMASFVNASYSEEEGIYILDC----PVSVGDVEYNFDF 335

Query: 363 -----TILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQ 417
                ++  S+ +  P  + S    YC   +Q    + S +LG+VFL   Y VFD++  +
Sbjct: 336 GDLQISVPLSSLILSPETEGS----YCGFAVQ--PTNDSMVLGDVFLSSAYVVFDLDNYK 389

Query: 418 VGFANRNTKATLV 430
           +  A  N  A+ V
Sbjct: 390 ISLAQANWNASEV 402

>Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)
          Length = 342

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 133/291 (45%), Gaps = 41/291 (14%)

Query: 149 DSIFTIFYRSGTAHGPLY-TGTLSINGLKIQDFRFGVA-----------IGVPSLLDAYA 196
           D+ F   Y  GT +   Y T  +S+  + ++ F FGVA           I +P+  + ++
Sbjct: 2   DTQFDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTENQGGILGISLPAGENTHS 61

Query: 197 LSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPL 256
           L G +   + P + +   + L    K I K ++S+ L+   +       + G I+FG   
Sbjct: 62  LGGAYN--TTPFEYENFPMALKSHGK-IEKIAYSLFLNEPKA-------HFGSILFGAVD 111

Query: 257 GALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVEL--PTAKNPSIDKNIGIRSGII-D 313
            + Y G+L   P++        V+    ++ ++ V +    + N ++ K   +R  ++ D
Sbjct: 112 KSKYSGQLYTLPMLQAYDTLDSVS-PGMFVTAQSVAVLNGDSGNKTVSK---VRFPVLFD 167

Query: 314 TGSTLVVLPQEDALALHSYFDDSISDG-KNFAIYCNSSEP--IHLELSKHNWTILPSNFV 370
           +G+T   LP E A A+   FD   S G + +   C+  +   + ++    N +   SNFV
Sbjct: 168 SGTTYSSLPTEVAHAIGKSFDGKYSSGDQGYTFDCSKVKDTLLSIDFGGFNISANISNFV 227

Query: 371 GEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFA 421
                KD     +C+ NI+  D  S ++LG+ FL D Y VFD+E  +V  A
Sbjct: 228 TRT--KD-----HCLLNIEAAD--SGFVLGDAFLVDAYVVFDLESHEVSIA 269

>CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 82/324 (25%), Positives = 143/324 (44%), Gaps = 59/324 (18%)

Query: 135 RQAFVAHSNSCTVT--DSIFTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVA------ 185
           +  F   S S T +  D+ F++ Y   T A GP  T T+S+NG+K+++  FG+A      
Sbjct: 125 KYGFFNASGSSTYSRNDTNFSLSYGDETFASGPWGTDTISLNGVKVENVTFGLASFSNST 184

Query: 186 -----IGVPSLLDAYALSGIFGLPSDPTDSDTSV------VGLLQGSKLINKKSFSVLLS 234
                IG+P     YA+       S+ T+  T+       + L Q  K I+K ++S+ L+
Sbjct: 185 NPVFGIGLPGDESTYAMF------SEDTNGTTNTQYSNFPLQLKQQGK-IDKVAYSIYLN 237

Query: 235 HIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPN----PQNHWLVAIKAAYIGSER 290
              S+        G I+FG    + Y G L   P+V       +N + + +  + +G +R
Sbjct: 238 STKSK-------QGSILFGAVDHSKYSGPLYTLPIVNRFGHLVENPYELEVTLSGLGLQR 290

Query: 291 VELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYC--- 347
               T+     D+   +   ++DTG+T   +P   A  L +  +  I D K   I     
Sbjct: 291 A---TSNITLFDQ---LLPALLDTGTTYTYMPSSVAQYLANQTNGVI-DKKTSLIKLAKC 343

Query: 348 ---NSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFL 404
               S++ I    S     I   +FV +       + G C       + SS ++LG+ F+
Sbjct: 344 PSKKSNDTIVFNFSGAQIKIKMVDFVEK-------HKGKCYLPCVSQE-SSFFLLGDSFM 395

Query: 405 QDLYTVFDIEGRQVGFANRNTKAT 428
           + +YTVFD++ +++  A  N  +T
Sbjct: 396 RHVYTVFDLDDKEISIAQANFNST 419

>YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}
           YPS6Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance
          Length = 537

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 84/313 (26%), Positives = 134/313 (42%), Gaps = 67/313 (21%)

Query: 142 SNSCTVTD--SIFTIFYRSGTAHGPLY-TGTLSINGLKIQDFRFGVA---IGVPSLLDAY 195
           SNS T  +  + F   Y  GT +   Y T  +S   + + DF FGV+   IG PS     
Sbjct: 148 SNSSTFENNATFFNNTYGDGTYYAGTYGTDVVSFENITLNDFTFGVSNDTIGNPS----- 202

Query: 196 ALSGIFGLP---SDPTDSDTSVVGL-------------LQGSKLINKKSFSVLLSHIPSE 239
              GI G+    ++ TD     + L             L+    INK ++S+ L      
Sbjct: 203 ---GILGISLPIAEFTDGIEYALALNRTPFIYDNFPMELKNQGKINKIAYSLFL------ 253

Query: 240 SRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNP 299
               D + G I+FG    + Y G+L   P+        L A     +GS    + TA++ 
Sbjct: 254 -NGPDAHFGSILFGAVDKSKYTGQLYTLPM--------LQAFNT--LGSNPGMIITAQSV 302

Query: 300 SI-DKNIGIRSG-------IIDTGSTLVVLPQEDALALHSYFDDSIS-DGKNFAIYCNSS 350
           +I D   G ++        ++D+G+T   LP E A A+   FD   S D + +   C+  
Sbjct: 303 AILDSESGNKTVSDIQFPVMLDSGTTFSYLPTEIAEAIGKSFDGEYSSDDQGYIFDCSKV 362

Query: 351 EP--IHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLY 408
               + ++    N +   SNFV     KD      CV N++  +  S+++LG+ FL D Y
Sbjct: 363 NDTLLSVDFGGFNISANISNFVTSA--KDR-----CVLNVKQSE--STYMLGDAFLVDAY 413

Query: 409 TVFDIEGRQVGFA 421
            V+D+E  ++  A
Sbjct: 414 VVYDLENYEISIA 426

>ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 506

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 69/304 (22%), Positives = 128/304 (42%), Gaps = 43/304 (14%)

Query: 143 NSCTVTDSIFTIFYRSGTAHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYALS---- 198
           N     D  F  +  +  A G   T  L++  + ++D    VA    S +  + +S    
Sbjct: 192 NKNDTVDGFFIEYGDNSYASGYWATDDLTVGDISVKDMTIAVADDTNSSVAVFGISYRGL 251

Query: 199 --GIFGLP-SDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEP 255
              +FG    DP + +     LL+   ++ + ++S+ L+   +       ++G I+FG  
Sbjct: 252 ESSVFGDNLQDPHEYENFPY-LLKDQGIVKRNAYSLYLNSAGA-------SDGNILFGGV 303

Query: 256 LGALYEGELSYTPLVP-----NPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSG 310
               Y G+L   P++      +P   ++V ++   I     +      P I        G
Sbjct: 304 DHNKYSGDLYTLPVLKGQEDSDPWERFVVTVQGIGIKGSETQNTLTTTPFI--------G 355

Query: 311 IIDTGSTLVVLPQEDALALHSYFDDSISDG---KNFAIYCNSS-EPIHLELSKHNWTILP 366
           ++D+G+T V LP+  A  + + +  S  D    +++ I C S  E I       N     
Sbjct: 356 LLDSGTTAVYLPEPVADMVANAYGGSFDDDPEVQSYVISCPSDDEKIVFNFGGFNIETSL 415

Query: 367 SNFVGEPYPKDSPYNGYCVSNIQGGDISSSW--ILGEVFLQDLYTVFDIEGRQVGFANRN 424
           SN++ +        NG C+ NI     +S +  ILG+ FL+D Y V+D++  ++  A  N
Sbjct: 416 SNYITDNG------NGQCILNIS---PTSDYMGILGDSFLRDSYVVYDMDNNEISLAQAN 466

Query: 425 TKAT 428
             +T
Sbjct: 467 FDST 470

>ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 393

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/322 (19%), Positives = 129/322 (40%), Gaps = 31/322 (9%)

Query: 107 SYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLY 166
           ++ + LDTGS++ W+     +S       +     S++   TD    + Y  G A   + 
Sbjct: 95  NFRVALDTGSSLLWIPSDRCTSQICRTRNRYRSGASSTFKATDKTLRLQYVKGDAKARVS 154

Query: 167 TGTLSINGLKIQDFRFGVAIGVPSLLDAYALSGIFGL--PSDPTDSDTSVVGLLQGSKLI 224
             TL   G KI++  FG A  +          GI G+  PS        +  L+    L 
Sbjct: 155 YDTLYFAGAKIENQGFGEAEAIGDDFSGARFDGIIGIGYPSIGYGIKPPINTLIDSGGL- 213

Query: 225 NKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAA 284
               F + +S+    ++N +   G IV G      ++G++ + P++   +  W   + A 
Sbjct: 214 KDPMFGIYISN----AQNRNSPVGEIVLGGYNTQKFKGDIKWLPVL--RKAFWETDLSAF 267

Query: 285 YIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFA 344
            +G+  +++               + + DTGS+ +++P++      S F  +  D     
Sbjct: 268 KVGNFALDVQGL------------TAVFDTGSSFIIMPEDTYTDFVSQFPGASHDDGTDY 315

Query: 345 IYC---NSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGD-ISSSWILG 400
           + C   NS   + L+       +   ++V +           C+  + G   ++   ILG
Sbjct: 316 VDCSTVNSGPDLTLDFGGVALKLSARDYVMQLGRNT------CILAVSGNSRVTGEVILG 369

Query: 401 EVFLQDLYTVFDIEGRQVGFAN 422
           + FL+  YT+++     +G A+
Sbjct: 370 DTFLRRYYTIYNFGDNTIGVAS 391

>Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)
          Length = 464

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 127/299 (42%), Gaps = 54/299 (18%)

Query: 149 DSIFTIFYRSGTAHGPLY-TGTLSINGLKIQDFRFGVA-----------IGVPSLLDAYA 196
           ++IF I Y     +   Y T  +S+  + + +F FGV+           + +PS+ +   
Sbjct: 155 ETIFNISYADNMYYAGTYGTDVVSLGNITLSNFTFGVSNDTKMSYGILGVSLPSVEETDD 214

Query: 197 LSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPL 256
           +       + P   +   + L    K I K ++S+ L+  PS         G I+FG   
Sbjct: 215 IEDALSSNTTPFVYENFPMALKSQGK-IEKIAYSLFLNE-PSARF------GSILFGAVD 266

Query: 257 GALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSG------ 310
            + Y G+L   P++          + A Y G       TA++ +I   I  +SG      
Sbjct: 267 KSKYSGQLYTLPML-----QAYNTLDALYSG----MFVTAQSAAI---IDSKSGNKTVSE 314

Query: 311 -----IIDTGSTLVVLPQEDALALHSYFDDSIS-DGKNFAIYCN--SSEPIHLELSKHNW 362
                + D+G++  VLP E A A+   FD   S D + +   C+  ++  + ++    N 
Sbjct: 315 VQFPVLFDSGTSTSVLPTEIADAIGRSFDGKYSSDDEGYIFDCSKVNNTQLSIDFGGFNI 374

Query: 363 TILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFA 421
           +   SNFV  P  KD     +CV  I   D  S  +LG+ FL D Y V+D+E  +V  A
Sbjct: 375 SANISNFV-TPLTKD-----HCVLQILPSDTVS--VLGDAFLVDTYVVYDLENHEVSVA 425

>AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL015W (BAR1)
          Length = 452

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 85/358 (23%), Positives = 143/358 (39%), Gaps = 70/358 (19%)

Query: 111 VLDTGSAISW------------------VYGVNSSSSANHKARQAFVAHSNSC-TVTDSI 151
           VLDTGSA  W                  V GV  + S + +  + F   S++   +  + 
Sbjct: 62  VLDTGSADLWLQAENNPFCVGAKDEKQEVRGVTVTPSIDCRGIKTFCNESSTTLRILPNP 121

Query: 152 FTIFYRSGTAHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYALSGIFGLPSDPTDSD 211
           F I Y      G   T  L I G  +   +FGV            LSG+ G+     +S 
Sbjct: 122 FYIDYADTFVDGSWATDRLVIGGHDVSGMKFGVG-----RTSNTELSGVLGVGHANLESV 176

Query: 212 TSVVGL-------------LQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGA 258
               G              L GS  + K ++SV L       +   + +G I+FG    +
Sbjct: 177 RGYAGAPNATYPNLPRQLKLDGS--VQKLAYSVSL-------QKTSERDGEILFGAIDTS 227

Query: 259 LYEGELSYTPLVP-----NPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIID 313
            Y G+L   P++      N  +++ +A++   I   R    +   P I+ +      ++D
Sbjct: 228 KYVGKLHTFPILNIDPHLNSPSNFYIALQGIDIQGGR---SSTGRPLINSSF---HALLD 281

Query: 314 TGSTLVV---LPQEDALALHSYFDDSISDGKNFAIYC---NSSEPIHLELSKHNWTILPS 367
           TG+  +V   L ++   AL++ +D   ++   F I C   + +   +    +    +  S
Sbjct: 282 TGTGGMVVSSLAEDIGAALNATYD---TEQCVFVIQCPTEDDTRQFNFNFGELQIAVPIS 338

Query: 368 NFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFANRNT 425
           NFV    P      G C   I  G  S ++ LG  FL+++YTVF++E  ++  A  NT
Sbjct: 339 NFV---VPASGLETGQCALAIMPG-TSETFALGIPFLKEVYTVFNLEDNEISMARANT 392

>Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)
          Length = 304

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 57/115 (49%), Gaps = 12/115 (10%)

Query: 311 IIDTGSTLVVLPQEDALALHSYFDDSISDG-KNFAIYCNSSEP--IHLELSKHNWTILPS 367
           + D+G+T   LP E A A+   FD   S G + +   C+  +   + ++    N +   S
Sbjct: 88  LFDSGTTYSSLPTEVAHAIGKSFDGKYSSGDQGYTFDCSKVKDTLLSIDFGGFNISANIS 147

Query: 368 NFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFAN 422
           NFV     KD     +C+ NI+  D  S ++LG+ FL D Y VFD+E  +V  A 
Sbjct: 148 NFVTRT--KD-----HCLLNIEAAD--SGFVLGDAFLVDAYVVFDLESHEVSIAQ 193

>ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 572

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 85/314 (27%), Positives = 134/314 (42%), Gaps = 61/314 (19%)

Query: 139 VAHSNSCTVTDSIFTIFYRSGT-AHGPLYTGTLSIN--GLKIQDFRFGVAIGVPSLLDAY 195
           V  S S     + F I Y  G+ A G  Y GT S+N   + ++   F VA    S +  +
Sbjct: 188 VNKSKSFRSNKTEFYISYGDGSFASG--YWGTDSVNFANMNLEGVSFAVANETNSTVGVF 245

Query: 196 ALSGIFGLPS-------DPTDSD------TSVVGLLQGSKLINKKSFSVLLSHIPSESRN 242
            +    GLP        DP+ +D       +   +L+    INK ++S+ L        +
Sbjct: 246 GI----GLPENEATYTPDPSLNDFHPYEYQNFPQVLKSKGAINKAAYSLFL-------NS 294

Query: 243 LDDNNGLIVFGEPLGALYEGELSYTPLV-------PNPQNHWLVAIKAAYI-GSERVELP 294
           LD ++G I+FG    + Y+G+L   PL+        NP    +      +  GS +    
Sbjct: 295 LDASSGDILFGAVDRSKYKGDLYTLPLLNSDPTKYKNPMEFDVTLQGVGFTNGSSKTTFT 354

Query: 295 TAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALA---LHSYFDDSISDGKNFAIYCNS-S 350
           T K P++          +D+G++L+ LP  DALA    H        D   + I C S +
Sbjct: 355 TTKIPAL----------LDSGTSLIYLP--DALAKGIAHKLGGSYNEDIGYYVIGCPSEN 402

Query: 351 EPIHLELSKHNWTI---LPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDL 407
           +   L      +TI   L +  +G P   D   +  CV  I   D+ +  ILG+VFL D 
Sbjct: 403 DDSQLVFDFGGFTIKNNLSNYLLGSP---DDGDDSQCVLGILPSDVQA--ILGDVFLADA 457

Query: 408 YTVFDIEGRQVGFA 421
           Y V+D++  +V  A
Sbjct: 458 YVVYDLDDYEVSLA 471

>KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON} 
          Length = 538

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 92/359 (25%), Positives = 146/359 (40%), Gaps = 72/359 (20%)

Query: 105 GVSYPLVLDTGSAISWVYGVN------SSSSANHKARQAF---------VAHSNSCTVTD 149
           G +  + +DTGS+  WV G N      S+ S    +R+ F            S++ +  +
Sbjct: 102 GQNVTVQIDTGSSDLWVTGSNNPYCNGSTFSDTVPSRELFNCSQYGTFNTNKSSTWSSNN 161

Query: 150 SIFTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVA-----------IGVPSLLDAYAL 197
           S F I Y   T A G      +SINGL +    F VA           IG+  L   Y  
Sbjct: 162 SRFFIQYGDTTFASGTWGRDVMSINGLNVTGLTFAVANASNSSNSVLGIGLTQLETTYN- 220

Query: 198 SGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLG 257
               G  S  + +  +   +L+ + L    S+S+ L+ + +ES       G I+FG    
Sbjct: 221 ----GSNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAES-------GSILFGAVDH 269

Query: 258 ALYEGELSYTPLV--------PNPQNHWLVAIKAAYI--GSERVELPTAKNPSIDKNIGI 307
           + Y G L   PLV        PNP   + V ++   I  GS++  +   K          
Sbjct: 270 SKYSGNLYTLPLVNTYKDRGFPNPI-EFAVTLQGIGIVSGSKKTTITQTK---------- 318

Query: 308 RSGIIDTGSTLVVLPQEDALALHSYFDDSIS---DGKNFAIYCNSSEPIHLELSKHNWTI 364
            + I+D+G++L VLP     ++ S  +   S   D    +    +S   +L      +TI
Sbjct: 319 LAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTI 378

Query: 365 --LPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFA 421
               SNF+ E        +  C+  +   D  +S ILG+ FL   Y V+D+E  Q+  A
Sbjct: 379 KGTLSNFILEIE------DDICILGLSSVD-ENSVILGDTFLASAYVVYDLENLQISMA 430

>Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C
           (REAL)
          Length = 227

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 58/122 (47%), Gaps = 27/122 (22%)

Query: 311 IIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSEPIHLELSKHNWTILPSNFV 370
           + D+G++   LP E A A+   FD     GK    Y + ++    + SK N T+L  +F 
Sbjct: 119 LFDSGTSTSALPTEIADAIGRSFD-----GK----YSSDNQGYIFDCSKVNNTLLSIDFG 169

Query: 371 G-----------EPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVG 419
           G            P  KD     +C+ NI+  D  S ++LG+ FL D Y VFD+E  +V 
Sbjct: 170 GFNISANISNSVTPITKD-----HCLLNIEADD--SGYVLGDAFLIDTYVVFDLESHEVS 222

Query: 420 FA 421
            A
Sbjct: 223 VA 224

>TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8.318
           YLR120C
          Length = 1000

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 99/387 (25%), Positives = 163/387 (42%), Gaps = 58/387 (14%)

Query: 61  LKYNRSGAETKKSAQCNSLTFRPNISLLKRDPLSRVHIIQATFGGVSYPLVLDTGSAISW 120
           L YN S +ETK   +        +I L  R+      I   T    +  +++DTGS+  W
Sbjct: 45  LDYNTSTSETKLVKRDG-----EDIVLTNRNTFYSAEIEVGT-PAQTMNVIVDTGSSDLW 98

Query: 121 VYG-------VNSSSSANHKARQAF-VAHSNSCTVTDSIFTIFYRSGT-AHGPLYTGTLS 171
           V G       + S  S N +   +F ++ S++ T   + F I Y SG    G      L 
Sbjct: 99  VIGHDNLTCPLASDGSFNCERFGSFSISKSSTFTKNSTEFAITYVSGNNCIGVWGQDNLI 158

Query: 172 INGLKIQDFRFGVAIGVPSLLDAYALSGIFGLPSDPTDSDTSVVG------------LLQ 219
           I G+      FGV   V +   +  + GI GLP    D++T+ VG            +L+
Sbjct: 159 IGGVNATGLSFGV---VHTTTSSAGILGI-GLP----DTETTAVGQYGHYKYDNFPMVLK 210

Query: 220 GSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLV 279
              +I+ + +S+ L    S         G  + G    + Y G L   PLV N  N +  
Sbjct: 211 NKGIISHQGYSIYLDSSSS-------TYGEFLLGGVDTSKYTGTLYKLPLV-NWYNTYFS 262

Query: 280 AIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISD 339
           +    ++  + + L T    ++       + I+DTGST+  +P     AL S        
Sbjct: 263 SPGDFHVTLQGLGLITNSGSAVTLTETKMAVILDTGSTVTGIPATLYNALLS-------- 314

Query: 340 GKNFAIYCNSSEPIHLELSKHNWTILPSNFVGEPY--PKDSPYN--GYCVSNIQGGDIS- 394
             +   Y +S+   ++       + L  NF G  Y  P  S  N  G  V +++    S 
Sbjct: 315 --SLGGYYSSTHGAYVFTCPTETSKLVFNFGGINYKLPMSSFINTLGDNVCSLKVSSRSD 372

Query: 395 SSWILGEVFLQDLYTVFDIEGRQVGFA 421
           S++ILG+ FL+++Y  FD+E +++G A
Sbjct: 373 SNFILGDDFLRNVYAAFDLENKEIGLA 399

>CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 508

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 86/333 (25%), Positives = 137/333 (41%), Gaps = 80/333 (24%)

Query: 140 AHSNSCTVTDSIFTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVA-----------IG 187
           + SN+    D+ F I Y  G+   G   T  +++ G  +++  F VA           IG
Sbjct: 131 SSSNTFKSNDTDFFITYGDGSYVEGTWGTDQVALAGQTLENVTFAVAELTNNSYGLLGIG 190

Query: 188 VPSL-----LDAYALSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRN 242
           +P L     +D   L+    +  +P     +    L+ +KLINK  +S+ L+        
Sbjct: 191 LPELESSITIDTAQLTNTSSVKKNPY---MNFPESLKLNKLINKVVYSIYLNRT------ 241

Query: 243 LDDNNGLIVFGEPLGALYEGELSYTPLV--------PNPQNHWLVAIKAAYIGSE----- 289
            +D  G I+FG      Y+G L+  PLV        P P N  +V +      +      
Sbjct: 242 -NDKFGSILFGAVDHNRYDGNLTTVPLVFSNRDFGTPRP-NELMVTLNGMSFEATDGNVT 299

Query: 290 RVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQE--DALALHSYFDDSISDGKNFAIYC 347
           ++   T+K P++          +DTGST   LP +  +ALA  +              Y 
Sbjct: 300 QILNATSKFPAL----------LDTGSTDTHLPVDVYNALAESTN-----------GTYD 338

Query: 348 NSSEPIHLE--LSKHNWTILPSNF------VGEPYPKD-SPYNGYCVSNIQ--GGDISSS 396
            +   I +   LSK + TIL  NF      +G PY +      G C  N+   G D +  
Sbjct: 339 QTQNKIRIPKCLSKKDKTIL--NFSLGGVNIGVPYKEMVKKIKGKCYINVAPTGSDFA-- 394

Query: 397 WILGEVFLQDLYTVFDIEGRQVGFANRNTKATL 429
            ILG+  ++  Y VFD+E R++  A  +   TL
Sbjct: 395 -ILGDDVIRYAYMVFDLEDREISLAQASFNDTL 426

>TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.318
           YLR120C
          Length = 600

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 102/412 (24%), Positives = 176/412 (42%), Gaps = 80/412 (19%)

Query: 61  LKYNRS-GAETKKSAQCNSLTFRPNISLLKRDPLSRVHI--------IQATFG--GVSYP 109
            K+++S G   K S++ N    +P + ++KRD    + +        I+ + G    +  
Sbjct: 47  FKFDKSYGDSYKNSSKRN----KPKLDIVKRDGYEEIELKNESSFYSIKLSIGTPAQNVT 102

Query: 110 LVLDTGSAISWVYGVN-----------------SSSSANHKARQAF-VAHSNSCTVTDSI 151
           +++DTGS+  WV G +                 S SS +      F +  S+S T  D+ 
Sbjct: 103 VLIDTGSSDLWVTGSDNPLCSSDDATFTGSDGSSQSSIDCSLYGTFDIDDSSSFTSNDTS 162

Query: 152 FTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVA-----------IGVPSLLDAYA--L 197
           F I Y  G+ A G      LS+  + +    F VA           IG+PSL   Y+  L
Sbjct: 163 FAITYGDGSYALGNWGQDVLSLQDIDVTGLSFAVANYTNSTVGVLGIGLPSLEATYSGSL 222

Query: 198 SGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLG 257
           +G     S+P   D   + +L+ S  +   ++S+ L        + D + G I+FG    
Sbjct: 223 AG-----SNPYQYDNLPL-VLRNSGAVKSYAYSLFL-------NDEDSSEGSILFGGVDH 269

Query: 258 ALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPT-AKNPSI-DKNIGIRSGIIDTG 315
           + YEG L+  PLV   ++    +     I  + + + T +KN ++ D  I     ++D+G
Sbjct: 270 SKYEGTLNTLPLVNYQKSSGFQSPYEFDITLQGLGISTSSKNTTVSDTQI---VALLDSG 326

Query: 316 STLVVLPQEDALALHSYFDDSISDGKN-FAIYCNSSE---PIHLELSKHNWTILPSNFVG 371
           +TL  LP      L +  + S S     + + C SS     I  +    +  +  ++F+ 
Sbjct: 327 TTLTYLPVTLTSLLAAELNASYSARLGYYTMSCPSSSDSTEIVFDFGGFHINVPLTSFI- 385

Query: 372 EPYPKDSPYNGYCVSNI--QGGDISSSWILGEVFLQDLYTVFDIEGRQVGFA 421
                 S  N  C+  I  + GD +   ILG+ FLQ  Y V+D+E  ++  A
Sbjct: 386 ----VTSSMN-VCILGIIPRSGDQA---ILGDSFLQHAYVVYDLENLEISLA 429

>Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {ON}
           YLR121C (REAL)
          Length = 497

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 89/354 (25%), Positives = 145/354 (40%), Gaps = 72/354 (20%)

Query: 107 SYPLVLDTGSAISWV----------------YGV-NSSSSANHKARQAFVAHSNSCTVTD 149
           S  ++LDTGSA  WV                YGV + + S+  KA ++            
Sbjct: 75  SLTVLLDTGSADLWVPSKGNPYCGSVMDCDQYGVFDKTKSSTFKANKS------------ 122

Query: 150 SIFTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVA-----------IGVPSLLDAYAL 197
           S F   Y  GT A G      L  NGL +    F VA           IG+P+L   Y  
Sbjct: 123 SPFYAAYGDGTFAQGAFGQDRLKYNGLDLSGLSFAVANESNSTFGVLGIGLPALEVTY-- 180

Query: 198 SGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLG 257
           SG   +    +    +    L+ S  I+  ++S+ L+    ES++    +G I+FG    
Sbjct: 181 SGKVAVVDKKSYEYDNFPLFLKRSGAIDATAYSLFLND---ESQS----SGSILFGAVDH 233

Query: 258 ALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGST 317
           + YEG L   PLV   ++       A  +    + L T ++ +      I + ++D+G+T
Sbjct: 234 SKYEGRLYTVPLVNLYRSQGYQHPVAFDVTLHGIGLQTDRHNTTLTATKIPA-LLDSGTT 292

Query: 318 LVVLPQEDALALHSYFDDSISDGKNFAIY-CNSSEPIHLELSKHNWTILPSNFVG----- 371
           L  LP +    L    + + S    +  Y C SS+         N T +  +F G     
Sbjct: 293 LTYLPSQAVALLAKSLNATYSKALGYYEYACPSSD---------NDTSVAFDFGGFHINA 343

Query: 372 --EPYPKDSPYNGYCVSNI--QGGDISSSWILGEVFLQDLYTVFDIEGRQVGFA 421
               +   +   G CV  +  Q G+ ++  ILG+ FL++ Y V+D++  +V  A
Sbjct: 344 PVSDFTMQTSVGGTCVLAVIPQAGNATA--ILGDSFLRNAYVVYDLDNYEVSLA 395

>Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W
           (REAL)
          Length = 516

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 130/310 (41%), Gaps = 68/310 (21%)

Query: 152 FTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYA---LSGIFGLPSDP 207
           F I Y   T + G     T+S+NG+ I D +FG+A         YA   +SG+ G+    
Sbjct: 126 FYIIYADETFSDGSWGKETVSVNGIDIPDIQFGLA--------KYATTPVSGVLGIGFPR 177

Query: 208 TDSDTSVVG-----------LLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPL 256
            +S     G           LL+  ++I+  ++S+ L        + D   G IVFG   
Sbjct: 178 RESVKGYEGAPDKYYPNFPQLLKSEQIIDVVAYSLFL-------NSPDSGMGSIVFGAID 230

Query: 257 GALYEGELSYTPLVPNPQNHWLVAIKAAYI--------------GSERVELPTAKNPSID 302
            + + G+L   P+V    N +   + A                 G ER    T K P + 
Sbjct: 231 ESKFYGDLLTFPMV----NEYPTIVDAPATLAMTIQGLGAQNKSGCERETFMTTKYPVL- 285

Query: 303 KNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSIS-DGKNFAIYC-NSSEPIHLELSKH 360
                    +D+G++L+  P+  A  + S+ + S S D   + + C +S++ I       
Sbjct: 286 ---------LDSGTSLLNAPKTIADKMASFVNASYSADEGIYILNCPDSADDIEYTFDFG 336

Query: 361 NWTI-LP-SNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQV 418
           +  I +P ++ +  P  +     GYC   +Q    + S +LG+VFL   Y VFD++  ++
Sbjct: 337 DLQINVPLTSLILSPEVE----GGYCGFAVQ--PTNDSMVLGDVFLSSAYVVFDLDNYKI 390

Query: 419 GFANRNTKAT 428
             A  N  A+
Sbjct: 391 SLAQANWNAS 400

>NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa]
           {ON} Anc_7.182
          Length = 540

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/299 (22%), Positives = 128/299 (42%), Gaps = 47/299 (15%)

Query: 150 SIFTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYALSGIFGL----- 203
           S F  +Y   T A G   T  L++NG+ +   +FG+   V +      +SG+ G+     
Sbjct: 139 SRFYAYYSDKTFADGSWATEKLTMNGVDVSSLQFGLGNCVTT-----PVSGVLGIGFPRR 193

Query: 204 ------PSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLG 257
                  + P +   +   +L+   +I+  ++S+ L+ + S++       G I+FG    
Sbjct: 194 ESVKGYDNAPNEFYPNFPQVLKNQGIIDVVAYSMFLNKLESDT-------GSILFGAIDT 246

Query: 258 ALYEGELSYTPLV---PNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGI--- 311
           + Y G+L   P++   P+      V  K A +      L    N +      + S I   
Sbjct: 247 SKYTGDLVTFPMLNIYPD------VTDKPATLMVILQGLGAQDNANCKAETFVTSKIPVL 300

Query: 312 IDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIY-CNSSEPIH-----LELSKHNWTIL 365
           +D+G+TL+  P+E A  +  + + + S+ +   I  C + E +       +       + 
Sbjct: 301 LDSGTTLMGAPKEIADMMADFMNATFSEDEGIYIMECPTKETLANTDYIFDFGGVQIKVP 360

Query: 366 PSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFANRN 424
            SNF+     +  P  G+ V      D S++ +LG++FL   Y VFD++  Q+  A  N
Sbjct: 361 LSNFILSAQSEGGPC-GFAVL----PDDSNTMVLGDIFLSSAYVVFDLDNYQISLAAAN 414

>Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144C
           (MKC7) - aspartyl protease related to Yap3p [contig 105]
           FULL
          Length = 651

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 135/290 (46%), Gaps = 36/290 (12%)

Query: 152 FTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYALSGIFGLPS--DPT 208
           F I Y  GT A+G     TLS++G  I + +F VA    S +    + G+ GL S  DP 
Sbjct: 167 FMIMYGDGTFANGLWAKDTLSLDGHDISNLQFAVANMSDSDVGVLGV-GLTGLESSADPF 225

Query: 209 DSDTSVVG----LLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGEL 264
           D + S       +L+ + +I+K ++S+ ++ + +E+       G ++FG    + Y G L
Sbjct: 226 DDEPSQYPNFPVVLKQNNVISKMAYSLYINSLDAEA-------GSVLFGAVDHSKYTGGL 278

Query: 265 SYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRS--GIIDTGSTLVVLP 322
              PLV     +++  I    +  + + + + KN    K +       ++D+G+TL+ + 
Sbjct: 279 YTIPLVNALAQYFVDEILEFDVTVQGLGIESKKN-CFQKTLTTAQFPALMDSGTTLIYID 337

Query: 323 QEDALALHSYFDDSISDGKNFAIYCNSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNG 382
            + A A+      ++SD  ++ +Y           +K + T L  +F G  +   +P + 
Sbjct: 338 PDLADAIADSLGATMSD--DYELYTFECP------AKDDDTQLVFDFGG--FQITNPLSN 387

Query: 383 YCVS----NIQGGDISSSW--ILGEVFLQDLYTVFDIEGRQ--VGFANRN 424
           Y +      + G  +  S+  ILG+ FL   Y VFD+E  +  +G AN N
Sbjct: 388 YVLETDDEKVCGLGVVPSYSNILGDEFLASAYVVFDLENLELSIGQANLN 437

>SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 557

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 87/378 (23%), Positives = 140/378 (37%), Gaps = 100/378 (26%)

Query: 105 GVSYPLVLDTGSAISWVYGVNS--------SSSANHKARQ-----AFVAHSNSCTVTD-- 149
           G +   V DTG + +WV G NS        ++ ANH A       AF  H+  C + D  
Sbjct: 113 GQNMFFVADTGLSDTWVVGQNSVYCDIENGTTPANHTANFSENTFAFKNHAFPCYLADVF 172

Query: 150 -------------SIFTIFYRSGTAHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYA 196
                          FT FY    A G  Y  T+ +  + I+ F FGVA           
Sbjct: 173 EVNYSTSIVSNNTDFFTQFYDYTFASGTWYQDTIEVGSIIIEKFNFGVA----------- 221

Query: 197 LSGIFGLPSDPTDSDTSVVGL-LQGSKLINKKSFSVLLSHIPSESRN------------- 242
                      T++    +GL L+G+++ N+  ++    + P++ +N             
Sbjct: 222 ---------QETNATIGSLGLGLEGNEITNEGDYTYTYENFPTKLKNSGMIKRVIYSIYA 272

Query: 243 --LDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVEL-PTAKN- 298
             +D  +G ++FG    + Y G+  YT  + N  N            S+ VE   T +N 
Sbjct: 273 GKIDTEDGSLLFGAVEHSRYVGDTLYTLPLVNVNN----------ASSDPVEFHVTLQNL 322

Query: 299 -PSIDK-NIGIRS----GIIDTGSTLVVLPQEDALALHSYFDDSI------SDGKNFAIY 346
             S++K N  I S     +++TG+ +  LP          F D I         K + +Y
Sbjct: 323 VVSVNKTNTTIMSDRYAALLNTGAIVTYLPTH-------LFSDFIKKTGLSESQKYYGMY 375

Query: 347 ---CNSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVF 403
              C+S      +          ++++ E    + P    C   I   D     +LG  F
Sbjct: 376 VTDCSSEISFSYDFGGFKIESSLNDYLFEIDESEIP-GAKCAVTINSHD-EKYLVLGSGF 433

Query: 404 LQDLYTVFDIEGRQVGFA 421
               Y VFD+E  +V  A
Sbjct: 434 FSSAYVVFDLERLEVSIA 451

>AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR121C (YPS3),
           YDR144C (MKC7) and YLR120C (YPS1); Tandem gene
           duplication in Saccharomyces cerevisiae
          Length = 499

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 81/346 (23%), Positives = 145/346 (41%), Gaps = 53/346 (15%)

Query: 110 LVLDTGSAISWVYGVNSSSSAN----------HKARQAFVAHSNSCTVTDSIFTIFYRSG 159
           +++DTGS+  WV G       N          ++      + S++    ++ F I Y   
Sbjct: 89  VLMDTGSSDLWVVGAGVRCGPNNYPNPNQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDS 148

Query: 160 T-AHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYALSGIFGLPSDPTDSDTSVVG-- 216
           T AHG   T  L +    +    F VA    S   + A+ GI GLP+  T   +   G  
Sbjct: 149 TYAHGTWGTDRLDLGQANVDGLTFAVAHASNS---SVAVLGI-GLPAMETTMSSQQFGYQ 204

Query: 217 ------LLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLV 270
                 +L+ + +I K  +S+ ++ + +++       G ++FG    + Y+G L+  PLV
Sbjct: 205 YDNLPMVLKRNNVIKKTVYSMFINELNAKT-------GSVLFGAVDHSKYKGTLNTVPLV 257

Query: 271 PNPQNHWLVAIKAAYIGSERVELPTAKNP-SIDKNIGIR-SGIIDTGSTLVVLPQE--DA 326
                  +      ++    + L T ++   +   +G +   ++D+G+TL   P +  D 
Sbjct: 258 NANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQLADR 317

Query: 327 LALHSYFDDSISDGKNFAIYCNSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGY-CV 385
           LA  +      S+   + + CNS         + + T    +F G  +   SP + Y  +
Sbjct: 318 LA-RAAGARWHSEEVGYIVDCNSR--------RLHQTAYIYDFGG--FQIRSPLSDYSMM 366

Query: 386 SNIQGG-------DISSSWILGEVFLQDLYTVFDIEGRQVGFANRN 424
           +N++G          S   ILG+VFL   Y VFD+E  +V  A  N
Sbjct: 367 TNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQAN 412

>Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C
           (REAL)
          Length = 540

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 123/293 (41%), Gaps = 43/293 (14%)

Query: 149 DSIFTIFYRSGTAHGPLY-TGTLSINGLKIQDFRFGVAIGVPSLLDAYALSGIFG--LPS 205
           ++IF + Y   + +   Y T  +S+  + + +F FGV+       D     GI G  LPS
Sbjct: 159 ETIFNLTYGDNSYYAGTYGTDVVSLGNITLSNFTFGVSN------DTTNNGGILGVSLPS 212

Query: 206 DPTDSDT--------------SVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIV 251
                DT              +    L+    I K ++S+ L+  PS         G I+
Sbjct: 213 AEVTDDTEDALSSNTTPFIYNNFPMALKSQGKIKKIAYSLFLNE-PSARF------GSIL 265

Query: 252 FGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGI 311
           FG    + Y G+L   P++    N         ++ ++ V +  +K+ +   +      +
Sbjct: 266 FGAVDKSEYSGQLYTLPML-QAYNTLDATDAGMFVTAQSVAILDSKSGNKTVSEVQFPVL 324

Query: 312 IDTGSTLVVLPQEDALALHSYFDDSIS-DGKNFAIYCN--SSEPIHLELSKHNWTILPSN 368
            D+G++  VLP + A A+   FD   S D + +   C   ++  +  +    N +   SN
Sbjct: 325 FDSGTSTSVLPTKIADAIGRSFDGKYSSDDQGYIFDCAKVNNTLLSFDFGGFNISANISN 384

Query: 369 FVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFA 421
           FV       +P   +C+  I   D  + ++LG+ FL D Y V+D+E  +V  A
Sbjct: 385 FV-------TPAKDHCILQILPSD--TIFVLGDAFLVDTYVVYDLENHEVSVA 428

>AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
           (PEP4)
          Length = 268

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 75/183 (40%), Gaps = 27/183 (14%)

Query: 246 NNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNI 305
           N G I+FG      + G L + P+    +  W V   +   G   V+          + +
Sbjct: 105 NEGEIIFGGYDSTKFAGSLEWLPI--TKKGFWEVEFNSISTGESTVQ---------GEGL 153

Query: 306 GIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSE---PIHLELSKHNW 362
           G    I+DTGS+L +LP E     +   + ++       + C++ E    I  EL    +
Sbjct: 154 G---AILDTGSSLTLLPTEIFDKFNGALEAALGSKTGGRVSCSARETAPEIVFELGGKKF 210

Query: 363 TILPSNFVGEPYPKDSPYNGYCVSNIQ---GGDISSSWILGEVFLQDLYTVFDIEGRQVG 419
            I  + ++        P    C+  I+    G  S+  ILG  FL+  Y+V+D+   +VG
Sbjct: 211 AITGNEYI-------MPAGSECMVTIRPQASGAQSNVVILGTPFLRKFYSVYDLGSDRVG 263

Query: 420 FAN 422
            A 
Sbjct: 264 LAE 266

>Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR039C
           (REAL)
          Length = 387

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 76/296 (25%), Positives = 126/296 (42%), Gaps = 48/296 (16%)

Query: 149 DSIFTIFYRSGTAH-GPLYTGTLSINGLKIQDFRFGVA-----------IGVPSLLDAYA 196
           ++IF I Y   + + G   T  +S+  + + +F FGV+           I +PS     +
Sbjct: 5   ETIFNITYDDNSYYAGTFGTDIVSLGDITLSNFTFGVSNDTTINGGILGISLPSAEITDS 64

Query: 197 LSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPL 256
             G     + P   D   + L    K I K ++S+ L+  P+         G I+FG   
Sbjct: 65  GQGALSSNTTPFAYDNFPMALKNQGK-IEKIAYSLFLNE-PNARF------GSILFGAVD 116

Query: 257 GALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGI----- 311
            + Y G+L   P++     + L A+           L TA++ +I  +I     +     
Sbjct: 117 KSKYTGQLYTLPMLQ--AYNTLDALGGGM-------LVTAQSVAILDSISGNKTVSEVQF 167

Query: 312 ---IDTGSTLVVLPQEDALALHSYFDDSIS-DGKNFAIYCN--SSEPIHLELSKHNWTIL 365
               D+G++  VLP E A A+   FD   S D + +   C+  ++  + ++    N +  
Sbjct: 168 PVLFDSGTSTSVLPTEIADAIGRSFDGKYSSDDEGYIFDCSKVNNTQLSIDFGGFNISAN 227

Query: 366 PSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFA 421
            SNFV  P  KD     +CV  I   D  S  +LG+ FL D Y V+D+E  +V  A
Sbjct: 228 ISNFV-TPLTKD-----HCVLQILPSDTVS--VLGDAFLVDTYVVYDLESHEVSVA 275

>CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa]
           {ON} similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015w BAR1
          Length = 541

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 81/361 (22%), Positives = 138/361 (38%), Gaps = 80/361 (22%)

Query: 107 SYPLVLDTGSAISWVYGVNSSSSANHKARQ-----------AFVAHSNSCTVTDSIFTIF 155
           S PLVLDTGS+  WV  + +    N  + +            F     S T  D +  + 
Sbjct: 65  SIPLVLDTGSSDLWVTLIGNPLCYNKGSGKPPKCLIDCSGLVFYDMDKSQTF-DYLKNVT 123

Query: 156 YRSGTAHGPLYTGTLSINGLKI-----QDFRFGVAIGVPSLLDAY------ALSGIFGLP 204
           ++ G A     +G   ++ + +     +D +FG+A    +           A+  + G  
Sbjct: 124 FKIGYADTTYTSGIWIVDIITLPEGHLKDLQFGMAFATNATFSGVLGIGFPAMESVNGYE 183

Query: 205 SDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGEL 264
             P     +    L+ +   N  ++S+          N +   G I+FG    + + G L
Sbjct: 184 FAPGKFYPNFPLALKNAGFTNIAAYSI--------EYNDESKKGSILFGSIDTSRFIGPL 235

Query: 265 SYTPLV-------PNPQNHWLVAIKAAYIGS-ERVELPTAKNPSIDKNIGIRSGIIDTGS 316
              P++         P    L        GS E+  +   K P++          +DTGS
Sbjct: 236 YTFPMINEFPGIADEPSTLSLTLDGIGIDGSCEQWVISNTKLPAL----------LDTGS 285

Query: 317 TLVVLPQEDALALHSYFDDSISDGKN-FAIYCNSSE------------PIHLELSKHNWT 363
           TL+ LP     ++ SY + + SD    F + C S +             +H+++   ++ 
Sbjct: 286 TLIELPHPITQSIASYLNATWSDDHGLFVLACPSDDFLTTTDLAFTFGELHMKIPLRSFI 345

Query: 364 ILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSS---WILGEVFLQDLYTVFDIEGRQVGF 420
           +LP          D   NG C     G  I+SS    ILG+ FL  +YTVFD++   +  
Sbjct: 346 LLP----------DEESNGLC-----GLGITSSKGRVILGDSFLTHVYTVFDLDNYMISL 390

Query: 421 A 421
           A
Sbjct: 391 A 391

>NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 117/291 (40%), Gaps = 52/291 (17%)

Query: 156 YRSGT-AHGPLYTGTLSINGL-----KIQDFRFGV-AIGVPSLLDAYA--LSGIFGLPSD 206
           + SGT AH  L  G L+I GL      + +   GV  IG+P L   Y+   S ++   + 
Sbjct: 227 FASGTWAHDVLNLGGLNITGLSFAVANMSNSTVGVLGIGLPGLETTYSGSTSKLYQYNNF 286

Query: 207 PTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSY 266
           P         LL+ S  I+  S+S+ L        +LD   G ++FG      Y G L  
Sbjct: 287 PM--------LLKQSGAIDSTSYSLFLD-------DLDAKQGSVLFGAVDHTKYVGNLYT 331

Query: 267 TPLV--------PNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTL 318
            P+V        PNP       +  A IG +      +KN ++  N      ++D+G+T+
Sbjct: 332 VPMVNILASKGYPNPIQF---DVTLAGIGIQN----DSKNYTVTTNK--FPALLDSGTTI 382

Query: 319 VVLPQEDALALHSYFDDSISDGKNF-AIYCN---SSEPIHLELSKHNWTILPSNFVGEPY 374
              PQE    +        S    F A+ CN   SS     +    + T   S+F+    
Sbjct: 383 SYFPQEVVQTIARQLGARYSSALGFYAMSCNGVSSSTNFVFDFGGFHITGPVSDFL---- 438

Query: 375 PKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFANRNT 425
               P +G           S   +LG++FL   Y V+D++  ++  A  NT
Sbjct: 439 ---LPTSGNTCVLAMAPQESQHILLGDIFLTHAYVVYDLDNYEISLAQANT 486

>CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
          Length = 539

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 122/300 (40%), Gaps = 51/300 (17%)

Query: 152 FTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVA-IGVPSLLDAYALSGIFGLPSDPTD 209
           F + Y  GT A G   T T  +N   + +  F +A I   S+     + G+ G P++ T 
Sbjct: 144 FFVKYEDGTYASGMWGTDTFKLNHHNVSNITFALANIANASM----GVLGV-GFPAEETT 198

Query: 210 SDTSVVGL--------------LQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEP 255
            D S   L              L+ ++ I K S+S+ L+   S+        G+I+FG  
Sbjct: 199 DDPSPGSLIDKEHYQYDNFPIALKRTRTIKKVSYSIFLNDTNSKK-------GVILFGGV 251

Query: 256 LGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSG----I 311
             + Y+G L   P+V N     L+ +         + L         KN+ +       +
Sbjct: 252 DHSKYQGTLWTVPMVNN-----LLTLNQTTTSRPEITLNGLGFRDDKKNVTLWGEKIPVL 306

Query: 312 IDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSEPIHLELSKHNWTILPSNFVG 371
           +DTG+TL   P++    +    + +I D K   I            +K N  ++  NF G
Sbjct: 307 LDTGTTLAYAPKQVVDVIAKRVNGTI-DSKTGGIKLKKCPN-----AKDNSELI-FNFAG 359

Query: 372 EPYPKD-----SPYNGYCVSNIQGGDISSS--WILGEVFLQDLYTVFDIEGRQVGFANRN 424
              P           G C   I+  +  S    +LG++F++ +Y+VF++E  +V FA  N
Sbjct: 360 AEIPVSLLNMVEKRKGKCYLEIRYHEELSKTGMLLGDIFMRHVYSVFNMEDMEVSFAVAN 419

>CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3
          Length = 521

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 64/304 (21%), Positives = 131/304 (43%), Gaps = 52/304 (17%)

Query: 151 IFTIFYRSGTAHGPLYTGTLSINGLKIQDFRFGVA-----------IGVPSLLDAYALSG 199
           +F  +  +G   G   T ++S+  L + +   GV+           +G+P     +  S 
Sbjct: 141 LFITYGDNGFVRGTWGTDSVSVGNLNLSNLSIGVSPMTNTSTGILGVGLPGEESTFNYSS 200

Query: 200 IFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGAL 259
               PS+   S+  +   L+   LI K ++S+ L+   S+        G I+FG    + 
Sbjct: 201 NVTGPSNYQYSNFPI--RLKEEGLIEKIAYSIYLNETGSKY-------GSILFGAVDHSK 251

Query: 260 YEGELSYTPLV-------PNPQNHWLVAIKAAYIG-SERVELPTAKNPSIDKNIGIRSGI 311
           Y+G L   PLV        +P    +       +G ++ + L   K P++          
Sbjct: 252 YQGPLYTFPLVNSKYKEGSDPFQFEITMNGVGLVGKTDNITLYDQKLPTL---------- 301

Query: 312 IDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIY---CNS---SEPIHLELSKHNWTIL 365
           +D+GST+ +LP++ A  +    + ++ DGK   I    C S   ++ +    S   +++ 
Sbjct: 302 LDSGSTISLLPRDVADLVAQQVNGTV-DGKGNCIKLPKCPSKKDNQKLIFNFSGAEFSVN 360

Query: 366 PSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFANRNT 425
            ++F+ +       + G C       D  +  +LG+ F+ ++YTVF+++ +++  A  N 
Sbjct: 361 VTDFMEK-------HKGKCYLQFSALDGINFALLGDNFMNNVYTVFNLDDKELSLAQANY 413

Query: 426 KATL 429
            ++L
Sbjct: 414 NSSL 417

>ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {ON}
           weakly similar to YYIL015W uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 551

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 119/304 (39%), Gaps = 59/304 (19%)

Query: 149 DSIFTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYALSGIFGLPSDP 207
           DS F + Y  G+ A G      + ++GL + D  F VA    S +  + +    GLP + 
Sbjct: 149 DSTFYLTYGDGSFAKGLWGMDHVYLDGLNVSDVSFAVANESNSTVGVFGV----GLPGEE 204

Query: 208 TDSDTSVVG----------LLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLG 257
                 V G          +L+ + ++ K ++S+ L        + D N+G I+FG    
Sbjct: 205 ATVTPGVNGNHYQYKNFPQVLKDNGVVQKNAYSLYL-------NSPDSNSGNILFGAVDH 257

Query: 258 ALYEGELSYTPLVPNPQNHWL------VAIKAAYIGSERVELPTAKNPSIDKNIGIRSGI 311
           + Y G L   P+V    +  +      V ++   +G+       + + ++         +
Sbjct: 258 SKYSGNLYTLPIVNTYADQGVAPREFDVTVQGITVGNSSSNSTVSSDKTL--------AL 309

Query: 312 IDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSE-----------PIHLELSKH 360
           +D+G+TL+ LP   A  L        S    + +    SE             H+E    
Sbjct: 310 LDSGTTLMYLPTALADELAKSLGGKFSPSTGYYLIPKPSENDDTKITFDFGGFHIETKLS 369

Query: 361 NWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGF 420
           N+ +  S       P+D    G   +    GD +   I G+VFL D Y V+D+E  ++  
Sbjct: 370 NYILQGSG------PQDVAILGILRTE---GDRA---IFGDVFLVDAYVVYDLEDYEISL 417

Query: 421 ANRN 424
           A  N
Sbjct: 418 AQAN 421

>KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON} 
          Length = 531

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 128/296 (43%), Gaps = 43/296 (14%)

Query: 152 FTIFYRSGTAHGPLY-TGTLSINGLKIQDFRFGVA-----------IGVPSLLDAYALSG 199
           FT+FY   T     + T  + +  L+I D  FGVA           IG PSL      + 
Sbjct: 176 FTMFYADKTGASRFWGTDVVRVELLEILDMSFGVANVFNATEGVFGIGFPSL----ETTN 231

Query: 200 IFGLPSDPTDSD--TSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLG 257
           +F    DP  S    +    L     ++K ++S+ L+    +S  +    G ++FG    
Sbjct: 232 MFNARIDPYSSYEYANFPQALNNQGSVDKVAYSLFLN----DSHAM---KGSVLFGAVDH 284

Query: 258 ALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGST 317
           + Y  +L   PLV + ++  +       + + R   P  + P   ++      ++D+G+T
Sbjct: 285 SKYRNDLFTVPLVNDFRDKGMDHPHYFNVFNARRGCPNKRRPQNRRHDEFIV-VLDSGAT 343

Query: 318 LVVLPQE--DAL--ALHSYFDDSISDGKNFAIYCNSSEPIHL---ELSKHNWTILPSNFV 370
           +  LP +  D L  +L++ FD+ ++   ++ + C S +   +   ++ + +     SNFV
Sbjct: 344 VSSLPTKLVDQLVQSLNATFDEELN---SYTLKCPSKKDTSVASFDIGRFHIDGPLSNFV 400

Query: 371 GEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFANRNTK 426
              Y K+      C+  +   D +  +IL + FL   Y V D+E  ++     NT+
Sbjct: 401 -RKYEKNK-----CILRLDPAD-NQPYILCDNFLSRAYVVHDLESYEISMGQANTE 449

>YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON}
           YPS3Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 508

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 90/356 (25%), Positives = 148/356 (41%), Gaps = 83/356 (23%)

Query: 110 LVLDTGSAISWV----------------YGV-NSSSSANHKARQAFVAHSNSCTVTDSIF 152
           ++LDTGSA  WV                YGV + + S+  KA ++            S F
Sbjct: 78  VLLDTGSADLWVPGKGNPYCGSVMDCDQYGVFDKTKSSTFKANKS------------SPF 125

Query: 153 TIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVA-----------IGVPSLLDAYALSGI 200
              Y  GT A G      L  N L +    F VA           IG+ +L   Y  SG 
Sbjct: 126 YAAYGDGTYAEGAFGQDKLKYNELDLSGLSFAVANESNSTFGVLGIGLSTLEVTY--SGK 183

Query: 201 FGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALY 260
             +    +    +    L+ S  I+  ++S+ L+    ES++    +G I+FG    + Y
Sbjct: 184 VAIMDKRSYEYDNFPLFLKHSGAIDATAYSLFLND---ESQS----SGSILFGAVDHSKY 236

Query: 261 EGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRS----GIIDTGS 316
           EG+L   PLV   ++       A  +  + + L T K     +NI + +     ++D+G+
Sbjct: 237 EGQLYTIPLVNLYKSQGYQHPVAFDVTLQGLGLQTDK-----RNITLTTTKLPALLDSGT 291

Query: 317 TLVVLPQEDALALHSYFDDSISDGKNFAIY-CNSSEPIHLELSKHNWTILPSNFVGEPYP 375
           TL  LP +    L    + S S    +  Y C SS+         N T +  +F G  + 
Sbjct: 292 TLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSD---------NKTSVAFDFGG--FR 340

Query: 376 KDSPYN--------GYCVSNI--QGGDISSSWILGEVFLQDLYTVFDIEGRQVGFA 421
            ++P +        G CV  I  Q G+ ++  ILG+ FL++ Y V+D++  ++  A
Sbjct: 341 INAPLSDFTMQTSVGTCVLAIIPQAGNATA--ILGDSFLRNAYVVYDLDNYEISLA 394

>Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}
           similar to Ashbya gossypii AGL192W
          Length = 502

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 96/222 (43%), Gaps = 43/222 (19%)

Query: 217 LLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLV------ 270
           +L+ + +I+K ++S+ L+       +LD  +G ++FG    + Y G L+  PLV      
Sbjct: 213 VLKRNGVIDKTAYSLYLN-------DLDATSGSVLFGAVDHSKYTGTLATVPLVNVNARY 265

Query: 271 --PNP-QNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDAL 327
             P P + H  +       G +R  +   K P++          +D+G+TL   P E A 
Sbjct: 266 GFPKPIELHITLNGLGFSSGKKRGTISATKVPAL----------LDSGTTLSYFPTELAA 315

Query: 328 ALHSYFDDSISDG-KNFAIYCNSSEPIHLELSKHNWTILPSNFVGEP-------YPKDSP 379
           A+ S      +   + F I C+ +        K N   L  NF G         Y  ++ 
Sbjct: 316 AIASNVGAVWNARLRKFLIPCSQA--------KRNNIDLIYNFGGVEITSPLVNYLSETN 367

Query: 380 YNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFA 421
               C+  I     S+  ILG+VFL  +YTV+D+E  +V  A
Sbjct: 368 VEDVCLLGIVPTS-SNDIILGDVFLTSVYTVYDLEALEVSIA 408

>KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.319
           YLR121C
          Length = 521

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 81/347 (23%), Positives = 138/347 (39%), Gaps = 59/347 (17%)

Query: 110 LVLDTGSAISWVYG-------------VNSSSSANHKARQAFVA-HSNSCTVTDSIFTIF 155
           +++DTGS+  WV G             V+S++  +      F    S++ +  D++F+I 
Sbjct: 90  VLVDTGSSDLWVTGSDNPYCVSVKSNLVSSTNKFDCNTYGTFDKNQSSTWSSNDTLFSIT 149

Query: 156 Y-RSGTAHGPLYTGTLSINGLKIQDFRFGVA-----------IGVPSLLDAYALSGIFGL 203
           Y  +  A G      L ++ L +    F VA           IG+P L   Y        
Sbjct: 150 YGDTSFARGTWGQDKLHLDDLDVSGLSFAVANVTNSTVGVLGIGLPGLEVTY-----INA 204

Query: 204 PSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGE 263
           P +    D   + +L+ S   +   +S+ L H  +E       +G ++FG    + Y G 
Sbjct: 205 PRNRYQYDNFPM-ILKNSGATHSNLYSLHLDHPEAE-------HGTVLFGAVDHSKYTGS 256

Query: 264 LSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQ 323
           L   PLV   + H         +  + V +      +   N  I + ++D+G+TL  LPQ
Sbjct: 257 LYTIPLVNTLKTHGFSDPAKFEVTLQGVGIVANNTQTTLTNTKI-AALLDSGTTLTYLPQ 315

Query: 324 EDALALHSYFDDSI-----SDGKNFAIYC----NSSEPIHLELSKHNWTILPSNFVGEPY 374
               AL     DSI     S    + + C    NS   +  +    +     ++F+ E +
Sbjct: 316 ----ALVQVIADSIGARWSSRYGYYIVSCRAVENSDTTLVFDFGGFHINGKLTDFIVETF 371

Query: 375 PKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFA 421
                    C+  I     S+S ILG+ FL + Y VFD+E  ++  A
Sbjct: 372 GN------VCLLTIIEETGSNSAILGDNFLINAYVVFDLENNEISMA 412

>KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]
           {ON} some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease
          Length = 511

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 69/313 (22%), Positives = 129/313 (41%), Gaps = 81/313 (25%)

Query: 153 TIFYRSGTAHGPLYTGTLSINGLKIQDFRFGVA-----------IGVPSLLDAYALSGIF 201
           T ++    + G      +SI   ++ D +F VA           +G+P L    A+ G  
Sbjct: 141 TQYFDGSYSDGFWVVDDISIADQQVPDLQFAVANISSAPSGVLGVGLPRL---EAVRGYD 197

Query: 202 GLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYE 261
           G P+   D+       L+ ++LIN+  +S+       ES       G ++FG      Y+
Sbjct: 198 GAPNANYDNFPQT---LKSNRLINRVLYSLYFDSGDLES-------GTVLFGGIDEKKYD 247

Query: 262 GELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRS------------ 309
           G L   PLV    N +           E+++ P A + ++ + +GIRS            
Sbjct: 248 GVLYTLPLV----NIY-----------EQIDEPAAFDITL-QGLGIRSESNCKDTVIAHK 291

Query: 310 ---GIIDTGSTLVVLPQEDALALHSYFDDSISDGKN-FAIYCNSSE----------PIHL 355
               ++D+GST++  PQE   ++      + S+    + + C +S            + L
Sbjct: 292 KAPALLDSGSTIMGAPQEALESIAQELGAAFSESDGLYVLDCPASNDDRTFYFDFGELKL 351

Query: 356 ELSKHNWTILPSNFVGEPYPKDSPYNGYC-VSNIQGGDISSSWILGEVFLQDLYTVFDIE 414
           ++  H+   LP +  G+          YC ++ I  G+    WILG++ L+  Y V+D++
Sbjct: 352 KVPIHDLLYLPES--GQ---------NYCGLAIIASGE---EWILGDLVLKSAYVVYDLD 397

Query: 415 GRQVGFANRNTKA 427
             ++  A   T +
Sbjct: 398 NLEISIAQVKTTS 410

>Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W
           (REAL)
          Length = 593

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 130/302 (43%), Gaps = 60/302 (19%)

Query: 152 FTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYA---LSGIFGLPSDP 207
           F I Y  GT A G   T T+SI+G+ I + +FG+A         YA   +SG+ G+    
Sbjct: 126 FYIIYADGTFADGTWGTETVSIDGIVIPNIQFGLA--------KYATTPVSGVLGIGFPR 177

Query: 208 TDSDTSVVG-----------LLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPL 256
            +S     G           +L+  ++I+  ++S+ L        + +   G I+FG   
Sbjct: 178 RESVKGYEGAPNKYYPNFPQILKSEQIIDVVAYSLFL-------NSPESGTGSIIFGAID 230

Query: 257 GALYEGELSYTPLV---PN-PQNHWLVAIKAAYIGS------ERVELPTAKNPSIDKNIG 306
            + + G+L   P+V   PN       +A+    +G+      E     T K P       
Sbjct: 231 ESKFSGDLFTFPMVNEYPNIVDTPATLAMTIQGLGAQNKNSCEYETFMTTKYPV------ 284

Query: 307 IRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIY-CNS-SEPIHLELSKHNWTI 364
               ++D+G++L+  P+  A  + S+ + + S  +   I  C + ++ I       +  I
Sbjct: 285 ----LLDSGTSLLNAPKVIADKMASFVNATYSAEEGIYILDCPAFADEIEYTFDFGDLKI 340

Query: 365 -LP-SNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFAN 422
            +P ++ +  P  +     GYC   +Q    + S +LG+VFL   Y VFD++  ++  A 
Sbjct: 341 SVPLTSLILSPEAE----GGYCGFAVQ--PTNDSMVLGDVFLSSAYVVFDLDNYKISLAQ 394

Query: 423 RN 424
            N
Sbjct: 395 AN 396

>KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 129/323 (39%), Gaps = 59/323 (18%)

Query: 141 HSNSCTV--TDSIFTIFY-RSGTAHGPLYTGTLSINGLKIQDFRFGVA-----------I 186
           HS S T    ++ F I Y  +  A G     T+SIN L +    F VA           I
Sbjct: 167 HSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGI 226

Query: 187 GVPSLLDAYALSGIFGLPSDPTDSDTSVVG------LLQGSKLINKKSFSVLLSHIPSES 240
           G+P L     LS       D   + +S+        +L+   +I+K ++S+ L+  P E 
Sbjct: 227 GLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLND-PQEQ 285

Query: 241 RNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELP-TAKNP 299
                  G ++FG    + Y G L   PLV          I      S+ VE   T    
Sbjct: 286 E------GSVLFGAVDHSKYTGTLYTVPLVD---------IYHDSASSKPVEFDITLYGL 330

Query: 300 SIDKNIGIRSGI--------IDTGSTLVVLPQEDALALHSYFDDSISDGKNF----AIYC 347
            +DK+ G +S I        +D+G+T+   P + A  +   F+ +      F      Y 
Sbjct: 331 GVDKD-GSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYD 389

Query: 348 NSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWI-LGEVFLQD 406
            S+  +  +    + T    +FV +   +       CV  I  G    +W+ LG+VFL +
Sbjct: 390 TSNTNLVFDFGGFHITAPLDDFVVQQSSQT------CVLAI--GPQQENWVVLGDVFLSN 441

Query: 407 LYTVFDIEGRQVGFANRNTKATL 429
            Y V+D+E  +V  A  N  ++L
Sbjct: 442 AYVVYDLENLEVSMAQANFDSSL 464

>KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 85/360 (23%), Positives = 148/360 (41%), Gaps = 85/360 (23%)

Query: 110 LVLDTGSAISWVYGVN-----SSSSANHKARQAFVAHSNSCTVTD--SIFTIFYRSGT-A 161
           ++LDTGS+  WV G N     +S S+  K    F  +  S T  D  S   I Y+ GT  
Sbjct: 66  VLLDTGSSDLWVTGANNPYCQTSLSSECKEYGTF-DYGQSSTFQDRNSALKINYQDGTKV 124

Query: 162 HGPLYTGTLSIN--GLKIQDFRFGVAIGVPSLLDAYALSGIFGLPSDPTDSDTSVVGL-- 217
            G     TL +N   +++Q+   GVA                    D +DS   V+GL  
Sbjct: 125 DGRWGVDTLELNNGAIQLQNTMIGVA--------------------DSSDSVAGVIGLGF 164

Query: 218 --LQGSKLINKKSFSVLLSHIPSESRN------------LDDN-NGLIVFGEPLGALYEG 262
             L+ +  +     S   ++ P + +             LD++  G I+FG      Y G
Sbjct: 165 PGLETTNNVQANGESYTYANFPMQLKQQGVTDATVFAIALDNSYGGDILFGAVDEGKYIG 224

Query: 263 ELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRS--------GIIDT 314
            L   P+V +      +          R+E+ T +   +D + G +          ++D+
Sbjct: 225 GLYTLPVVNSRGTATPI----------RMEV-TLQGIGVDSDGGDQETFSSTPMLALVDS 273

Query: 315 GSTLVVLPQEDALALH----SYFDDSISDGKNFAIYCNSS---EPIHLELSKHNWTILPS 367
           GST+V LP+  A A++    + +D S    + + I C ++   + +  +    + +   S
Sbjct: 274 GSTMVYLPELIATAIYNKVGARYDGS---SEMYTIDCGTNVENDNLIFDFGGFHISTPVS 330

Query: 368 NFVGEPYPKDSPYNGYCVSNI--QGGDISSSWILGEVFLQDLYTVFDIEGRQVGFANRNT 425
           N++          NG C+  I  Q G+   + +LG+ FL   Y VFD++  ++  A  N+
Sbjct: 331 NYI---ITDQRSSNGQCLFGILSQSGN---TVVLGDTFLSSAYVVFDLDHYEISMAQGNS 384

>NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {ON}
           Anc_7.182
          Length = 547

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 88/199 (44%), Gaps = 17/199 (8%)

Query: 245 DNNGLIVFGEPLGALYEGELSYTPLV---PNPQNH-WLVAIKAAYIGSERVELPTAKNPS 300
           + +G ++FG    + +EG++   P+V   PN  +    +A+    + ++     T     
Sbjct: 232 NQDGSLLFGAIDTSKFEGDMITYPMVNVYPNVVDKPATLALTIQGVAAQNTNDCTQNETF 291

Query: 301 IDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSIS-DGKNFAIYCNSSEPIH----- 354
           +     +   ++D+G+TL+  P+E A  +  + + + S D + + + C S E ++     
Sbjct: 292 MTSKFPV---LLDSGTTLMSAPKELADKMADFVNATYSEDDRIYILNCPSQEVLNDIEYI 348

Query: 355 LELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIE 414
            +       I    F+    P D   +G C   +     +   +LG++FL  +Y VFD++
Sbjct: 349 FDFGGLQVKIPLEKFI---LPSDDG-SGPCAFGVLPETTTDRMVLGDIFLSFVYAVFDLD 404

Query: 415 GRQVGFANRNTKATLVHNE 433
             Q+  AN N  A    NE
Sbjct: 405 HYQISLANINKNANSESNE 423

>ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 531

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 76/336 (22%), Positives = 139/336 (41%), Gaps = 54/336 (16%)

Query: 112 LDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFY-RSGTAHGPLYTGTL 170
           +  GS  S         + N +  + F  HSN     D+ F++ Y  +  A G     ++
Sbjct: 141 MSGGSTASATLDCKEFGTFNREDSKTF--HSN-----DTEFSVSYGDTSYAIGTWGYDSI 193

Query: 171 SINGLKIQDFRFGVA-----------IGVPSLLDAYALSGIFGLPSDPTDSDTSVVGLLQ 219
           +IN + + +   GVA           IG+ +L + Y  +G+  + +  T    +   LL+
Sbjct: 194 NINDVNLTNVSIGVANKTNSSVGIMGIGLSNLENTY--TGVENVKNRNTHKYLNFPMLLK 251

Query: 220 GSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWL- 278
               I K  +S+ L+   +         G I+FG    + Y G+L   P++   Q   L 
Sbjct: 252 EQGFIEKNVYSLFLNRREAFE-------GSILFGAVDHSKYSGQLYTVPMLNLYQQQGLK 304

Query: 279 ------VAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQED----ALA 328
                 V ++   I +  +   T+  P           ++D+G+TLV LP +     A  
Sbjct: 305 DPLQLQVTLQGVGIEANNMTNTTSTTPV--------PALLDSGTTLVYLPDKMLAMLAEQ 356

Query: 329 LHSYFDDSISDGKNFAIYCNSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNI 388
           L++++D  I     +   C+  +  +L  +   + I+ SN     Y         CV  +
Sbjct: 357 LNAHWDRGIG---YYVTDCSRVDNTNLYFNFGGFNIV-SNM--STYVVSRSNENSCVLGL 410

Query: 389 QGGDISSSWILGEVFLQDLYTVFDIEGRQVGFANRN 424
           Q G   ++ ILG++F+Q  Y VFD++  ++  A  N
Sbjct: 411 QPGGPEAA-ILGDMFMQHAYIVFDLDDFEISMAQAN 445

>Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {ON}
           YLR121C (REAL)
          Length = 507

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 87/361 (24%), Positives = 144/361 (39%), Gaps = 93/361 (25%)

Query: 110 LVLDTGSAISWV----------------YGV-NSSSSANHKARQAFVAHSNSCTVTDSIF 152
           ++LDTGSA  WV                YGV + S S+  KA ++            S F
Sbjct: 78  VLLDTGSADLWVPGKGNPYCGSVMDCDQYGVFDKSKSSTFKANKS------------SPF 125

Query: 153 TIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVA-----------IGVPSLLDAYALSGI 200
              Y  GT A G      L  N L +    F VA           IG+ +L   Y  SG 
Sbjct: 126 YAAYGDGTFAEGAFGQDKLKYNNLDLSGLPFAVANESNSTFGVLGIGLSTLEVTY--SGK 183

Query: 201 FGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALY 260
             +    +    +    L+ S  I+  ++S+ L+     S       G I+FG    + Y
Sbjct: 184 VAVMDKRSYEYDNFPLFLKHSGAIDATAYSLFLNDESQAS-------GSILFGAVDHSKY 236

Query: 261 EGELSYTPLVPNPQNH-------WLVAIKAAYIGSER--VELPTAKNPSIDKNIGIRSGI 311
           EG+L   PLV   ++        + V ++   + +++    L T K P++          
Sbjct: 237 EGQLYTIPLVNMYKSQGYQHPVAFDVTLQGLGLQTDKRNTTLTTTKFPAL---------- 286

Query: 312 IDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIY-CNSSEPIHLELSKHNWTILPSNFV 370
           +D+G+TL  LP +    L    + S S    +  Y C SS+         N T +  +F 
Sbjct: 287 LDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSD---------NKTSIAFDFG 337

Query: 371 GEPYPKDSPYN--------GYCVSNI--QGGDISSSWILGEVFLQDLYTVFDIEGRQVGF 420
           G  +  ++P +        G C   +  Q G+ ++  ILG+ FL++ Y V+D++  ++  
Sbjct: 338 G--FRINAPLSDFTMQTSVGTCALALIPQAGNATA--ILGDSFLRNAYVVYDLDNYEISL 393

Query: 421 A 421
           A
Sbjct: 394 A 394

>Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON}
           (50979..51989) [1011 nt, 337 aa]
          Length = 336

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 108/257 (42%), Gaps = 60/257 (23%)

Query: 110 LVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTV--------------TDSIFTIF 155
           +++DTGS+  WV   N+        +   + HS +CT                D    I 
Sbjct: 80  VLVDTGSSDLWVSSPNNIYCY-EDGKNTNINHSINCTKFGTYTRDKSSTSNKLDHRLFIQ 138

Query: 156 YRSGT-AHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYALSGIFGLPSDPTDSDTSV 214
           Y  G+ A G   T TL+I    +Q  +FG++    +++     SG+ GL    T+S    
Sbjct: 139 YGDGSFADGEWITDTLTIGPYDLQSVQFGISNNASTII-----SGVLGLGFLRTESIDGY 193

Query: 215 VG-----------LLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGE 263
            G            L+  ++ N  +FS+ L+       N +D +G ++FG    + + G+
Sbjct: 194 DGSPNKLYYNLPAYLKDQEITNTNAFSLFLN-------NSNDASGTVLFGGIDYSKFSGD 246

Query: 264 LSYTPLV---PNPQNH---WLVAIKAAY---IGSERVELPTAKNPSIDKNIGIRSGIIDT 314
           L   PLV   P   N    + + ++  Y    G + + L   K P+          ++D+
Sbjct: 247 LVTFPLVNIYPKLINEPCTFTITLQQLYGKINGGKSIGLIKEKVPA----------LLDS 296

Query: 315 GSTLVVLPQE--DALAL 329
           GS+L+ +P E  D +AL
Sbjct: 297 GSSLISMPIEITDEIAL 313

>CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 591

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 128/310 (41%), Gaps = 57/310 (18%)

Query: 151 IFTIFYRSGTAHGPLYTGTLSINGLKIQDFRFGVA-----------IGVPSLLDAY--AL 197
            FT +  +  A G   T  + +  L I D  F VA           +G+P+L ++Y  AL
Sbjct: 190 FFTSYGDNSYASGLWGTDDVRLGNLSIADVFFAVANFSNSSTGVLGVGLPAL-ESYNPAL 248

Query: 198 SGIFG----LPSDPTDSDTSVVG---------LLQGSKLINKKSFSVLLSHIPSESRNLD 244
           S  F     LP + +D+D   +          +L+   +I K ++S+ L+       + +
Sbjct: 249 SDNFNVSDYLPVNASDADIDNISKPTYANFPQILKQKNVIEKVAYSLFLN-------DTN 301

Query: 245 DNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKN 304
             NG I+FG    + Y G LS  PLV +     +       I  + + L  ++      N
Sbjct: 302 ATNGQILFGAVDHSKYTGSLSTLPLVNSLYVEGINDTTQLEITLDGMGLKNSQGQFTIYN 361

Query: 305 IGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSEPIHLE--LSKHNW 362
             + + ++D+G+T+  LP    + LHS     +       I    +  I L+   +K++ 
Sbjct: 362 QKMPA-LLDSGTTVSYLP----IDLHSLVAKQLK-----GIVDPQTGFIELKNCPAKNDN 411

Query: 363 TILPSNFVG--------EPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIE 414
           T L  NF G        E   K    N Y     QG       +LG+ FL++ Y V+D+E
Sbjct: 412 TQLVFNFGGAFISIKYTEFIEKSDDDNCYVTFMPQG---EPGILLGDNFLRNAYIVYDLE 468

Query: 415 GRQVGFANRN 424
             ++  A  N
Sbjct: 469 DMEISIAQAN 478

>SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 556

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 70/309 (22%), Positives = 124/309 (40%), Gaps = 53/309 (17%)

Query: 142 SNSCTVTDSIFTIFY-RSGTAHGPLYTGTLSINGLKIQDFRFGVA-----------IGVP 189
           S++ +  D++F IFY  S  A+G      L ++ + I    F VA           IG+P
Sbjct: 192 SSTFSSNDTLFVIFYGDSSYAYGTWGQDELYLHDIDIGGLSFAVANQTNSTVGVLGIGLP 251

Query: 190 SLLDAYALSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGL 249
            L   Y  SG      +    D   + +L+ + +I   ++S+ L+   S S       G 
Sbjct: 252 GLEVTY--SGYASSARNRYQYDNFPL-ILKRNNVIKANAYSLFLNSTNSSS-------GS 301

Query: 250 IVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRS 309
           ++FG    + Y G+L   PL+   ++       + Y    + E+         + IG+R+
Sbjct: 302 LLFGAVDHSKYSGQLYTVPLLNTLES-------SGYTDPIQFEVAV-------QGIGVRT 347

Query: 310 -------------GIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIY-CNSSEPIHL 355
                         ++D+G+TL   P + A  +    D + S    + I  C SS+    
Sbjct: 348 SGSNTTLTTTVIPALLDSGATLSYFPVQVAEMIADALDATYSSSYGYYIVDCPSSDDDTE 407

Query: 356 ELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEG 415
            +       + S         + P    CV  I   + S+ +ILG+VFL   Y V+D++ 
Sbjct: 408 IIYDFGGFHIASKLTDYILTTNRP--SICVLGIVPQN-SNRFILGDVFLTSAYVVYDLDN 464

Query: 416 RQVGFANRN 424
            ++  A  N
Sbjct: 465 FEISLAQAN 473

>Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {ON}
           complement(141395..143161) [1767 nt, 589 aa]
          Length = 588

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 97/396 (24%), Positives = 153/396 (38%), Gaps = 102/396 (25%)

Query: 87  LLKRD-PLSRVHII-QATFGGVSYPL---------VLDTGSAISWVYGVN--------SS 127
           ++KRD  +  V I+ Q+ F  VS  +         +LDTGS+  WV G N        S+
Sbjct: 90  IVKRDNGVEEVEIMNQSNFYSVSLSIGSNAQNVTVLLDTGSSDLWVTGSNNPLCSRGDSN 149

Query: 128 SSANHKARQAFV--AHSNSCTVTDSIFTIFYR-SGTAHGPLYTGTLSINGLKIQDFRFGV 184
           S A   A+      + S++ +  ++ F+I Y  S  A G     TL +  L +    F V
Sbjct: 150 SDAVDCAKFGTFNPSTSDTWSSNETSFSISYADSSYASGTWGQDTLKLQDLDVTGLSFAV 209

Query: 185 A-----------IGVPSLLDAYALSGIFGLPSDPTDSDTSVVG----------LLQGSKL 223
           A           IG+PSL   Y+ S              +V G          LL+ S  
Sbjct: 210 ANYTNSTVGVLGIGLPSLEVTYSGS-------------NNVAGTRYQYENFPLLLKNSGA 256

Query: 224 INKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQN-------H 276
               ++S+ L        +LD   G ++FG      Y G L   PLV   +         
Sbjct: 257 TKANAYSLYL-------NDLDSRTGSVLFGGVDHNKYSGTLYTIPLVNTLRAAGFSQPVE 309

Query: 277 WLVAIKAAYIGSER---VELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYF 333
           + V ++   I  +    V L T K P+          ++D+G+TLV LP     AL S  
Sbjct: 310 FDVTLQGMGISDDEHGNVTLTTTKIPA----------LLDSGTTLVYLPS----ALVSLI 355

Query: 334 DDSISDGKN-----FAIYCNSSEP---IHLELSKHNWTILPSNFVGEPYPKDSPYNGYCV 385
            D      N     + + C  S+    I  +    + +   + ++ +         G CV
Sbjct: 356 ADEYDAVYNSRTGYYVMNCPDSDEDSQIVFDFGGFHISTNLTTYIIQ------AVGGICV 409

Query: 386 SNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFA 421
             I     S + ILG+ FLQ  Y V+D++  ++  A
Sbjct: 410 LGILPQS-SGTAILGDSFLQHAYVVYDLDNLEISMA 444

>KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa]
           {ON} Anc_8.318 YLR120C
          Length = 575

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 117/298 (39%), Gaps = 51/298 (17%)

Query: 150 SIFTIFYRSGTAHGPLYTGTLSINGLKIQDFRFGVA------IGVPSLLDAYALSGIFGL 203
           S F  +  S  A G      LSI+ + +    F VA      +GV  +     LSG+   
Sbjct: 204 SFFISYGDSSVAEGVWGQDVLSISDVDVSGVSFAVANYTNSTVGVLGI----GLSGLETT 259

Query: 204 PSDPTDSDTSVVG----LLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGAL 259
            S  + S++ +      LL+ S +I+  ++S+ L+          D  G ++FG    + 
Sbjct: 260 YSGTSSSESYIYENLPMLLKSSGVIDTIAYSLFLNEKS-------DTTGNLLFGAVDHSK 312

Query: 260 YEGELSYTPLV--------PNPQNHWLVAIKAAYIGSE-RVELPTAKNPSIDKNIGIRSG 310
           Y G L   P+V         NP    +         S+    + T K P++         
Sbjct: 313 YSGSLYTLPIVNVYASEGYKNPLEFDVTMYGLGISTSDSNTTIATMKIPAL--------- 363

Query: 311 IIDTGSTLVVLPQEDALALHSYFDDSISDGKNF-AIYCNSSE---PIHLELSKHNWTILP 366
            +D+G+T+V  P+     +      S SD   F A+ C SS        +    + T+  
Sbjct: 364 -LDSGTTIVYFPETLLELVADQLGASYSDELGFYAMSCVSSSDDTEFVFDFGGFHITVPL 422

Query: 367 SNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFANRN 424
           S+F+      +      C+  +   D   S ILG+ FL + Y V+D+E  ++  A  N
Sbjct: 423 SDFLIRVSGSE------CILAMAAQD-DESIILGDYFLTNAYVVYDLENYEISMAQAN 473

>ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]
           {ON} weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 521

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 77/353 (21%), Positives = 138/353 (39%), Gaps = 58/353 (16%)

Query: 110 LVLDTGSAISWVYG-VNSSSSANHKARQAFVAHSNSCTVTDSI----------------- 151
           LV+D+GSA +WV    N   S+N K+  +     N   +T++I                 
Sbjct: 62  LVVDSGSADTWVMASTNPFCSSNAKSGASKNYTYNGKAITETIDCQGLTALDVNSSSQFR 121

Query: 152 ------FTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVAI----GVPSLLDAY--ALS 198
                 F I Y  G+   G   T  +S  G  I   +FGVA      +P +L        
Sbjct: 122 DLNVGRFYINYTDGSFDDGYWATDEVSAAGAHISGLQFGVAQYASEEIPGILGLGFPRRE 181

Query: 199 GIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGA 258
            + G P  P     +   +L+   +I+  ++S+ L+  P+ S       G ++FG    +
Sbjct: 182 SVRGYPGAPNKFYDNFPQMLKKDGIIDVVAYSMYLND-PNGS-----GGGSVLFGGVDPS 235

Query: 259 LYEGELSYTPLV---PN-PQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDT 314
            Y G+L   P+    PN       +A+     G+++      +  + D N    + ++D+
Sbjct: 236 KYSGDLYTFPMANQYPNIVSKPATLAVTLQGFGAQKKS--EGRQETFDTNN--YAVLLDS 291

Query: 315 GSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSEP------IHLELSKHNWTILPSN 368
           G++L+  P+E    +  + + +    ++  IY     P         +       +  S 
Sbjct: 292 GTSLMGAPEEVVSKMAHFINKNARFSEDDGIYVMDCPPKDDDTEFVFDFGDLQIAVPVST 351

Query: 369 FVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFA 421
            +  P  +      YC   +   D   +W LG+VFL   Y VFD++  +V  A
Sbjct: 352 LILPPSGES-----YCGLGVLPKD--GTWTLGDVFLSYAYLVFDLDNYKVSMA 397

>Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score = 37.7 bits (86), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 106/263 (40%), Gaps = 47/263 (17%)

Query: 88  LKRDPLSRVHIIQATFGGVSYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTV 147
           + +D L  V ++++ F  +SY   + T  A + +    S+S A +         S S T 
Sbjct: 130 VNKDNL--VSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTF 187

Query: 148 --TDSIFTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVA-----------IGVPSLLD 193
               + F+I Y   T A G      LS+N L +    F VA           IG+P L  
Sbjct: 188 ESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLES 247

Query: 194 AYALSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFG 253
            Y  SG+    +  + +  +   +L+ S  I   ++S+  +H        D  +G I+FG
Sbjct: 248 TY--SGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNH-------SDSKHGTILFG 298

Query: 254 EPLGALYEGELSYTPLVPNPQN-------HWLVAIKAAYIG-SERVE----LPTAKNPSI 301
                 Y G+L   P++   QN        + V ++   +   ER E    L T K P  
Sbjct: 299 AVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPV- 357

Query: 302 DKNIGIRSGIIDTGSTLVVLPQE 324
                    ++D+G+T+  +P +
Sbjct: 358 ---------LLDSGTTISYMPAD 371

>CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa]
           {ON} similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 601

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 77/317 (24%), Positives = 124/317 (39%), Gaps = 72/317 (22%)

Query: 141 HSNSCTVTDSIFTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVA-----------IGV 188
           HSN     D+ F I Y   T A G      L ++ L +    F VA           IG+
Sbjct: 209 HSN-----DTAFMIQYGDSTFASGTWGMDNLHLSDLNVTGLSFAVANRTNSTVGVLGIGL 263

Query: 189 PSLLDAY----ALSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLD 244
           P+L   Y    A+SG       P   D   + LL+    I   S+S+ L++  +E+    
Sbjct: 264 PALEVTYSGRTAVSG-----QRPYQYDNFPLVLLRNGA-IKSNSYSLFLNNASAET---- 313

Query: 245 DNNGLIVFGEPLGALYEGELSYTPLV--------PNPQNHWLVAIKAAYIGS--ERVELP 294
              G ++FG    + Y G+L   P+V         NP   + V +    I S  +   + 
Sbjct: 314 ---GSVLFGAVDHSKYLGDLYTIPMVNTYASQGYKNPI-QFEVTLNGLGISSSSDNTTIT 369

Query: 295 TAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSE--- 351
           T K P++          +D+G+TL  LPQ     +      + S+   + ++   S+   
Sbjct: 370 TTKIPAL----------LDSGTTLTYLPQALVTRIVQKLQATYSNRAGYYVFSCPSQSDD 419

Query: 352 -PIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQ---GGDISSSWILGEVFLQDL 407
             +  +    +     +NF+      DS     C+  I    GG I    ILG+ FL   
Sbjct: 420 TEVVFDFGGFHINAPITNFI-IGSSGDS-----CILGIMPQSGGGI----ILGDSFLNSA 469

Query: 408 YTVFDIEGRQVGFANRN 424
           Y V+D+E  ++  A  N
Sbjct: 470 YVVYDLENYEISMAQAN 486

>NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score = 37.4 bits (85), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 88/411 (21%), Positives = 157/411 (38%), Gaps = 80/411 (19%)

Query: 61  LKYNRSGAETKKSAQCNSLTFRPNISLLKRD--PLSRVHII-QATFGGVSY--------- 108
           L++N+   +   +A  +S   +P + L+KRD      V +  Q +F  V           
Sbjct: 36  LRFNKKYGDHYDTASTDSR--KPKLELVKRDGSDYEEVELTNQQSFYSVEVDVGTPSQRV 93

Query: 109 PLVLDTGSAISWVYG--------------VNSSSSANHKARQAFVAHSNSCTVTDSIFTI 154
            ++LDTGS+  WV G              ++ S      +  +   H+N      + F I
Sbjct: 94  TVLLDTGSSDFWVMGSDNPYCSDDTSTTGIDCSEFGTFDSSSSSTFHNNG-----TAFNI 148

Query: 155 FYRSGT-AHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYALSGIFGLPSDPTDSDTS 213
            Y  G+ A G   T T+SI+ + +      VA    S +    L G+ GL +  + S   
Sbjct: 149 HYGDGSFALGTWGTDTVSIDDITLDALSLAVANSSNSSMGVIGL-GLAGLETTYSSSHAV 207

Query: 214 VVG----------LLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGE 263
             G           L+ + ++   ++S+ L+  P E+       G I+FG    +LY G+
Sbjct: 208 KSGQTYQYANFPLALKNAGIVAANAYSLYLND-PEETT------GNILFGAVDHSLYSGQ 260

Query: 264 LSYTPLV--------PNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTG 315
           L   PLV         N     +       + S       +  P I         ++D+G
Sbjct: 261 LYTIPLVNIYSGSGFKNAVEFDVTLNGIGIVDSSGSATTVSTTPII--------ALLDSG 312

Query: 316 STLVVLPQEDALALHSYFDDSISDGKN-FAIYCNSSE----PIHLELSKHNWTILPSNFV 370
           +TL   P +    L +      S     + I C++ +     +  +    +     ++FV
Sbjct: 313 TTLTYFPTQYVSLLAAQLGAQYSSSNGYYTISCDAMQDTTTKLVFDFGGFHINATLADFV 372

Query: 371 GEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFA 421
            +           C  +I   + SSS ILG+ FL + Y V+D++  ++  A
Sbjct: 373 VQSGTST------CFLSIIPQN-SSSAILGDTFLNNAYVVYDLDNLEISMA 416

>KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score = 37.4 bits (85), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 82/198 (41%), Gaps = 37/198 (18%)

Query: 242 NLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWL------------VAIKAAYIGSE 289
           +L++  G I+FG    + Y G +   P++   Q++              + + ++    +
Sbjct: 229 DLEEERGSILFGAVDHSKYTGSMYTLPIINRLQSYGYTTPIQFDITLQGIGLSSSESNGD 288

Query: 290 RVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYC-- 347
            V + + K P++          +D+G+T+  LP      +      S+S    F  Y   
Sbjct: 289 EVTITSTKMPAL----------LDSGTTMTYLPSNIVSQIAQQLGASMS--ARFGQYVLP 336

Query: 348 --NSSEPIHLELSKHNWTILP--SNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVF 403
             N  E +HL      + I    +N++ +           C+  +   D S++ ILG+ F
Sbjct: 337 CSNVPENMHLVYDFGGFHINSNLTNYIVQASQT------LCILGLFPRD-SNTAILGDTF 389

Query: 404 LQDLYTVFDIEGRQVGFA 421
           L D Y V+D+E  Q+G A
Sbjct: 390 LTDAYVVYDLENLQIGLA 407

>Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar to
           Ashbya gossypii AGR240W
          Length = 518

 Score = 37.0 bits (84), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 85/371 (22%), Positives = 142/371 (38%), Gaps = 89/371 (23%)

Query: 110 LVLDTGSAISWVY-------------GVNSSSSANHKARQAFVA---------HSNSCTV 147
           ++ DTGSA  W               G NS+++ +++   A             S++ T 
Sbjct: 67  VLFDTGSADLWFQSSDNEYCAASYPQGDNSTNTNDNEQNMASFCSSSRTYNFQRSSTFTP 126

Query: 148 TDSIFTIFYRSGTAHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYALSGIFGLPSDP 207
           T   F I Y +  + G      L I    +   +FGV     S +    ++GI G+  + 
Sbjct: 127 TGYKFFIDYVNTFSRGIWAKDRLVIGNADVSGLQFGV-----SNISNTTINGILGVGYER 181

Query: 208 TDSDTSVVG-----------LLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPL 256
            +S     G           LL+ S  I+K ++SV L+H       L+ N   + FG   
Sbjct: 182 LESVKGYSGAPNRTYPNLPMLLKESGKIDKVAYSVFLNH-------LNSNVSTVTFGGVD 234

Query: 257 GALYEGELSYTPLV------PNPQNHWLVAIKAAYIGSERVEL-PTAKNPSIDKNIGIRS 309
              Y G+L   PLV      P P + + + ++A  +      L  T  N  +        
Sbjct: 235 SEKYTGDLYKFPLVNIYKSIPRP-SKFHITLQALEVHGNYSSLNKTVSNTPL-------P 286

Query: 310 GIIDTGSTLVVLP----QEDALALHSYFDDSISDGKNFAIYCNSSEP----------IHL 355
            + DTG+  +V+P    +  A  +H+ FD+  S    +   C + E           I +
Sbjct: 287 ALFDTGTNGMVVPPNVAENIASTIHATFDEKFSL---YLFACPAEEDDTKLVFDFGDIQI 343

Query: 356 ELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEG 415
           E    N+ I+P+  +G            C   I   D   ++ LG  FL+  Y V+++E 
Sbjct: 344 EAPLANF-IVPAAELGTEQ---------CGVAIIPED--GTFTLGIPFLRSTYVVYNLED 391

Query: 416 RQVGFANRNTK 426
            +V  A  N K
Sbjct: 392 YEVALAQANWK 402

>ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score = 37.0 bits (84), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 124/305 (40%), Gaps = 59/305 (19%)

Query: 149 DSIFTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYALSGIFGLPSDP 207
           ++ F I Y  G+ A G      + +  L I D    VA    S +    +    GLP   
Sbjct: 219 NTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLGI----GLPGLE 274

Query: 208 T--DSDTSVVG----------LLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEP 255
           T   SD S+V           ++   + I KK+   L  + P      D +NG I+FG  
Sbjct: 275 TTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSP------DAHNGSILFGAV 328

Query: 256 LGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTG 315
             + ++G L   P++   ++  +       +  + + L    + +      I + ++D+G
Sbjct: 329 DKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQTSTTTLSTTKIPA-LLDSG 387

Query: 316 STLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSEPIHLEL----SKHNWTILPSNFVG 371
           STL  LP ED L +       ++DG    +    SE ++  L    SKH+ T +  NF G
Sbjct: 388 STLAYLP-EDLLEM-------VADG----LGARFSENLNYYLMDCPSKHDETKIVFNFGG 435

Query: 372 -----------EPYPKDSPYNGYCVSNI-QGGDISSSWILGEVFLQDLYTVFDIEGRQVG 419
                       P   D+     CV  I   GD  SS ILG+ FL   Y V+D+E  ++ 
Sbjct: 436 FNIETNLTTYTTPISSDT-----CVLRILPSGD--SSAILGDAFLVHAYVVYDLEDFEIS 488

Query: 420 FANRN 424
            A  N
Sbjct: 489 MAQAN 493

>CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7
          Length = 505

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 75/323 (23%), Positives = 120/323 (37%), Gaps = 85/323 (26%)

Query: 151 IFTIFYRSGTAHGPLYTGTLSINGLKIQDFRFGVA-----------IGVPSLLDAYAL-- 197
            F  +  S  A G   T  L +NGL I    FG+A           +G+  L  +Y    
Sbjct: 136 FFISYLDSSYAEGVWATDNLYLNGLNISGLNFGLAYFSNSSNSVLGVGLTPLEASYDTDI 195

Query: 198 ----SGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFG 253
               S  F  P+ P         +L+    I+K ++S+ L+   S+        G I+FG
Sbjct: 196 KQDDSPRFQYPNFPQ--------ILKQKGAISKVTYSLYLNDTKSKY-------GQILFG 240

Query: 254 EPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRS---- 309
               + Y G+L   PLV +             I    V L           +GIR     
Sbjct: 241 GVDHSKYVGQLYTIPLVNSKYQK-----SPGVIADLEVTL---------NGLGIRDNTTN 286

Query: 310 -----------GIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSEPIHLEL- 357
                       + D+G++   +P   A  + S  + +I          N +E I L   
Sbjct: 287 TNTTLYTQKLPALFDSGTSYSYVPYTMAQVIASQVNGTID---------NKTEAIRLPKC 337

Query: 358 -SKHNWTILPSNFVG--------EPYPKDSPYNGYCVSNIQGG--DISSSWILGEVFLQD 406
            SK +   +  NF G        + Y K S   G C  ++     +     +LG+ FL+ 
Sbjct: 338 PSKKDTREVVFNFNGVEIAIPLKQFYQKKS---GKCYLDLMVAPPNNGPGLLLGDTFLRQ 394

Query: 407 LYTVFDIEGRQVGFANRNTKATL 429
           +YTVFD+E +++  A  N  ++L
Sbjct: 395 VYTVFDLEAQELSIARANFNSSL 417

>TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 103/262 (39%), Gaps = 36/262 (13%)

Query: 175 LKIQDFRFGVA-----------IGVPSLLDAYALSGIFGLPSDPTDSDTSVVGLLQGSKL 223
           L + DF FGVA           +G+P L   Y  SG+  L   P       + L Q S L
Sbjct: 232 LNLTDFSFGVADLTNSTISVLGMGLPRLEVTY--SGL-SLDRSPYTYANFPMALKQ-SGL 287

Query: 224 INKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKA 283
           I++  +S+ L+   + +       G ++FG    + Y G L+  PL+    +   +A   
Sbjct: 288 IDRMVYSLYLNKAGAST-------GSVLFGAVDHSKYHGSLNTIPLISLSGSGIPIAFNV 340

Query: 284 AYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKN- 342
           A  G             +   +     ++D+G+T+  LP      + S    S  + +  
Sbjct: 341 ALQGLGMSSDSQGTQTFLSTPL---PALLDSGTTMTYLPDALVATVASTLGASFDEAQGL 397

Query: 343 FAIYCNS---SEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWIL 399
           + + C S       + +      ++  SNF+ E  P        CV  +       + IL
Sbjct: 398 YLLDCPSGSDDREFNFDFGGFQISVPLSNFILEALPD------VCVLTLFESHAERA-IL 450

Query: 400 GEVFLQDLYTVFDIEGRQVGFA 421
           G+ FL + Y V+D+E  ++  A
Sbjct: 451 GDSFLTEAYVVYDLENLEISMA 472

>KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {ON} 
          Length = 540

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 54/120 (45%), Gaps = 11/120 (9%)

Query: 311 IIDTGSTLVVLPQEDALALHSYFDDSISDGKN-FAIYCNSSEP---IHLELSKHNWTILP 366
           ++D+GST   LP      L S  + + S+  N + + C S E    +  +L      +  
Sbjct: 331 LLDSGSTTSYLPDTLVSMLASALNATFSEKINGYTLKCPSEEDATFLSFDLGGFLIDVPL 390

Query: 367 SNFVGEPYPKDSPYNGYCVSNIQG-GDISSSWILGEVFLQDLYTVFDIEGRQVGFANRNT 425
           S+ V + +         CV  ++G G+    +ILG+ FL   Y V+D+E  ++     +T
Sbjct: 391 SDLVAKRHKNQ------CVLMVKGQGEGEGGYILGDTFLSSAYVVYDLESYEISIGQAST 444

>ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 486

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 79/378 (20%), Positives = 146/378 (38%), Gaps = 71/378 (18%)

Query: 110 LVLDTGSAISWVYGVNSSSSANHKARQAF---------------------------VAHS 142
           ++LDTGS+  WV G ++    NH    +                             + S
Sbjct: 85  VLLDTGSSDLWVPGADNLFCENHAVSDSNSTDKPLKSPTLPSPQPTIDCNQYGTFDYSKS 144

Query: 143 NSCTVTDSIFTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYALSGIF 201
           +S    DS   I Y   + A G     T+ +N L I +   GVA           + G+ 
Sbjct: 145 SSFKANDSSLLIRYGDQSYALGRFGQDTVEMNSLSIPNVSLGVAHQANVTQGVLGI-GLA 203

Query: 202 GLPSDPTDSDTSVVG----------LLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIV 251
           GL +  T   +++            +L+   +I+  ++S+ L+  P  S+      G I+
Sbjct: 204 GLETTNTGFSSTLNSKSYTYENFPQVLKSQGIIDANAYSLFLNS-PGASQ------GGIL 256

Query: 252 FGEPLGALYEGELSYTPLV----PNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGI 307
           FG    + Y G L   P++    P     + V ++   I  ++             N+ +
Sbjct: 257 FGGVDHSKYTGPLYTVPIINTGAPGNPIQFQVTLQGVGISLDKSNGTNTNAADSTSNVTL 316

Query: 308 RSG----IIDTGSTLVVLPQ--EDALA--LHSYFDDSISDGKNFAIYC---NSSEPIHLE 356
            +     ++D+G+TL+ LP+   D +A  L + ++   S+   + + C   N +  + L+
Sbjct: 317 TASKFPVLLDSGTTLMTLPRPVTDQMAKQLGATYN---SETSYYQLKCPSQNDNTRLILD 373

Query: 357 LSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGR 416
                     +N +          NG C+  I   D + S  LG+VFL D Y V+D++  
Sbjct: 374 FGGFQVNAKITNHITRSQ------NGECLLGITPSD-TDSGTLGDVFLVDAYVVYDLDNY 426

Query: 417 QVGFANRNTKATLVHNEP 434
           ++  A  +   +    EP
Sbjct: 427 EISLAQADFSDSAQSIEP 444

>YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}
           MKC7GPI-anchored aspartyl protease, member of the yapsin
           family of proteases involved in cell wall growth and
           maintenance; shares functions with Yap3p and Kex2p
          Length = 596

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 79/364 (21%), Positives = 143/364 (39%), Gaps = 49/364 (13%)

Query: 88  LKRDPLSRVHIIQATFGGVSYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTV 147
           + +D L+ V  +++ F  +SY   + T  A +      S+S     A       S S T 
Sbjct: 130 VNKDALASV--VESVFTEISYDTTIVTSEATATFDSTASTSQLIDCATYGTFNTSKSSTF 187

Query: 148 T--DSIFTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVA-----------IGVPSLLD 193
              ++ F+I Y   T A G      LS+N L I    F VA           IG+P L  
Sbjct: 188 NSNNTEFSIAYGDTTFASGTWGHDQLSLNDLNITGLSFAVANETNSTVGVLGIGLPGLES 247

Query: 194 AYALSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFG 253
            Y+   +  +    T ++  +V  L+ S +I   ++S+        + + D  +G I+FG
Sbjct: 248 TYSGVSLSSVQKSYTYNNFPMV--LKNSGVIKSTAYSLF-------ANDSDSKHGTILFG 298

Query: 254 EPLGALYEGELSYTPLVPNPQNHWL---VAIKAAYIGSERVELPTAKNPSIDKNIGIRSG 310
                 Y G+L   P++   Q+      +  +    G     L T+K    D    + + 
Sbjct: 299 AVDHGKYAGDLYTIPIINTLQHRGYKDPIQFQVTLQG-----LGTSKGDKEDNLTTLTTT 353

Query: 311 ----IIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSEPIHLELSKHNWTILP 366
               ++D+G+T+  +P E    L      + S    + I     + I  E+ + +  I  
Sbjct: 354 KIPVLLDSGTTISYMPTELVKMLADQVGATYSSAYGYYIM----DCIK-EMEEESSIIFD 408

Query: 367 ------SNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGF 420
                 SN++ +        +  C+  I       + ILG+ FL + Y V+D++  ++  
Sbjct: 409 FGGFYLSNWLSDFQLVTDSRSNICILGI-APQSDPTIILGDNFLANTYVVYDLDNMEISM 467

Query: 421 ANRN 424
           A  N
Sbjct: 468 AQAN 471

>Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {ON}
           YLR120C (REAL)
          Length = 569

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 69/296 (23%), Positives = 113/296 (38%), Gaps = 54/296 (18%)

Query: 152 FTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVA-----------IGVPSLLDAYALSG 199
           F+I Y  GT A G   T  L ++ L +    F VA           IG+P L   Y  SG
Sbjct: 207 FSISYGDGTFASGTFGTDILDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTY--SG 264

Query: 200 IFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGAL 259
                S    +  +   +L+ S  I   ++S+ L        + D  +G I+FG    + 
Sbjct: 265 STASSSRRPYTYDNFPMVLKNSGAIKTNAYSLYL-------NDSDAKHGTILFGAVDHSK 317

Query: 260 YEGELSYTPLV----------PNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRS 309
           Y G L   P+V          P   +  +  I  +Y  + +  L T + P++        
Sbjct: 318 YAGTLYTVPIVNTLSASGFSSPIQFDVTINGIGISYPDNSQKTLTTTQIPAL-------- 369

Query: 310 GIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIY-CNS---SEPIHLELSKHNWTIL 365
             +D+G+TL  LPQ     +    D   S    + +  C S   S  I  +    +    
Sbjct: 370 --LDSGTTLTYLPQAVVAMIADELDAQYSSRLGYYVLDCPSNSNSTQIVFDFGGFHINAS 427

Query: 366 PSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFA 421
            S+F+             C+  I   D   + ILG+ FL + Y V+D++  ++  A
Sbjct: 428 LSSFILNA-------GNICLLGIIATD--DTTILGDSFLTNAYVVYDLDNLEISMA 474

>TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {ON} 
          Length = 689

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 60/275 (21%), Positives = 114/275 (41%), Gaps = 48/275 (17%)

Query: 173 NGLKIQDFRFGVA-----------IGVPSLLDAYALSGIFGLPSDPTDSDTSVVGLLQGS 221
           +GL +    F VA           IG+P L   YA  G++      T  +  +V  L+ S
Sbjct: 328 DGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYA--GVYQTTKPYTYDNFPLV--LKNS 383

Query: 222 KLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYT-PLVPNPQNHWLVA 280
             I+K ++S+ L+   ++       NG ++FG    + Y+G+  YT PLV +  +     
Sbjct: 384 GAIHKSAYSLYLNKQSAK-------NGNVLFGAIDHSQYQGDTLYTIPLVNSDTSSGYSK 436

Query: 281 IKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDG 340
                +  + + +   +N +          ++D+G+TL   P++    L    + S S+ 
Sbjct: 437 PIEFDVTLQGLGVSDNRNGNFTVTTTQIVALLDSGTTLTYFPKDMLNLLAKRINASYSEA 496

Query: 341 KNFAIY-CNSSEP----------IHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQ 389
             + +  C  S             H++ +  N+ +  S+  G+      PYNG       
Sbjct: 497 LGYYVMNCPDSRDNTQLVFDFGGFHIKTNLTNFVL--SSASGKCVLGLLPYNG------- 547

Query: 390 GGDISSSWILGEVFLQDLYTVFDIEGRQVGFANRN 424
                +S ILG++FL   Y V++++  ++  A  N
Sbjct: 548 -----NSAILGDIFLTHAYVVYNLDDLEISMAQAN 577

>Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {ON}
           YLR121C (REAL)
          Length = 745

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 83/346 (23%), Positives = 140/346 (40%), Gaps = 61/346 (17%)

Query: 110 LVLDTGSAISWV----------------YGV----NSSS-SANHKARQAFVAHSNSCTVT 148
           ++LDTGSA  WV                YGV    NSS+ +ANH A   F A     T  
Sbjct: 79  VLLDTGSADLWVPSNANPYCGSAMNCDQYGVFDKANSSTFTANHSA--PFYASYGDGTFA 136

Query: 149 DSIFTIFYRSGTAHGPLYTGTLSINGLKI-----QDFRFGV-AIGVPSLLDAYALSGIFG 202
           + +F         H   Y+G L ++GL        +   GV  IG+P L   Y  SG   
Sbjct: 137 EGVF----GQDKLH---YSGGLDLSGLSFAVANKSNSTVGVLGIGLPMLEVTY--SGKVA 187

Query: 203 LPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEG 262
           +    +    +    L+ S  I+  ++S+ L+     S       G ++FG    + Y G
Sbjct: 188 VADKRSYQYDNFPLFLKRSGAIDATAYSLFLNDETQTS-------GSVLFGAVDHSKYLG 240

Query: 263 ELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLP 322
           +L   PLV   +        A  +  + + L T  + +      I + ++D+G+TL  LP
Sbjct: 241 QLYTIPLVNLYKAQGYQRPVAFDVTLQGLGLQTRAHNTTLTTTRIPA-LLDSGTTLTYLP 299

Query: 323 QEDALALHSYFDDSISDGKNFAIYC-----NSSEPIHLELSKHNWTILPSNFVGEPYPKD 377
            +    +    + + S    +  Y      +++  +  +L   +     S+F  +     
Sbjct: 300 ADAVALMAKSLNATFSKELGYYEYACPTSGDNATSVVFDLGGFHINAPLSDFTMQTNV-- 357

Query: 378 SPYNGYCVSNI--QGGDISSSWILGEVFLQDLYTVFDIEGRQVGFA 421
               G CV  I  Q G+ ++  ILG+ FL+  Y V+D++  +V  A
Sbjct: 358 ----GTCVLAIVPQAGNATA--ILGDSFLRSAYVVYDLDNYEVSLA 397

>CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 516

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 76/322 (23%), Positives = 127/322 (39%), Gaps = 51/322 (15%)

Query: 135 RQAFVAHSNSCTVTDS---IFTIFYRSGTAHGPLYTGTLSINGLKIQDFRFGVA------ 185
           +  F   S+S T  ++   IF  +       G   T  +S+ GL I    F VA      
Sbjct: 122 KYGFFNMSSSSTFKNNDTDIFLYYEDLSFVRGTWGTDVVSLGGLNISGVNFAVAEISNSS 181

Query: 186 -----IGVPSLLDAYALSGIFGLPSDPTDSDTSVVGL-LQGSKLINKKSFSVLLSHIPSE 239
                + +PS    Y+++      ++ T+   S + L L+   +I+K ++S+ L+   S+
Sbjct: 182 SGVLGVSLPSEESTYSINS--NGTTNATNYQYSNLPLQLKEQGIIDKVTYSIYLNDTKSK 239

Query: 240 SRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNP 299
                   G I+FG    + Y G L   PLV    N     +   Y     + L      
Sbjct: 240 Y-------GSILFGAVDHSKYTGTLYTLPLV----NSEYDVVNKPY--ELDITLNGIGYQ 286

Query: 300 SIDKNIGIR----SGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSEPIHL 355
           S+  N+ +     + +ID+G+T+   P E    +    + ++    N          I L
Sbjct: 287 SMSSNMTLYDQKVAALIDSGTTISEFPDEIVEVVAKQMNATVDPNGN---------GIRL 337

Query: 356 EL--SKHNWTILPSNFVGEPYPKD-----SPYNGYC-VSNIQGGDISSSWILGEVFLQDL 407
               SK +   L  N  G     D     +   G C +  I  G  S   ILG+ F++ +
Sbjct: 338 AKCPSKKDNAKLLFNLGGALIYVDIKEFTTKVKGKCYLEIIPSGAESDLVILGDNFMRSV 397

Query: 408 YTVFDIEGRQVGFANRNTKATL 429
           YTVFD+E  +V  A  N  ++L
Sbjct: 398 YTVFDLEANEVSIAQANFNSSL 419

>Suva_9.186 Chr9
           (310161..310220,310267..310332,310362..310451,
           310470..310622,310626..310658,310662..310688,
           310692..310742,310746..310787,310807..310833,
           310840..311922) [1632 bp, 543 aa] {OFF} YIL015W (PSEUDO)
          Length = 543

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 382 GYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFANRNTKAT 428
           GYC   +Q  +   S +LG+VFL   Y VFD++  ++  A  N  A+
Sbjct: 308 GYCGFAVQPTN--DSMVLGDVFLSSAYVVFDLDNYKISLAQANWNAS 352

>Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W
           (REAL)
          Length = 333

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 382 GYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFANRN 424
           GYC   +Q  +   S +LG+VFL   Y VFD++  ++  A  N
Sbjct: 98  GYCGFAVQPTN--DSMVLGDVFLSSAYVVFDLDNYKISLAQAN 138

>YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON}
           YPS1Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 569

 Score = 34.7 bits (78), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 114/303 (37%), Gaps = 67/303 (22%)

Query: 152 FTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVA-----------IGVPSLLDAYALSG 199
           F+I Y  GT A G   T  L ++ L +    F VA           IG+P L   Y  SG
Sbjct: 207 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTY--SG 264

Query: 200 IFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGAL 259
                S       +   +L+ S  I   ++S+ L        + D  +G I+FG    + 
Sbjct: 265 STASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYL-------NDSDAMHGTILFGAVDHSK 317

Query: 260 YEGELSYTPLV----------PNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRS 309
           Y G L   P+V          P   +  +  I  +  GS    L T K P++        
Sbjct: 318 YTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGISDSGSSNKTLTTTKIPAL-------- 369

Query: 310 GIIDTGSTLVVLPQED----ALALHSYFDDSISDGKNFAIYCNSSEPIHLELSKHNWTIL 365
             +D+G+TL  LPQ      A  L + +   I     + + C S + + +      + I 
Sbjct: 370 --LDSGTTLTYLPQTVVSMIATELGAQYSSRIG---YYVLDCPSDDSMEIVFDFGGFHI- 423

Query: 366 PSNFVGEPYPKDSPYNGY-------CVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQV 418
                      ++P + +       C+  I      +  ILG+ FL + Y V+D+E  ++
Sbjct: 424 -----------NAPLSSFILSTGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEI 472

Query: 419 GFA 421
             A
Sbjct: 473 SMA 475

>KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.182
           YIL015W
          Length = 563

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 120/300 (40%), Gaps = 52/300 (17%)

Query: 152 FTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYALSGIFGLPSDPTDS 210
           F I Y   T A G   T T    G+KI + +FG+A         YA + I G+       
Sbjct: 139 FYIIYGDKTFADGIWGTETFEFGGVKIPNVQFGLA--------DYATTPIGGVLGIGFQR 190

Query: 211 DTSVVG--------------LLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPL 256
             SV G              +L+   +I+  ++S+ L             +  I+FG   
Sbjct: 191 RESVKGYTNAPEVFYPNFPQVLKNEGIIDTVAYSLSLGQ-----------SSHIMFGAID 239

Query: 257 GALYEGELSYTPLV---PNPQNH-WLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGII 312
              Y G++   P++   PN  +    ++I    +G++  +    +  S  K       ++
Sbjct: 240 RNSYIGDMVTFPMINMFPNAVSKPATLSITIQGLGAQNKQECKFQTFSTTK----YPALL 295

Query: 313 DTGSTLVVLPQEDALALHSYFDDSISDGKN-FAIYC-NSSEPIH--LELSKHNWTILPSN 368
           D+GSTL+  P E A  + ++     S+    + + C N +  I    +     +T+  SN
Sbjct: 296 DSGSTLISAPVEIADKMAAFIGAQWSESDGIYTLECPNDTTNIDYIFDFGDMKFTLPLSN 355

Query: 369 FVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFANRNTKAT 428
            +    P     N  C   +Q  D  +  +LG+VFL     VFD++  Q+  A  N K++
Sbjct: 356 LI---LPSQGGSN-VCGFGLQRSD--NEIVLGDVFLCSTLVVFDLDHYQISLAKSNQKSS 409

>ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 528

 Score = 34.3 bits (77), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 68/320 (21%), Positives = 132/320 (41%), Gaps = 49/320 (15%)

Query: 125 NSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGPLYTGTLSINGLKIQDFRFGV 184
           N +++A  +A  +   H N    TD  +  +     A G   T  L +  L++ +  F V
Sbjct: 191 NCNATAFFEADNSKTFHRNR---TDPYYIQYEDLSYASGYWGTDDLQLGDLQVHNVSFAV 247

Query: 185 A-----------IGVPSLLDAYALSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLL 233
           A           IG P    ++A  G     + P +   +    L+   +I + ++S+ L
Sbjct: 248 ANDTNSTTPVFGIGFPGGESSFASVGPEYRAAHPHEY-ANFPQTLKNQGIIQRVAYSLYL 306

Query: 234 SHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVP--------NPQNHWLVAIKAAY 285
           +   S   N       ++FG    + Y+G+L   P++         +P N   + ++   
Sbjct: 307 NSPNSTYGN-------VLFGGVDHSQYQGQLYTLPILQLGNLTSDGDPYNTLAITLQGV- 358

Query: 286 IGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSIS-DGKNFA 344
                V    +K+    K I +   ++D+G+T + LP + A ++ S +   +  + + + 
Sbjct: 359 ----SVTRRGSKHKVKTKPIPV---VLDSGTTAMYLPYKLAKSIASRYHGILGPEDQGYI 411

Query: 345 IYC-NSSEPIHLELSKHNWTILPS--NFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGE 401
           I C  S +  ++       TI     N++ E        N   +  I   DI +  + G+
Sbjct: 412 IDCPKSGDNDYITFDFGGVTIKTDIRNYIFE-----QSENKCLLGIIPNSDILA--VFGD 464

Query: 402 VFLQDLYTVFDIEGRQVGFA 421
           VFL D Y V+D+EG+++  A
Sbjct: 465 VFLTDAYVVYDLEGKEISLA 484

>TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {ON}
           Anc_8.318 YLR120C
          Length = 596

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 62/285 (21%), Positives = 112/285 (39%), Gaps = 66/285 (23%)

Query: 170 LSINGLKIQDFRFGVA-----------IGVPSLLDAYALSGIFGLPSDPTDSD---TSVV 215
           LS   + +    FGVA           IG+P L   Y     FG  +   +S     +  
Sbjct: 238 LSFQDINVTGLSFGVANVTNSTVGVLGIGLPELESTY-----FGTVNSVNESSYIYNNFP 292

Query: 216 GLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVP-NPQ 274
            +L+ S +INK ++S+ L+         D   G ++ G    + +  +L   P++  NP 
Sbjct: 293 QVLKNSGIINKTAYSLFLNK-------SDSTQGSLLLGAVDTSKFADKLYTVPMLNINPS 345

Query: 275 NHW--------LVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDA 326
             +        L+     Y   +   +P+++ P +          +D+G+T+V LP+   
Sbjct: 346 KGYTDPSAFLVLMQKMTRYKYGQGHLVPSSRIPVL----------LDSGTTMVYLPRSIV 395

Query: 327 LALHSYFDDS-ISDGKNFAIYCNSSEPIHLELSKHNWTILPSNFVGEP---------YPK 376
             +  + +   + +   + I C S        +K N T    +F G            P 
Sbjct: 396 EQIMRHEEAQYVEELDLYQIKCPSP-------NKKNQTSFSFDFGGFQIKASLSDFIVPT 448

Query: 377 DSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFA 421
           D   NG C+  +   D++   ILG+ FL   Y V+D+E  ++  A
Sbjct: 449 D---NGQCIFGMIPQDMNVG-ILGDSFLTHAYVVYDLEDYEISMA 489

>SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some
           similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 592

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 73/313 (23%), Positives = 122/313 (38%), Gaps = 62/313 (19%)

Query: 142 SNSCTVTDSIFTIFYRSGTA-HGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYALSGI 200
           S+S +  D+ F I Y   TA +G      L +  L+I D  F VA+        + +   
Sbjct: 177 SSSFSANDTEFYISYLDSTAAYGIWAQDVLKLGDLEISDMPFAVAVVGDVQTPVFGV--- 233

Query: 201 FGLPSDPTDSDTSVVG---------LLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIV 251
            G P   + + +SV           LL+    + K  +S+ L          D ++G  +
Sbjct: 234 -GFPGTESTAGSSVKEPYEYANFPVLLKSQGYVKKVVYSLFL-------DAQDSSSGSFL 285

Query: 252 FGEPLGALYEGELSYTPL---------VPNPQNHWLVAIKAAYIGSERVELPTAKNPSID 302
            G    + Y G L   P+         + +  + +++ ++   I S++ E  T       
Sbjct: 286 LGAVDHSKYSGGLYTLPMYSGTDGDDTLSSTPSRFIITLQGLGI-SDKGENKTVAT---- 340

Query: 303 KNIGIRSGI-IDTGSTLVVLPQEDALALHSYFDDSIS-DGKNFAIYCNSSEPIHLELSKH 360
                RS + +D+GST  V P E A  +      S S D + + + C S         K 
Sbjct: 341 ----TRSLVYLDSGSTGTVFPSEYAELIADSLGASYSGDYEAYVMKCPS---------KD 387

Query: 361 NWTILPSNFVGEPYPKDSPYNGY---------CVSNIQGGDISSSWILGEVFLQDLYTVF 411
           + T    +F G  +   SP + Y         CV +I   DI    +LG+ FL   Y V+
Sbjct: 388 DDTNFVYDFGG--FTISSPLSNYMEATGDDSVCVLDIDTDDIPY-IVLGDAFLVSAYVVY 444

Query: 412 DIEGRQVGFANRN 424
           D+E  ++  A  N
Sbjct: 445 DLEDYEISIAQAN 457

>TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa]
           {ON} Anc_7.182 YIL015W
          Length = 395

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 65/135 (48%), Gaps = 28/135 (20%)

Query: 293 LPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSEP 352
           L +A +  + K  G+ +   D  + + +LP E  L L+    D I + K    + + + P
Sbjct: 274 LLSAPDHYVSKIAGLLNATFDNTTHMYLLPSETDLTLYK---DMIINFK----FMDFNVP 326

Query: 353 IH-LELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVF 411
           I+ LE       ILP +            + Y  + +   ++++ ++LG++FL  +YT+F
Sbjct: 327 INMLEF------ILPYD------------DSYVFAILPTKNVNTGFVLGDIFLPHVYTIF 368

Query: 412 DIEGRQV--GFANRN 424
           +++   +  G +N+N
Sbjct: 369 NLDNYTISLGLSNQN 383

>KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 767

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 96/224 (42%), Gaps = 41/224 (18%)

Query: 217 LLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNH 276
           +L+ +  I+K ++S+ L+       +LD  +G ++FG    + Y G L   PLV   +++
Sbjct: 251 VLKENGAIDKIAYSLYLN-------SLDAPSGSVLFGGVDHSKYTGGLYTLPLVNTYKDY 303

Query: 277 WL-------VAIKAAYIGSER-VELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALA 328
            +       V ++   I SE+     T     I       + ++D+G+TL+    E    
Sbjct: 304 GVKTPVQFDVTVQGIGIESEKACRQETFTTTKI-------AALMDSGTTLMYTAPEIVNK 356

Query: 329 LHSYFDDSISDGKN-FAIYCNSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCV-- 385
           +  Y + S S G   F   C S           + T    +F G  +   SP + Y +  
Sbjct: 357 IALYVNASFSPGYGLFMFRCPS---------DGDDTQFIFDFGG--FQIKSPLSNYILRT 405

Query: 386 --SNIQG-GDISSSW--ILGEVFLQDLYTVFDIEGRQVGFANRN 424
              NI G G ISS+   I G+ FL   Y V+D+E  ++  A  N
Sbjct: 406 DDENICGLGLISSNQGTIFGDEFLASAYVVYDLENLELSLAQAN 449

>TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.182
           YIL015W
          Length = 552

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 63/283 (22%), Positives = 110/283 (38%), Gaps = 63/283 (22%)

Query: 170 LSINGLKIQDFRFGVA------------IGVPSLLDAYALSGIFGLPSDPTDSDTSVVGL 217
           L +NG+ I   +FGVA            IG P          + G    P +   +   +
Sbjct: 165 LRLNGIDISTLQFGVADYATVPVGGVLGIGFPR------RESVKGYDDAPNEFYPNFPQV 218

Query: 218 LQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLV---PNPQ 274
           L+   +I   ++S+ L+ + S++       G I+FG      Y G L   P+V   PN  
Sbjct: 219 LKNEGVIGVAAYSMFLNEVSSDA-------GSILFGAVDPTKYTGSLYTFPMVNEYPNVV 271

Query: 275 NH-WLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQE--DALALHS 331
           +    +A+    +G++       K  +  K    ++ ++D+G+TL+  P E  + +A   
Sbjct: 272 DKPATLAMTLQALGAKSDSSCKYKTFTTTK----QAVLLDSGTTLMTAPPEIAEEMAFFC 327

Query: 332 ------------YFDDSISDGKNFAIYCNSSEPIHLELSKHNWTILPSNFVGEPYPKDSP 379
                       YFD    D     I+      I L L+    +++ S          S 
Sbjct: 328 WGPTYNESEGIFYFDCPSDDDDTEFIFDFGDLKITLPLA----SLVIS----------SS 373

Query: 380 YNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFAN 422
            +G+C   +     S S  LG +FL   Y V+D++  Q+  A 
Sbjct: 374 GDGHCGFGLTPA--SYSMTLGAIFLSSAYVVYDLDNYQISIAQ 414

>Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {ON}
           YLR120C (YPS1) - GPI-anchored aspartic protease [contig
           171] FULL
          Length = 629

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 106/278 (38%), Gaps = 54/278 (19%)

Query: 170 LSINGLKIQDFRFGV-AIGVPSLLDAYALSGIFGLPSDPTDSDT--SVVGLLQGSKLINK 226
           +S+    I +  FGV  IG+P L    AL+        P+D+ T  +   +L     I K
Sbjct: 246 ISLAVANISNSTFGVLGIGLPGLEVTNALA------ESPSDAYTYKNFPAMLVDQGKIRK 299

Query: 227 KSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYI 286
            ++S+ +        +L+  +G ++FG    + Y G L   PLV +             I
Sbjct: 300 SAYSLFV-------NDLNATHGSVLFGAVDHSKYTGTLQTIPLVNS-------------I 339

Query: 287 GSERVELPTAKNPSIDKNIGIRS-------------GIIDTGSTLVVLPQEDALALHSYF 333
            S +V  P   + ++   +GI                ++D+G+T   LP     A+    
Sbjct: 340 KSAQVPKPIQFDVTL-HGLGITLNDTNTTITTTPFPALLDSGTTFTHLPGYLVSAIAKKL 398

Query: 334 DDSISDGKNFAIY-CNS---SEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNI- 388
           +    D   F  Y C+    S+ +  +    +      NF    Y  D      C   + 
Sbjct: 399 NAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALI 458

Query: 389 --QGGDISSSWILGEVFLQDLYTVFDIEGRQVGFANRN 424
               G+I    ILG+ FL   Y V+D+E  ++  A  N
Sbjct: 459 PYNRGEI----ILGDNFLTAAYVVYDLENLEISMAQAN 492

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 2/74 (2%)

Query: 34  RIYKLLAPTRIVSEIKTSADDSTGSTLLKYNRSGAETKKSAQCNSLTFRPNISLLKRDPL 93
           R+YK+LA   ++ +   S  DS G  ++K     AE ++  Q +S      IS  + + L
Sbjct: 88  RVYKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFIS--QTEQL 145

Query: 94  SRVHIIQATFGGVS 107
            R  +++ T GG S
Sbjct: 146 ERESLLKETEGGDS 159

>TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.318
           YLR120C
          Length = 667

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 112/273 (41%), Gaps = 45/273 (16%)

Query: 173 NGLKIQDFRFGVA-----------IGVPSLLDAYALSGIFGLPSDPTDSDTSVVGLLQGS 221
           +GL +    F VA           IG+P L   Y  SG++   + P   D   + +L+ S
Sbjct: 307 DGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTY--SGVY-QSTKPYIYDNFPL-VLKNS 362

Query: 222 KLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYT-PLVPNPQNHWLVA 280
             I+K  +S+ L+   ++       NG ++FG    + YEG+  YT PLV    +     
Sbjct: 363 GAIHKSVYSLYLNKQNAK-------NGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYST 415

Query: 281 IKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDG 340
                I  + + +    N        I + ++D+G+TL   P++    L    + S SD 
Sbjct: 416 PIEFDITLQGLGVTDNTNNYTVTTTQIVA-LLDSGTTLTYFPKDMLNLLAKTINASYSDA 474

Query: 341 KNFAIY-CNSSE---PIHLELSKHNWTILPSNFV-----GEPYPKDSPYNGYCVSNIQGG 391
             + +  C  S+    I  +    +     +NFV     G+      PYNG         
Sbjct: 475 LGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYNG--------- 525

Query: 392 DISSSWILGEVFLQDLYTVFDIEGRQVGFANRN 424
              +S ILG++FL   Y V++++  ++  A  N
Sbjct: 526 ---NSAILGDMFLTHAYVVYNLDDLEISMAQAN 555

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 50/117 (42%), Gaps = 11/117 (9%)

Query: 147 VTDSIFTIFYRSGTAHGPLYTGTLSINGLKIQDFRFGVAIGVPSL-LDAYALSGIFGLPS 205
           VTDS+ +IF        P+   T+ I+GL   D   GV   V SL  +   L GI+  PS
Sbjct: 43  VTDSVVSIFESENV---PIDWETVEISGL---DNEEGVQKAVDSLKRNKVGLKGIWHTPS 96

Query: 206 DPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEG 262
           D T   +  V L +   +    +    +  +PS   N+D    L+V  E     Y G
Sbjct: 97  DQTGHGSLNVALRKQLDIFANVALFKTVPGVPSRHSNVD----LVVIRENTEGEYSG 149

>KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 391 GDISSSW-ILGEVFLQDLYTVFDIEGRQVGFANRNTKAT 428
           G  SSS+  LG++FL   Y V+D++ +++  A  N  AT
Sbjct: 379 GSTSSSYATLGDLFLTHAYVVYDLDNKEISMAQINYNAT 417

>Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C
           (YPS1) - GPI-anchored aspartic protease [contig 47] FULL
          Length = 570

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 86/228 (37%), Gaps = 51/228 (22%)

Query: 217 LLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLV------ 270
           LL     I++ ++S+ L        +LD  +G ++FG    + Y G L   PLV      
Sbjct: 273 LLVDQGKIHQNAYSLFLD-------DLDAEHGSVLFGAVDHSKYTGNLYTVPLVNIYKSS 325

Query: 271 --PNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALA 328
             P+P     V ++   + + +  +     P           ++D+G+TL  LP     +
Sbjct: 326 GFPDPI-QLDVTLQGLGMSANKTNITFTTTP--------IPALLDSGTTLTYLPSSMVQS 376

Query: 329 LHSYFDDSIS-DGKNFAIYC----NSSEPI------HLELSKHNWTI-LPSNFVGEPYPK 376
           +        S D   + + C    +S E +      H++    N+ I   SNF       
Sbjct: 377 IARRLSAQYSYDVGYYVLECSEVSDSDELVFDFGGFHIKSKLQNFLIKASSNFCALGLVP 436

Query: 377 DSPYNGYCVSNIQGGDISSSWILGEVFLQDLYTVFDIEGRQVGFANRN 424
            S               SS  ILG+ FL   Y V+D+E  +V  A  N
Sbjct: 437 QS---------------SSRAILGDNFLTAAYVVYDLENLEVSMAQAN 469

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 51/117 (43%), Gaps = 11/117 (9%)

Query: 147 VTDSIFTIFYRSGTAHGPLYTGTLSINGLKIQDFRFGVAIGVPSL-LDAYALSGIFGLPS 205
           VTDS+ +IF        P+   T+ I+GL  Q+   GV   V SL  +   L GI+  PS
Sbjct: 44  VTDSVVSIFESENI---PIDWETVEISGLDNQE---GVQKAVESLKRNKVGLKGIWHTPS 97

Query: 206 DPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEG 262
           D T   +  V L +   +    +    +  +PS   N+D    ++V  E     Y G
Sbjct: 98  DQTGHGSLNVALRKQLDIFANVALFKSVPGVPSRHSNVD----MVVIRENTEGEYSG 150

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,344,194
Number of extensions: 2316441
Number of successful extensions: 5849
Number of sequences better than 10.0: 125
Number of HSP's gapped: 5862
Number of HSP's successfully gapped: 126
Length of query: 494
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 380
Effective length of database: 40,409,475
Effective search space: 15355600500
Effective search space used: 15355600500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)