Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ABL122C8.844ON1043104346510.0
Ecym_46158.844ON1067101930760.0
KLTH0C03784g8.844ON99783114360.0
SAKL0D01364g8.844ON108280714430.0
TDEL0B005408.844ON111581413531e-168
KAFR0A028508.844ON104293513431e-167
Kwal_27.102398.844ON91466813101e-164
CAGL0B02365g8.844ON105077111851e-144
KLLA0D01485g8.844ON115166511371e-136
ZYRO0G14256g8.844ON12593049521e-109
Suva_13.268.844ON11224349151e-105
TBLA0B032808.844ON13622879181e-104
YML117W (NAB6)8.844ON11344269071e-104
Smik_13.178.844ON11314268961e-102
Kpol_1068.58.844ON10322568851e-102
Skud_13.248.844ON11284348891e-101
NDAI0E002708.844ON11982718911e-101
TPHA0I002708.844ON10393668761e-100
KNAG0G034408.844ON10534978761e-100
NCAS0B002808.844ON10812628668e-99
SAKL0A05280g6.183ON5822064468e-46
NCAS0H010406.183ON6292064481e-45
KAFR0B066906.183ON5332064412e-45
Kpol_1002.696.183ON5902064343e-44
TBLA0B052106.183ON7102064384e-44
Kwal_27.111586.183ON5672084325e-44
AFL061C6.183ON5232064279e-44
KLTH0H04906g6.183ON5692084299e-44
Ecym_22336.183ON5762064272e-43
ZYRO0G08140g6.183ON6322064292e-43
TDEL0G016206.183ON5842074254e-43
NDAI0F022606.183ON6802074295e-43
KLLA0E19031g6.183ON6522064275e-43
Suva_16.1236.183ON5962064221e-42
Smik_6.3906.183ON6252094195e-42
CAGL0C01419g6.183ON6392064196e-42
Skud_16.946.183ON6142094177e-42
YPL184C (MRN1)6.183ON6122094177e-42
TPHA0J022106.183ON5932124122e-41
KNAG0M004306.183ON4432063892e-39
Skud_2.3456.104ON664105810.70
Suva_4.4706.104ON66380781.6
SAKL0A07370g6.104ON49082772.0
Smik_2.3556.104ON73685772.1
YBR212W (NGR1)6.104ON67297772.2
ZYRO0C05060g6.104ON71680762.9
TBLA0D028108.466ON30653743.1
TDEL0G036706.104ON61780753.3
KNAG0A024008.466ON30139743.6
Skud_4.478.466ON34337743.9
Suva_4.398.466ON34836744.1
Smik_4.318.466ON34136735.2
KLTH0H06842g6.104ON547100736.2
TBLA0C018208.670ON39470726.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL122C
         (1043 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...  1796   0.0  
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...  1189   0.0  
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   557   0.0  
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   560   0.0  
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   525   e-168
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   521   e-167
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   509   e-164
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   461   e-144
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   442   e-136
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   371   e-109
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...   357   e-105
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   358   e-104
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...   353   e-104
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...   349   e-102
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   345   e-102
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...   347   e-101
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     347   e-101
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   342   e-100
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   342   e-100
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     338   8e-99
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   176   8e-46
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   177   1e-45
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   174   2e-45
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   171   3e-44
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   173   4e-44
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   171   5e-44
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   169   9e-44
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   169   9e-44
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   169   2e-43
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   169   2e-43
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   168   4e-43
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    169   5e-43
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   169   5e-43
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   167   1e-42
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   166   5e-42
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   166   6e-42
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   165   7e-42
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   165   7e-42
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   163   2e-41
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   154   2e-39
Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W ...    36   0.70 
Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W ...    35   1.6  
SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {...    34   2.0  
Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W ...    34   2.1  
YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA bi...    34   2.2  
ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {...    34   2.9  
TBLA0D02810 Chr4 complement(688830..689750) [921 bp, 306 aa] {ON...    33   3.1  
TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {O...    33   3.3  
KNAG0A02400 Chr1 complement(236366..237271) [906 bp, 301 aa] {ON...    33   3.6  
Skud_4.47 Chr4 complement(83397..84428) [1032 bp, 343 aa] {ON} Y...    33   3.9  
Suva_4.39 Chr4 complement(74438..75484) [1047 bp, 348 aa] {ON} Y...    33   4.1  
Smik_4.31 Chr4 complement(64414..65439) [1026 bp, 341 aa] {ON} Y...    33   5.2  
KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {...    33   6.2  
TBLA0C01820 Chr3 complement(429227..430411) [1185 bp, 394 aa] {O...    32   6.7  

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score = 1796 bits (4651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 890/1043 (85%), Positives = 890/1043 (85%)

Query: 1    MTNYQRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRFFPGAEGMSLAAGSMPPVP 60
            MTNYQRL                                 RFFPGAEGMSLAAGSMPPVP
Sbjct: 1    MTNYQRLGPLGQAVPGPGAGGQPASSGPAQGPGTGPGQPARFFPGAEGMSLAAGSMPPVP 60

Query: 61   QTPFDPTYGASLLPSHMLMGSPFLSTPLRPQAHFHPSTPGXXXXXXXXXXXXXXXFLYYP 120
            QTPFDPTYGASLLPSHMLMGSPFLSTPLRPQAHFHPSTPG               FLYYP
Sbjct: 61   QTPFDPTYGASLLPSHMLMGSPFLSTPLRPQAHFHPSTPGHSSHSLHHAQSARSSFLYYP 120

Query: 121  QPPMLKPIPPRRKKSVTLNHSEPYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFL 180
            QPPMLKPIPPRRKKSVTLNHSEPYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFL
Sbjct: 121  QPPMLKPIPPRRKKSVTLNHSEPYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFL 180

Query: 181  NSFVKFGPVESIYLMDDNHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVC 240
            NSFVKFGPVESIYLMDDNHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVC
Sbjct: 181  NSFVKFGPVESIYLMDDNHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVC 240

Query: 241  QDESSWFKYLQMNVVTRGATRSLTVEFEDSVKELNEDFVRLKFPWLFCSQRFVLERIDLI 300
            QDESSWFKYLQMNVVTRGATRSLTVEFEDSVKELNEDFVRLKFPWLFCSQRFVLERIDLI
Sbjct: 241  QDESSWFKYLQMNVVTRGATRSLTVEFEDSVKELNEDFVRLKFPWLFCSQRFVLERIDLI 300

Query: 301  NATTVNQHFGTRYMILHFISISMALEVDDFLQQPSQKRQLNISRIQFVNVNGHHSKLSDE 360
            NATTVNQHFGTRYMILHFISISMALEVDDFLQQPSQKRQLNISRIQFVNVNGHHSKLSDE
Sbjct: 301  NATTVNQHFGTRYMILHFISISMALEVDDFLQQPSQKRQLNISRIQFVNVNGHHSKLSDE 360

Query: 361  EAAAAANGLQQDXXXXXXXXXXXXXXNTADLAALFHXXXXXXXXXXXQVVPSEYPTPLIE 420
            EAAAAANGLQQD              NTADLAALFH           QVVPSEYPTPLIE
Sbjct: 361  EAAAAANGLQQDSRTSSVSSISLSISNTADLAALFHSLDLSLDTLSLQVVPSEYPTPLIE 420

Query: 421  QHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVSSSLSGVLFMNDPSSSGSTP 480
            QHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVSSSLSGVLFMNDPSSSGSTP
Sbjct: 421  QHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVSSSLSGVLFMNDPSSSGSTP 480

Query: 481  MIVPSELNLNTPVXXXXXXXXXXXXXXXXXSLHNPSDGNGGSPSYFMDPMVGAPIGQTLQ 540
            MIVPSELNLNTPV                 SLHNPSDGNGGSPSYFMDPMVGAPIGQTLQ
Sbjct: 481  MIVPSELNLNTPVMGGPMQGQLMPGPPQPMSLHNPSDGNGGSPSYFMDPMVGAPIGQTLQ 540

Query: 541  RQYLAGASQANGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIET 600
            RQYLAGASQANGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIET
Sbjct: 541  RQYLAGASQANGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIET 600

Query: 601  AAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKE 660
            AAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKE
Sbjct: 601  AAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKE 660

Query: 661  KYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVE 720
            KYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVE
Sbjct: 661  KYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVE 720

Query: 721  DSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSRFYKKIKKQSYSMK 780
            DSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSRFYKKIKKQSYSMK
Sbjct: 721  DSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSRFYKKIKKQSYSMK 780

Query: 781  QGKQPRKEDGIVNSDDLTKNNEVLPGVQMNSSKNGGVGESQSLVGDQELAEGLGISLTSA 840
            QGKQPRKEDGIVNSDDLTKNNEVLPGVQMNSSKNGGVGESQSLVGDQELAEGLGISLTSA
Sbjct: 781  QGKQPRKEDGIVNSDDLTKNNEVLPGVQMNSSKNGGVGESQSLVGDQELAEGLGISLTSA 840

Query: 841  QISPDTGHTHHYSXXXXXXXXXXXXXXXYSTSGSSDIDIIVAPPDEFKRREXXXXXXXXX 900
            QISPDTGHTHHYS               YSTSGSSDIDIIVAPPDEFKRRE         
Sbjct: 841  QISPDTGHTHHYSDGVEEGDECDDDDAGYSTSGSSDIDIIVAPPDEFKRRESGTSSGKHK 900

Query: 901  XXXXXXRRXXXXXXXXXXXXXXXXXLGSLDHTXXXXXXXXXXXXXXXXMQQHLADRRPRH 960
                  RR                 LGSLDHT                MQQHLADRRPRH
Sbjct: 901  KKSKSTRRNQHSNAASSASYNQQYSLGSLDHTSSAGSLDAPPPLAPSSMQQHLADRRPRH 960

Query: 961  TPGRSTDSSASQYNSQTPTNANYKSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATN 1020
            TPGRSTDSSASQYNSQTPTNANYKSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATN
Sbjct: 961  TPGRSTDSSASQYNSQTPTNANYKSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATN 1020

Query: 1021 ILGATTVQEPLGGYYDSNGNEQH 1043
            ILGATTVQEPLGGYYDSNGNEQH
Sbjct: 1021 ILGATTVQEPLGGYYDSNGNEQH 1043

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
            similar to Ashbya gossypii ABL122C
          Length = 1067

 Score = 1189 bits (3076), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 627/1019 (61%), Positives = 716/1019 (70%), Gaps = 32/1019 (3%)

Query: 41   RFFPGAE--GMSLAAGSMPPVPQTPFDPTYGASLLPSHMLMGSPFLSTPLRPQAHFHPST 98
            RFFP  +      AA SMPPVPQTPFDPTYGASLLPSHMLMGSPF+STP+RPQ HFHPS 
Sbjct: 62   RFFPSGDVASSLSAAASMPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQGHFHPSA 121

Query: 99   PGXXXXXXXXXXXXXXXFLYYPQPPMLKPIPPRRKKSVTLNHSEPYHINFKILPKGKDEY 158
                             FLYYPQPP+LKPIPPRR+KS +LNHSEPY +NFKILPKGKDEY
Sbjct: 122  --------SSHSNHSRSFLYYPQPPILKPIPPRRRKSFSLNHSEPYQVNFKILPKGKDEY 173

Query: 159  MTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMDDNHSILLSFLTKATCLDFYNNL 218
            MTRSLL +NLE   + DIHNFL +F+KFGP+ESIYL+DD+HSILLSFLTKATCLDFYNNL
Sbjct: 174  MTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLLDDSHSILLSFLTKATCLDFYNNL 233

Query: 219  LQRFSEFKTKLHSPKLSVSFVCQDESSWFKYLQMNVVTRGATRSLTVEFEDSVKELNEDF 278
            LQRFSEFK+KLHS KLSVSFVCQDE++WF+ LQMNVVTRG TRSL +EFED   EL  D 
Sbjct: 234  LQRFSEFKSKLHSTKLSVSFVCQDETNWFRLLQMNVVTRGVTRSLCIEFEDQSMELTSDL 293

Query: 279  VRLKFPWLFCSQRFVLERIDLINATT-VNQHFGTRYMILHFISISMALEVDDFLQQPSQK 337
            +  K PWLF S RFV+ERIDL+NA    NQ+F  RY+++HFI ISMALEV+++LQQ SQK
Sbjct: 294  IHEKIPWLFFSHRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQK 353

Query: 338  RQLNISRIQFVNVNGHHSKLSDEEAAAAANGLQQDXXXXXXXXXXXXXXNTADLAALFHX 397
            +QL IS+IQFVNVNGH S LSDE+A AAANGLQ++              N++DL  LFH 
Sbjct: 354  KQLGISKIQFVNVNGHSSDLSDEDAVAAANGLQRESRTSSVSSISLPISNSSDLVELFHS 413

Query: 398  XXXXXXXXXXQVVPSEYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNH 457
                      QV+PSEYP PLIE H +HL S+TISRPSKTL  S SL+EMD        +
Sbjct: 414  LDLALGIISLQVIPSEYPVPLIESHDDHLHSVTISRPSKTLTSSTSLVEMDGGPNGGTPN 473

Query: 458  HGVSSSLSGVLFMNDPSSSGSTPMIVPSELNLNTPVXXXXXXXXXXXXXXXXXSLHNPSD 517
               S+++ GVL ++DPSS G+TP ++P+ELN+NT +                 SLHNP+D
Sbjct: 474  --GSNAMQGVLLLSDPSSDGNTPSMLPNELNINTSLMPGPMGGQVLGTSQSL-SLHNPND 530

Query: 518  GNGGSPSYFMDPMVGAPIGQTLQRQYLAGASQANGINNRTVYIGNIHPRSKPEDICNVVR 577
              G  PSYFMDPM GAPI Q LQRQYL G  Q  G NNRTVYIGNIHPRSKPEDICNVVR
Sbjct: 531  NGGAGPSYFMDPMSGAPINQALQRQYLTGTGQVGGSNNRTVYIGNIHPRSKPEDICNVVR 590

Query: 578  GGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNI 637
            GGILQ IKWI SKRICFVTFIE AAA+QFYANASLEPIVLHGNILRVGWGQPSGELPKNI
Sbjct: 591  GGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNI 650

Query: 638  ALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQIN 697
            ALAVTIGASRNVYVSLPEYSFKEKYINNPEFK YHGKYKLP+EEQLRQDFTKYGQVEQIN
Sbjct: 651  ALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQIN 710

Query: 698  YLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVN 757
            YL+DGHCCWVNFMNIAHAIRLVED NS  ++NLEKFHAQFDGRYKNLIIGYGKDRCGNVN
Sbjct: 711  YLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVN 770

Query: 758  KNLAANKNSRFYKKIKKQSYSMKQGKQPRKEDGI--VNSDDLTKNNEVLPGVQMNSSKNG 815
            KNL ANKNSRF+KKIKK + + K  K+ + + G    +SDD  K++     V + SSK  
Sbjct: 771  KNLTANKNSRFFKKIKKLNCTTKPNKRQQSKRGTSSASSDDARKDDASTEKVPV-SSKEP 829

Query: 816  GVGESQSLVGDQELAEGLGISLTSAQISP-DTGHTHHYSXXXXXXXXXXXXXXXYSTSGS 874
               E   L  D  LAEGLGISL+SA ++      +   +               Y+TSGS
Sbjct: 830  VCDEILGLNDDNALAEGLGISLSSAYVNEYGDDISKRTNKKNRSKTETVEEDTGYTTSGS 889

Query: 875  SDIDIIVA-PPDEFKRREXXXXXXXXXXXXXXXRRXXXXXXXXXXXXXXXXX----LGSL 929
            SDIDIIVA P +  K +E               +R                      GS 
Sbjct: 890  SDIDIIVAPPLEHNKGKEGNSNHGKSKRKSQGGKRLQNGAQDGVGGGYGGHSQHYLAGSF 949

Query: 930  DHTXXXXXXXXXXXXXXXXMQQHLADRRPRHTPGRSTDSSAS-------QYNSQTPTNAN 982
            +                  + QH  D+          D++ +        YN    +N  
Sbjct: 950  ELVNSNTYLDSIPPLVPSPINQHFHDKSLCRGSAHVNDNNNALGGFNNYSYNCGG-SNNG 1008

Query: 983  YKSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYDSNGNE 1041
             ++RRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLY+TNILGATTV +PL G+YD N NE
Sbjct: 1009 NRTRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYSTNILGATTVHDPL-GFYDVNANE 1066

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/831 (41%), Positives = 465/831 (55%), Gaps = 109/831 (13%)

Query: 56  MPPVPQTPFDPTYGASLLPSHMLMGSPFLSTPLRPQAHFHPSTPGXXXXXXXXXXXXXXX 115
           +PP PQTPFD +YG SLLPSH+LM SPFL+TP    A   P   G               
Sbjct: 45  VPPAPQTPFDTSYGVSLLPSHLLMSSPFLATPGMGSAS--PHRAGGSRSSHAQSSYHTPN 102

Query: 116 FLYYPQPPMLKPIPPRRKKSVTLNHS---------EPYHINFKILPK----GKDEYMTRS 162
           F        L+  PP  K++     S           Y + F ILP+    G DEYMTRS
Sbjct: 103 F----GSTQLRMPPPTEKRNFKHGSSYRHNSSVQQRAYEVVFHILPRSADGGGDEYMTRS 158

Query: 163 LLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMDDNH-SILLSFLTKATCLDFYNNLLQR 221
           LL +NL    D  +H+FL  F KF  VES+YL+D    S+L+SFLTK TCLDFYN +LQ+
Sbjct: 159 LLFSNLN--PDTHLHDFLTKFEKFDRVESVYLVDSQQQSVLVSFLTKETCLDFYNGVLQK 216

Query: 222 FSEFKTKLHSPKLSVSFVCQDESSWFKYLQ---MNVVTRGATRSLTVEFEDSVKELNEDF 278
            SEFK +L S +L+++F    +      LQ   + V+  GATRSL +EF+D V     D 
Sbjct: 217 LSEFKKELKSKELTLNFASLRDVKTGPTLQEIKIEVLRAGATRSLILEFQDKV-----DL 271

Query: 279 VRLKFPWLFCSQ---RFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQQPS 335
             L     F      R+V+E I+++NA   ++HFG  Y I+HFISI+MALE  ++L+  S
Sbjct: 272 ALLSKSLGFIVNEGPRYVVEAIEIVNAGRSSKHFGPHYAIIHFISIAMALETVEYLKSQS 331

Query: 336 QKRQLNISRIQFVNVNGHHSKLSDEEAAAAANGLQQDXXXXXXXXXXXXXXNTADLAALF 395
            K       I+F  VN   +    E    +++ L +               + A L +  
Sbjct: 332 NKLA---GLIKFRYVNTTSASGKSEFQTLSSSQLNERALSNTSDSDISGGESVASLGSKL 388

Query: 396 HXXXXXXXXXXXQVVPSEYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATNAG 455
                        V P++Y  PL+E+ SEHL  +TIS   K L   +SL ++ SN T+  
Sbjct: 389 QQTSLGEQTLV--VDPTQYGRPLVEERSEHLPHVTIS---KALNSKSSLNDLTSNTTSPQ 443

Query: 456 ------NHHGVSSSLSGVLFMNDPSSSGSTPMIVPSELNLNTPVXXXXXXXXXXXXXXXX 509
                 N H  SSS   ++ +   +S G     +P                         
Sbjct: 444 PQEVLVNDHEDSSSRGSMVSLKQANSHGPAYPPIP------------------------- 478

Query: 510 XSLHNPSDGNGGSPSYF-MDPMVGAPIGQTLQRQYLAGASQANGINNRTVYIGNIHPRSK 568
                      G P Y  M   +G  + Q          +   G+ NRTVYIGNI PRSK
Sbjct: 479 -----------GYPFYMNMSKPLGQTLQQQYTTTAQVATAMGGGLGNRTVYIGNISPRSK 527

Query: 569 PEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQ 628
            EDICNVVRGGILQ++K+I +K ICFVTFIE A+AVQF+AN+++EPIVLHGN+L+VGWG 
Sbjct: 528 TEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGH 587

Query: 629 PSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFT 688
            SG LP++I+LAVTIGASRNVYVSLPE++FK+K+I +PE++ +  K++LP++EQL +DF+
Sbjct: 588 HSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFS 647

Query: 689 KYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGY 748
            +G +E +N+LEDGHCCW+NFMNI++AI+LVED+N+P   N + FH +F  RYK L IGY
Sbjct: 648 VFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNP---NNDSFHEKFGNRYKGLFIGY 704

Query: 749 GKDRCGNVNKNLAANKNSRFYKKIKKQSYSMKQGKQPRKEDGIVNSDDLTKNNEVLPGVQ 808
           GKDRCGNVNKNL ANKNS+++KK+KK SY+++  KQ   + G  ++    K+        
Sbjct: 705 GKDRCGNVNKNLVANKNSKYFKKVKKASYNIRLRKQ---QKGASDAPTEVKDEAKELDKP 761

Query: 809 MNSSKNG-GVGESQSLVGD----QELAE--------------GLGISLTSA 840
           + +   G  VG++Q+LV D    Q+L E              GLGISL S+
Sbjct: 762 IKADAFGISVGDTQNLVRDSDEEQKLEEDELLRLSDLNNTGGGLGISLASS 812

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (58%), Gaps = 5/75 (6%)

Query: 965  STDSSASQYNSQTPTNANYKSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGA 1024
            +T+ S+ +YN     ++      RR+   SK I G DVM+QYL QL HSTF+YA NILG 
Sbjct: 921  TTEKSSPRYNDIRSQDSKKPLHPRRRK--SKAIPGSDVMAQYLAQLQHSTFMYAANILG- 977

Query: 1025 TTVQEPLGGYYDSNG 1039
              V +    +YD NG
Sbjct: 978  --VDDGETVFYDENG 990

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/807 (43%), Positives = 460/807 (57%), Gaps = 125/807 (15%)

Query: 43  FPGAEGMSLAAGSMPPVPQTPFDPTYGASLLPSHMLM----------------GSPFLST 86
            P  +G   A   MP  PQTPFD +YGA+LLPSH+LM                GS  L++
Sbjct: 51  LPSQQGY-YAGSPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTPQNAAMMHAGSRGLNS 109

Query: 87  PLRPQAHFHPSTPGXXXXXXXXXXXXXXXF---------LYYPQPPMLKPIPPRRKKSVT 137
             +   H+  S  G                           YP PP L   P   K+   
Sbjct: 110 SQQQFYHYTYSNNGKNKGSSKKNNRDKKKVENGHVMMTRYSYPPPPQLNAPPMTHKRKTH 169

Query: 138 LNH-------SEPYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVE 190
           L H       SEPY INFKILPKG DEYMTRSLLL+N+     + +H+F+  FVKFGP+E
Sbjct: 170 LRHETNSQPSSEPYVINFKILPKGDDEYMTRSLLLSNVNA--SIKLHDFITKFVKFGPIE 227

Query: 191 SIYLM--------------------------DDNHSILLSFLTKATCLDFYNNLLQRFSE 224
           S+Y++                          +   SILLSFLTK TCLDFYNN+LQ+ S+
Sbjct: 228 SVYVVPEEEEEEEEEEEEEEEEEEEEEEKGEEKKQSILLSFLTKNTCLDFYNNVLQKLSD 287

Query: 225 FKTKLHSPKLSVSFVCQDESSWFKYLQMNVVTRGATRSLTVEFEDSVKELNEDFVRLKFP 284
           FK  L+S  L+++FV          ++ +V+ +GATRS+ +EF++S     +    ++  
Sbjct: 288 FKIDLNSKSLTLNFVSLTSED----IRDDVLRKGATRSIALEFKNSF--TTKQLESIEIL 341

Query: 285 WLFCSQRFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQQPSQKRQLNISR 344
               + RFV+E+ID++N  + N++F T Y I+HFISISMA+E   +L    +K  L ISR
Sbjct: 342 SNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISISMAVEASSYLLNWDEK--LGISR 399

Query: 345 IQFVN---VNGHHSKLSDEEAAAAANGLQQDXXXXXXXXXXXXXXNTADLAALFHXXXXX 401
           + FV    +N      SD   +A A+   QD               T  L  L       
Sbjct: 400 LFFVTDSIINK-----SDYFRSAPAS---QDASRSSVSIDQTLEFATKKLQGLV------ 445

Query: 402 XXXXXXQVVPSEYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVS 461
                  + P  YP   IE+H  HLTSI+IS+P        S     S+ +  GN +  S
Sbjct: 446 LKERTLSIKPKTYPQAEIEEHQHHLTSISISKPL------LSSNNNSSSVSLQGNQNLTS 499

Query: 462 SSLSGVLFMNDPSSSGSTPMIVPSELNLNTPVXXXXXXXXXXXXXXXXXSLHNPSDGNGG 521
           S ++  ++++D S+S    +++ S +   T                        S+    
Sbjct: 500 SPVTQEMYLHDTSNSTREDVMIQSSMASGT------------------------SNFVPP 535

Query: 522 SPSYFMDPMVGAPIGQTLQRQYLAGASQAN----GINNRTVYIGNIHPRSKPEDICNVVR 577
            P Y+MD  V  PI QTLQ+Q    A  A+    G+ NRTVY+GNI+PRSKPEDICNVVR
Sbjct: 536 PPHYYMD--VTKPIRQTLQQQLTTTAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVR 593

Query: 578 GGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNI 637
           GGILQ IK+   K +CFVTFIE AAAVQF+ANAS+EPIVLHGN+L+VGWG   G+L ++I
Sbjct: 594 GGILQHIKFFEHKHVCFVTFIEAAAAVQFFANASIEPIVLHGNVLKVGWGHHPGDLAQSI 653

Query: 638 ALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQIN 697
           ALAVTIGASRNVYVSLPEY+FK+K+I +PEF+ +  KY+LP++EQLRQDF+ +G++EQIN
Sbjct: 654 ALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQIN 713

Query: 698 YLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVN 757
           YL+DGHCCWVNFMNI  AI+LVED+N    K   KFH  +  RYK LIIGYGKDRCGNVN
Sbjct: 714 YLDDGHCCWVNFMNITSAIKLVEDANGADNK---KFHGSYQDRYKGLIIGYGKDRCGNVN 770

Query: 758 KNLAANKNSRFYKKIKKQSYSMKQGKQ 784
           KNL ANK SRF+KK+KK SY ++  KQ
Sbjct: 771 KNLVANKKSRFFKKVKKASYKIRMHKQ 797

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/46 (56%), Positives = 28/46 (60%)

Query: 994  SKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYDSNG 1039
            SK I G  VM+QYL QL HSTF+YA NILG T         YD NG
Sbjct: 1031 SKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDENG 1076

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
           YML117W
          Length = 1115

 Score =  525 bits (1353), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 316/814 (38%), Positives = 438/814 (53%), Gaps = 110/814 (13%)

Query: 43  FPGAEGMSLAAGSMPPVPQTPFDPTYGASLLPSHMLMGSPFLSTP-------LRPQAHFH 95
           F  ++ M    G +   P TPFD  YG +LLPSH+LMGSPF+S+P           AH  
Sbjct: 40  FMNSQPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLFQQPHHHQHAHQR 99

Query: 96  PSTPGXXXXXXXXXXXXXXXFLYYPQPPMLKPIP----------PRRK---KSVTLNHS- 141
                                  YP PP L   P          PRR    KS+  + + 
Sbjct: 100 LQQYSHNQSKSSSGRSFGKLATAYPVPPSLNSPPASRNALHNRGPRRGSHYKSIQSSDAS 159

Query: 142 ----EPYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMD- 196
               +P+ + +++LPKG DE+ TRSLL  N++    +D+H+F+ +F  +GPVES+YL   
Sbjct: 160 KRFKDPFILTYRVLPKGNDEFRTRSLLFENVD--GSIDLHSFVTNFTNYGPVESVYLFKS 217

Query: 197 --DNHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVC-------------- 240
             D+ SILLSF +KA CLDFYN++LQR SE+K+ L S  L++SFV               
Sbjct: 218 EGDHVSILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVSDTSEEDID 277

Query: 241 -QDESSWFKY-------LQMNVVTRGATRSLTVEFEDSVKELNEDFVRLKFPWLFCSQRF 292
            +D+S    +       L+ +V+ RGATRS+ + F+    +      +L+F     + R+
Sbjct: 278 KEDDSKPDAFNITAAGSLRYDVINRGATRSIMITFKTPCSKDELIDKKLEFLKKENNTRY 337

Query: 293 VLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQQPSQKRQLNISRIQFVNVNG 352
           VLE IDL+ A   ++HF   Y +L F++I MA+E+ D+++  SQK  L+IS+  F+++  
Sbjct: 338 VLESIDLVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQK--LDISKCFFISIQP 395

Query: 353 HHSKLSDEEAAAAANGLQQDXXXXXXXXXXXXXXNTADLAAL-----------FHXXXXX 401
                     ++A+NG   +              +     ++           +      
Sbjct: 396 QIPDGKRLSVSSASNGRSMESISGNYRSKNASVTSLESSGSIISLDQEIDEMTYKLQSVN 455

Query: 402 XXXXXXQVVPSEYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVS 461
                 +V  + Y  P  E H++HLT++T+S                            +
Sbjct: 456 SKKNILEVTTNNYKDPSFEGHTDHLTNVTVSE---------------------------A 488

Query: 462 SSLSGVLFMNDPSSSGSTPMIVPSELNLNTPVXXXXXXXXXXXXXXXXXSLHNPSDGNGG 521
           +SL   L M  P        ++P   N + P+                     P      
Sbjct: 489 ASLDSQLTMPSPQEVTVNEYVLP---NQDMPLPNDMNYAPSVQDVDAVPPSMVPMSTMPN 545

Query: 522 SP--SYFMDPMV------GAPIGQTLQRQYLAGA----SQANGINNRTVYIGNIHPRSKP 569
           +P   Y   P V        PI Q+LQRQY   A    S   GI NRTVYIGNIHPRS+ 
Sbjct: 546 TPYGCYMPPPNVRQNGNMTKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPRSRT 605

Query: 570 EDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQP 629
           EDICNVVRGGILQ +K+++ KRICFVTF+E +AAVQFY NA ++PIVLHGN+L+VGWG  
Sbjct: 606 EDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGWGHH 665

Query: 630 SGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTK 689
           SG LPK+IALAVT+GASRNVYVSLPE++FK+KYI +P+++ Y+ K++LP EEQLR DF+ 
Sbjct: 666 SGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDDFSH 725

Query: 690 YGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYG 749
           YG +EQINYL DGHCCWVNF NI+ AI+LVE+       N   F+    GRY  L+IGYG
Sbjct: 726 YGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGN---FYKMLGGRYDGLVIGYG 782

Query: 750 KDRCGNVNKNLAANKNSRFYKKIKKQSYSMKQGK 783
           KDRCGNVNKN  A KNSRFYKK+KK S++++  K
Sbjct: 783 KDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSK 816

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 30/46 (65%), Gaps = 2/46 (4%)

Query: 995  KPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYDSNGN 1040
            K I G DVM+QYL QL HSTF+YA NILGA+   +    Y D N +
Sbjct: 1071 KSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGD--NNYLDENAD 1114

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
           Anc_8.844 YML117W
          Length = 1042

 Score =  521 bits (1343), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 348/935 (37%), Positives = 492/935 (52%), Gaps = 158/935 (16%)

Query: 56  MPPVPQTPFDPTYGASLLPSHMLMGSPFLSTPLRPQAHFHPSTPGXXXXXXXXXXXXXXX 115
           +P  P TPFD  YGA+LLPSH+LMGSPF+S+P  P       TP                
Sbjct: 70  LPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNVP-------TPQQQYFLQQQFNTNNNN 122

Query: 116 FLYYPQPPMLK----PIPPR------RKKSVTLNH--------------------SEPYH 145
               P+    K    PI  R      ++KS  +N+                    +EP +
Sbjct: 123 GSSTPRKSFFKVSNRPISSRSSRFSEKRKSFIINNPTTNNSNNNNNNKEILEKLFTEPIN 182

Query: 146 INFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMDDNHS----- 200
           I++ ILPKG D Y TRSLL  N++    +++H+F+ +FVK   +ESIYL+ + +      
Sbjct: 183 ISYVILPKGDDAYRTRSLLFENVD--NAINLHSFITNFVKNNSIESIYLVPNKNDSNTCD 240

Query: 201 ILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVCQDESSWFK-----YLQMNVV 255
           I+LSFL++  CLDFYNN+LQR  EFK  L+S  L+++FV    +   +      L+ N+V
Sbjct: 241 IILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTTRDNQGPSLEFNIV 300

Query: 256 TRGATRSLTVEF----EDS-VKELNEDFVRLKFPWLFCSQ--RFVLERIDLINATTVNQH 308
           TR ATRSL +E      DS + E  + F ++    L   +  R+VLE IDL++    N+ 
Sbjct: 301 TRDATRSLAIELCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKE 360

Query: 309 FGTRYMILHFISISMALEVDDFLQQPSQKRQLNISRIQFV--------NVNGHHSKLSDE 360
           FG  Y IL F++I+MA+E+ D++Q  S K  LNI +  FV        NV  + S LS  
Sbjct: 361 FGKNYAILSFLNITMAIEIMDYIQVISSK--LNIGKCSFVTIQPLIENNVMNNSSALSSA 418

Query: 361 ---EAAAAANG-----------LQQDXXXXXXXXXXXXXXNTADLAALFHXXXXXXXXXX 406
              +++ ++ G             ++              +   ++              
Sbjct: 419 TNIQSSVSSEGNNNQNNNGSTFFHKNSINSLLSSESSVSIDEEVISIADKLKGIKLKDIS 478

Query: 407 XQVVPSEYPTPLIEQHSEHLTSITISRPSKTL----GPSASLIEMDSNATNAGNHHGVSS 462
             ++P +YP P     ++HL ++TIS P++       P    I ++           +S 
Sbjct: 479 LDILPRDYPEPEFNFSTDHLPNVTISVPTQLDQIPGTPRTQEIYIND----------MSP 528

Query: 463 SLSGVLFMNDPSS--SGS------TPMIVPSE---LNLNTPVXXXXXXXXXXXXXXXXXS 511
           S  G+  MN  S+  SG+      TPM++PS+   ++ NT +                  
Sbjct: 529 SFEGIDMMNSSSTMLSGNGTFISNTPMLIPSQSFYMDQNTQIQEAP-------------- 574

Query: 512 LHNPSDGNGGSPSYFMDPMVGAPIGQTLQRQYLAGASQANGIN----NRTVYIGNIHPRS 567
                         F       PI  +L+ Q    A  A+ +     NRT+YIGNI+PRS
Sbjct: 575 --------------FRSNSFIHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRS 620

Query: 568 KPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWG 627
           K EDICNVVRGGILQ+IK+I SK ICFVTFIE AAAVQFYANA ++PIVLHGN L++GWG
Sbjct: 621 KAEDICNVVRGGILQSIKFIESKHICFVTFIEAAAAVQFYANAFIDPIVLHGNTLKLGWG 680

Query: 628 QPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDF 687
             SG LPK+IALAVTIGASRNVYVSLPE++FK+KYIN+PEFK YH K+KLP  EQLR DF
Sbjct: 681 NYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDF 740

Query: 688 TKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIG 747
           + YG  EQINYL D HCCWVNFMNI+ AI+LVE++ +    + ++F+ +FD RY  L+I 
Sbjct: 741 SSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATN----DFDRFNEKFDERYNGLVIN 796

Query: 748 YGKDRCGNVNKNLAANKNSRFYKKIKKQSYSM-----KQGKQPRKEDGI--VNSDDLTKN 800
           YGKDRCGN+NKNL A KNSRFYK  +  ++ +     K+    R+E+G   V +D+ T  
Sbjct: 797 YGKDRCGNINKNLIAGKNSRFYKIRQNHNFKLSKLEEKRRDHDRRENGFKHVYNDEETIY 856

Query: 801 NEVLPGVQMNSSKNGGVGESQSLVGDQELAEGLGISLTSA-QISPDTGH---THHYSXXX 856
           NE +       + N    ES+   G     + LGISL S  +I+ D         +    
Sbjct: 857 NESM------ETDNQHNEESKENDGKFLQLDSLGISLESKNEIADDINDALTVDQFENEK 910

Query: 857 XXXXXXXXXXXXYSTSGSSDIDIIVAPPDEFKRRE 891
                       + +  SSDI++I+  P+  + ++
Sbjct: 911 SITKNNGFENTSFHSDSSSDIELIINSPNSLRTKD 945

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/40 (62%), Positives = 29/40 (72%), Gaps = 4/40 (10%)

Query: 997  IAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYD 1036
            I G DVM+QYL QL HSTF+YA NILGA+  +E    YYD
Sbjct: 997  IPGSDVMAQYLAQLQHSTFMYAANILGASGEEE----YYD 1032

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
           Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  509 bits (1310), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 284/668 (42%), Positives = 405/668 (60%), Gaps = 84/668 (12%)

Query: 143 PYHINFKILPKGK----DEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMD-D 197
           PY + F ILP+      D++ TRSL  +NL    D+ +H FL +F KF  +ES+Y++D +
Sbjct: 62  PYKLTFNILPRNGNGDGDKFRTRSLYFSNLNP--DVRLHEFLATFHKFDRIESVYVVDRE 119

Query: 198 NHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVC---QDESSWFKYLQMNV 254
             S+L+SFLTK TCLDFYN +LQ+ SEFK +L S +LS+SF      +     + ++  V
Sbjct: 120 QQSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFASPQKVESGPTLQEIKFEV 179

Query: 255 VTRGATRSLTVEFEDSVKELNEDFVRL--KFPWLFCSQ-RFVLERIDLINATTVNQHFGT 311
           +  GATRSL +EF+D +     DF  L  KF +   S  R+V+E I+ +N    +++FG+
Sbjct: 180 LRAGATRSLGLEFKDEI-----DFASLLKKFDFFDNSGPRYVIESIETVNTDKPSKYFGS 234

Query: 312 RYMILHFISISMALEVDDFL--QQPSQKRQLNISRIQFVNVNGHHSK-----LSDEEAAA 364
            Y I+HFISI+MA+E  ++L  Q P       ++++ +VN      K      S+ E + 
Sbjct: 235 NYAIVHFISIAMAVETMEYLKVQTP---ESFGLTKVSYVNSTFTSGKSEFQTFSNSELSD 291

Query: 365 AANGLQQDXXXXXXXXXXXXXXNTADLAALFHXXXXXXXXXXXQVVPSEYPTPLIEQHSE 424
             +   QD               + +    F             V+PS+Y  P++E+H++
Sbjct: 292 QNDVEVQDSISSFEDITLSEGSMSVENEKAF------------TVLPSQYGPPVVEEHNQ 339

Query: 425 HLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVSSSLSGVLFMNDPSSSGSTPMIVP 484
           H + ITIS+                             +LS  +  N  SSS ++P   P
Sbjct: 340 HCSHITISK-----------------------------ALSSKVSRNGSSSSIASPQ--P 368

Query: 485 SELNLNTPVXXXXXXXXXXXXXXXXXSLHNPSDGNGGSPSYFMDPMVGAPIGQTLQRQYL 544
            E+ ++                        P  G      Y+MD  +  P+GQTLQ+QY 
Sbjct: 369 QEVLVSNSEAPSSRNSIVSLLSARSQGPTYPVPGY----HYYMD--MSKPLGQTLQQQYT 422

Query: 545 AGASQAN----GINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIET 600
           A A  A     G  NRTVYIGNI PRSK EDICNVVRGGILQ++K+I +K ICFVTFIE 
Sbjct: 423 ATAQVATAMGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEA 482

Query: 601 AAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKE 660
           A+AVQF+AN+S+EPIVLHG++L+VGWG  SG LP++I+LAVTIGASRNVYVSLPEY+FK+
Sbjct: 483 ASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKD 542

Query: 661 KYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVE 720
           K+I +PE++ +  K+KLP+++QL  DF+ +G +E IN+LEDGHCCW+NFMNI++AI+LVE
Sbjct: 543 KFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVE 602

Query: 721 DSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSRFYKKIKKQSYSMK 780
           D+N+    N E FH +F+ RY+ L IGYGKDRCGNVNKNL +NKNS+++KK+KK SY+++
Sbjct: 603 DANN---SNNESFHEKFENRYRGLFIGYGKDRCGNVNKNLVSNKNSKYFKKVKKASYNIR 659

Query: 781 QGKQPRKE 788
             +Q + +
Sbjct: 660 LRRQQKSD 667

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 41/75 (54%), Gaps = 9/75 (12%)

Query: 954  ADRRPRHTPGRSTDS-----SASQYNSQTPTNANYKSRRRRQAKFSKPIAGQDVMSQYLE 1008
            A RR     G   DS     S S   S++    + KSR+R     ++ I G +VM+QYL 
Sbjct: 834  APRRSARKNGHDHDSNPVSGSKSDIGSKSTQGKSSKSRQRN----AQAIPGSNVMAQYLA 889

Query: 1009 QLHHSTFLYATNILG 1023
            QL HSTF+YA +ILG
Sbjct: 890  QLQHSTFMYAADILG 904

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa]
           {ON} some similarities with uniprot|Q03735 Saccharomyces
           cerevisiae YML117w
          Length = 1050

 Score =  461 bits (1185), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 299/771 (38%), Positives = 409/771 (53%), Gaps = 137/771 (17%)

Query: 136 VTLNHSEPYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLM 195
           VT     P  IN+++LP G D Y TRSLL  N++   D  +  F+   + +  VES+Y+ 
Sbjct: 162 VTKKLISPISINYRVLPSGDDTYKTRSLLFENVQK-NDEMLSVFMRLIINYSQVESVYVF 220

Query: 196 D-------------DNHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFV--- 239
                         D   + LSFL++   LDFYNN LQR  +FK KL SPKLSVSFV   
Sbjct: 221 QQTDTPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDFKKKLSSPKLSVSFVSFS 280

Query: 240 -CQDESSWFKY------------------------LQMNVVTRGATRSLTVEFEDSVKEL 274
              DE                              L   + +  ATRS+ +EF   V++ 
Sbjct: 281 YVTDEDKDKDKDKDKDINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAIEFYSQVEQ- 339

Query: 275 NEDFVRLKFPWL--FCSQRFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQ 332
             D +  K P+L    ++R++LE +D+I+A      F   Y+IL FI+I MA+EV D+L+
Sbjct: 340 --DALFEKLPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEVLDYLK 397

Query: 333 QPSQKRQLNISRIQFVNVNGHHSKLSDEEAAAAANGLQQDXXXXXXXXXXXXXXNTA--- 389
             +     +++   FV++ G  S+  +         +  +              NT    
Sbjct: 398 --ANLMTYSVNECFFVSLPGCKSQ-RESSTTPVLGHISTEGSKSVSEVNLANGGNTVMID 454

Query: 390 -DLAALF-HXXXXXXXXXXXQVVPSEYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEM 447
            +L +L              +++ S+YP P I  H +H+   T          + S+   
Sbjct: 455 RELESLSDELASLKLEEKCLKIIRSDYPKPEIRSHDDHIPGST----------NFSMYIF 504

Query: 448 DSNATNAGN-----HHGVS--SSLSGVLFMN--DPSSSGSTPMIVPSELNLNTPVXXXXX 498
           D      GN     H  ++  SS+ G  F N  DPS S    +++P   N   PV     
Sbjct: 505 DDGMNPEGNSGMYLHDNLTDHSSIIGSPFSNYIDPSISH---VMLP---NNGLPV----- 553

Query: 499 XXXXXXXXXXXXSLHNPSDGNGGSPSYF-MDPMVGAPIGQT-----------LQRQYLAG 546
                              G   +P  F ++P+ G P   T           L       
Sbjct: 554 -------------------GGFDAPGKFPIEPISGPPFNHTNKVITQSIEDRLNTSARIA 594

Query: 547 ASQANGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQF 606
           A+     +NRTVYIGNI+PRSK EDICNVVRGGILQ +K+I  KRICFVTFIE +AA QF
Sbjct: 595 AAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQF 654

Query: 607 YANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNP 666
            AN+ ++PIVLHGN LRVGWG  SG LPK+IALAVT+GA+RNVYVSLPEY+FK+K+IN+P
Sbjct: 655 CANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDP 714

Query: 667 EFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPI 726
           ++K YH +YKLP++EQLR+DFT YG++EQINYL+D HCCWVNF+NIA AIRLVED N   
Sbjct: 715 KYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDIN--- 771

Query: 727 EKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSRFYKKIKKQSYSMK----QG 782
             N E+FH +F+ RY+ LII YGKDRCGN+NKNL A K S+FYKK+KK SY ++    + 
Sbjct: 772 HNNGEEFHKKFNNRYEGLIINYGKDRCGNINKNLIAGKGSKFYKKVKKPSYDIRIKKMEE 831

Query: 783 KQPRKEDGIVN-------------SDDLTKNNEV-LPGVQMNSSKNGGVGE 819
           K+  +ED +++             S D T +NE  L G    + +NGGV +
Sbjct: 832 KRKMQEDNLLSQKKNSIQLDSLGISVDRTFSNESKLSGGHTTTEENGGVKQ 882

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 35/61 (57%), Gaps = 5/61 (8%)

Query: 974  NSQTPTNANYKSRRRRQAKF-----SKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQ 1028
            N Q P     K  +R    F     ++PI G DVM+QYL QL HSTF+YA NILGA+   
Sbjct: 984  NGQAPKMDYPKKYKRTHNNFPNQQPTRPIPGSDVMAQYLAQLQHSTFMYAANILGASVET 1043

Query: 1029 E 1029
            E
Sbjct: 1044 E 1044

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/33 (69%), Positives = 26/33 (78%)

Query: 59 VPQTPFDPTYGASLLPSHMLMGSPFLSTPLRPQ 91
          VP TPFD  YGASLLPSH+LMGSP +ST   P+
Sbjct: 49 VPPTPFDTAYGASLLPSHLLMGSPMISTTNLPR 81

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  442 bits (1137), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 271/665 (40%), Positives = 381/665 (57%), Gaps = 84/665 (12%)

Query: 199 HSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFV-CQDESSWFKYLQMNVVTR 257
            S LLSF TK +CLDFYNNLLQR++E K  + S +L+++FV  QD+  W   L+MNV++ 
Sbjct: 325 QSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEWMANLKMNVISL 384

Query: 258 GATRSLTVEFEDSVKELNEDFVRLKFPWLFCSQRFVLERIDLINATTVNQHFGTRYMILH 317
           GATRSL VEF D    +  D +    P+L  S ++V+  +D++      ++FG  Y +LH
Sbjct: 385 GATRSLYVEFADD--SVTSDTIWDTLPFLKNSGKYVVIDVDVVTTDERRKNFGLHYCLLH 442

Query: 318 FISISMALEVDDFLQQPSQKRQLNISRIQFVN-VNGHHSKLSDEEAAAAANGLQQDXXXX 376
           F+S++MALEV + L+   +     +SR+ FV   N    ++    ++A +  L+Q+    
Sbjct: 443 FLSVTMALEVKELLETGDEA----VSRVSFVTPANSADKEMRRRRSSAIS--LKQEASPQ 496

Query: 377 XXXX---------------XXXXXXNTADLAALFHXXXXXXXXXXXQVVP-SEYPTPLIE 420
                                     + D++   +            +V  SEY  P++ 
Sbjct: 497 MFSTDSRSRSRSSNVSLPLSEQVSTASTDISTPIYEEFDGNLTWSTLIVDVSEYKEPIVN 556

Query: 421 QHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVSSSLSGVLFMNDP-SSSGST 479
           +   HL S +IS+P+       +L   +S  TN       SS+LS  +   DP S S   
Sbjct: 557 EFDHHLNSWSISKPT-------TLYMHESGTTNFS-----SSNLSDDI---DPLSISSHD 601

Query: 480 PMIVPSELNLNTPVXXXXXXXXXXXXXXXXXSLHNPSDGNGGSPSYFMDPMVGAPIGQTL 539
           P  VP ++ LN                                  Y M+P++   I QT+
Sbjct: 602 P--VPQQMLLN-------------------------------EYPYIMEPLMPPQITQTI 628

Query: 540 QRQYLAGASQAN-GINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFI 598
           Q QY       N G+ +RTVYIGNI+PRSK EDICNVVRGGILQ IKW+S KRICFVTFI
Sbjct: 629 QNQYSKSIQAVNAGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFI 688

Query: 599 ETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSF 658
           ETAAAVQFYAN +LEPI+LHGN+L+VGWGQ  G LPKNIALAVT+GASRNVYVSLP+ +F
Sbjct: 689 ETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAF 748

Query: 659 KEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRL 718
           K+K+IN+P+FK Y  +YK+P   QL+ DF  YG +EQ+N+  DGHCCW+NFMNI+ AI+L
Sbjct: 749 KDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKL 808

Query: 719 VEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSR-FYKKIKKQSY 777
           VE+  S  + NL  FH + +GRY  LIIGYGKDRCGN+N+NL  NKN +        Q+ 
Sbjct: 809 VEEY-SDTKDNL--FHKKTEGRYVGLIIGYGKDRCGNINRNLVFNKNGKGSNHNRNSQNN 865

Query: 778 SMKQGKQPRKEDGIV-NSDDLTKNNEVLPGVQMNSSKNGGVGESQ---SLVGDQELAEGL 833
           +  +G + RK+     N+ ++   +  +    + + K     +++   SL  D + +EGL
Sbjct: 866 NTSRGHRQRKQSATFSNASNIDLKHSSVANASIANGKLDRPMDNKNFLSLGVDADFSEGL 925

Query: 834 GISLT 838
           GIS++
Sbjct: 926 GISIS 930

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/44 (65%), Positives = 37/44 (84%), Gaps = 4/44 (9%)

Query: 995  KPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYDSN 1038
            KPIAG DVM++YLEQLHH+TF+YA NILGAT  Q+P+  +YD +
Sbjct: 1110 KPIAGSDVMTRYLEQLHHNTFVYAANILGAT--QDPV--FYDED 1149

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/37 (64%), Positives = 31/37 (83%), Gaps = 3/37 (8%)

Query: 54 GSMP---PVPQTPFDPTYGASLLPSHMLMGSPFLSTP 87
          GS+P    +PQTPFDP YG +LLPSH+L+GSPF++TP
Sbjct: 60 GSIPGTVSIPQTPFDPVYGITLLPSHLLVGSPFVNTP 96

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 2/50 (4%)

Query: 148 FKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMDD 197
           + ILPKG D Y +RSLL TN+    +LDI  FL    K  P+ESIYL+ D
Sbjct: 219 YSILPKGNDTYRSRSLLFTNVN--SELDIVEFLQKVAKNYPIESIYLIKD 266

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
           {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
           YML117W NAB6 Putative RNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 1259

 Score =  371 bits (952), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 176/304 (57%), Positives = 228/304 (75%), Gaps = 16/304 (5%)

Query: 534 PIGQTLQRQYLAGASQAN----GINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISS 589
           PI Q+LQ+Q+   A  AN    GI NRTVYIGNIHPRSKPEDICNVVRGGILQ+I+++  
Sbjct: 643 PITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQD 702

Query: 590 KRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNV 649
           K ICFVTFIE + AVQFY NA ++PIVLHGN+L+VGWG  SG LPK+++LAVT+GASRNV
Sbjct: 703 KHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNV 762

Query: 650 YVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNF 709
           YVSLP+++FK+KYIN+P+++ Y  +YKLP EEQLR DF ++G +EQIN+L DGHCCWVNF
Sbjct: 763 YVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNF 822

Query: 710 MNIAHAIRLVEDSNSPIEKNL-EKFHAQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSRF 768
           MNI+ AI+LVE+    I+ N  E FH  FD RY+ LIIGYGKDRCGNVNKNL + KNSRF
Sbjct: 823 MNISSAIKLVEE----IKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRF 878

Query: 769 YKKIKKQSYSMKQGK---QPRKEDGIVNSDDLTKNNEVLP----GVQMNSSKNGGVGESQ 821
           YKK+KK SY+++  +   + +K +  + S +   + ++L     G+ +  + N      +
Sbjct: 879 YKKVKKPSYNIRLSRMEEERKKHEETLRSQNQNNDEKMLQFGSLGIHLEGNDNNKTSYER 938

Query: 822 SLVG 825
           SL G
Sbjct: 939 SLNG 942

 Score =  149 bits (376), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 98/280 (35%), Positives = 146/280 (52%), Gaps = 58/280 (20%)

Query: 142 EPYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMDD---- 197
           EP+ + +++LPKG DEY TRSLL  N+     +D+++F++ + ++GPVESIY+  D    
Sbjct: 213 EPFVVTYRMLPKGDDEYRTRSLLFENVNG--SVDLYSFVSKYSRYGPVESIYMFKDRNDK 270

Query: 198 -NHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFV----------------- 239
             HS+LLSFL++  CLD YN++LQR +EFKT L S  L+VSFV                 
Sbjct: 271 TKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKHVDENEVDQND 330

Query: 240 ------------------------CQDES---SWFKYLQMNVVTRGATRSLTVEFE---D 269
                                    QD++   +    LQ ++V RGATRS+ +E +   D
Sbjct: 331 NSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNRGATRSVALELDGEYD 390

Query: 270 SVKELNEDFVRLKFPWLFCSQRFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDD 329
             K L+++   L F     +QR+VLE I LINA    +HF   Y IL F++ISMA+EV D
Sbjct: 391 KTKLLDQE---LDFLSPANNQRYVLESIYLINAKEPFKHFPKNYAILTFLNISMAVEVLD 447

Query: 330 FLQQPSQKRQLNISRIQFVNVNGHHSKLSDEEAAAAANGL 369
           +++     R     +  FV+V+      SD      +N +
Sbjct: 448 YVRNNETARS-KFQKCFFVSVSSCPQTSSDGGIVTTSNSI 486

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 44/74 (59%), Gaps = 2/74 (2%)

Query: 965  STDSSASQYNSQTPTNANYKSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGA 1024
            S+ +S  + +S    +   + + R + + +K I G DVM+QYL QL HSTF+YA NILGA
Sbjct: 1185 SSHNSGDRMSSHVGNSRGQQGKGRNKRRNAKAIPGSDVMAQYLAQLQHSTFMYAANILGA 1244

Query: 1025 TTVQEPLGGYYDSN 1038
            T   E    YY+ N
Sbjct: 1245 TA--EGDVDYYEDN 1256

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 21/24 (87%)

Query: 64  FDPTYGASLLPSHMLMGSPFLSTP 87
           FD  YG +LLPSH+L+GSPF+S+P
Sbjct: 87  FDTAYGITLLPSHLLIGSPFVSSP 110

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
           (REAL)
          Length = 1122

 Score =  357 bits (915), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 205/434 (47%), Positives = 270/434 (62%), Gaps = 64/434 (14%)

Query: 408 QVVPSEYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVSSSLSGV 467
           +V   +YPTP+I +HS HL++I IS   KT+  S    + D  +    N H         
Sbjct: 533 EVTCHDYPTPVINEHSAHLSNIKIS---KTVDNSRQFTQ-DIPSPLPLNEH--------- 579

Query: 468 LFMNDPSSSGSTPMIVPSELNLNTPVXXXXXXXXXXXXXXXXXSLHNPSDGNGGSPSYFM 527
           +FM D + S  T  IV  +L                        +  PS     SP+  M
Sbjct: 580 MFMTDSNQSNGT--IVSQQL------------------------ITAPS---PQSPNPQM 610

Query: 528 DPMV-GAPIGQTLQRQYLAGA----SQANGINNRTVYIGNIHPRSKPEDICNVVRGGILQ 582
           +  V   PI Q+L++ +   A    S  + I NRT+YIGNI+PRS+ EDICNVVRGGILQ
Sbjct: 611 NQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQ 670

Query: 583 TIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVT 642
            IK+I+ KRICFVTFIE A+AVQFYAN+ ++PIVLHGN+LRVGWG  SG LPK+I+LAVT
Sbjct: 671 NIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVT 730

Query: 643 IGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDG 702
           IGASRNVYVSLPE++FKEK+I++P++K  H    LP  EQLR+DF+ YG +EQINYL D 
Sbjct: 731 IGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDS 790

Query: 703 HCCWVNFMNIAHAIRLVE----------DSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDR 752
           HCCW+NFMNI+ AI LVE          DS   I K   +   +FDGRYK L+I YGKDR
Sbjct: 791 HCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATE--EKFDGRYKGLLINYGKDR 848

Query: 753 CGNVNKNLAANKNSRFYKKIKKQSYSMK----QGKQPRKEDGIVNSDDLTKNNEVLPGVQ 808
           CGN+NKNL A KNSRFYKK+K+ SY+++    + ++ + E+    S D   N E L G+ 
Sbjct: 849 CGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKESFDKVLNLESL-GIS 907

Query: 809 MNSSKNGGVGESQS 822
           ++  K   + E+++
Sbjct: 908 LDPHKGTDIDEAEA 921

 Score =  139 bits (351), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 86/248 (34%), Positives = 138/248 (55%), Gaps = 43/248 (17%)

Query: 142 EPYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLM------ 195
           +P+ IN+KILP G D Y TRSLL+ N++     D+H+ + +FVK   +ES Y++      
Sbjct: 197 KPFRINYKILPAGDDAYRTRSLLIENVD--DSADLHSLVKNFVKSNALESAYIVGSKETD 254

Query: 196 ------DDNHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVC--------- 240
                   N SIL+SFLT+  CL+FYNN+LQR SEFKT L S  L++ FVC         
Sbjct: 255 NLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFVCLNYDSKSLP 314

Query: 241 ----------------QDESSWF--KYLQMNVVTRGATRSLTVEFEDSVKELNEDFVRLK 282
                            D++S      L  +V  + ATRS+ +EF+  +++      +L+
Sbjct: 315 TPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFKSPLEKAELFKEKLQ 374

Query: 283 FPWLFCSQRFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQQPSQKRQLNI 342
           F     ++R++LE ID+++    +  F   Y++L F++I MA+EV D+L++ S+K  L I
Sbjct: 375 FLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVLDYLKKYSKK--LGI 432

Query: 343 SRIQFVNV 350
           S+  +V++
Sbjct: 433 SKCFYVSL 440

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (87%)

Query: 56 MPPVPQTPFDPTYGASLLPSHMLMGSPFLSTP 87
          +P VP TPFD  YGASLLPSH+LMGSPF+S+P
Sbjct: 60 LPNVPPTPFDTAYGASLLPSHLLMGSPFVSSP 91

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%)

Query: 984  KSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGAT 1025
            K+++R      + I G DVM+QYL Q+ HSTF+YA NILGA+
Sbjct: 1072 KTKKRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGAS 1113

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  358 bits (918), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 169/287 (58%), Positives = 219/287 (76%), Gaps = 13/287 (4%)

Query: 535  IGQTLQRQYLAG----ASQANGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSK 590
            + QTL+  +       A    G  NRTVYIGNI+PRSKPED+CNVVRGGILQ I ++  K
Sbjct: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860

Query: 591  RICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVY 650
             ICFVTFIE   A QF+ANA ++PIVLHGNIL+VGWG  SG LPK+I+LAVTIGA+RNVY
Sbjct: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920

Query: 651  VSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFM 710
            VSLPE++FK+K+INNP+++ YH  YKLP E QLR+DF++YG++EQINYL DGHCCW+NFM
Sbjct: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980

Query: 711  NIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSRFYK 770
            NI  AI LVE+ N   E +  +FH +FDGRY  LIIGYGKDRCGNVNKNL A KNS+F+K
Sbjct: 981  NINSAITLVEEVN---EDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVATKNSKFFK 1037

Query: 771  KIKKQSYSMK-----QGKQPRKEDGIVNSDDLTKNNEVL-PGVQMNS 811
            K+KK +Y +K     + ++ ++E+ + N++ L+ N+++  P V + S
Sbjct: 1038 KVKKPAYQIKLKKIEEERRLQEENNLRNNNKLSNNSQIRKPAVNLES 1084

 Score =  105 bits (263), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 73/103 (70%), Gaps = 7/103 (6%)

Query: 143 PYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMDDN---- 198
           P  +++KILPKG DE+ TRSLLL N+   + +D    + +F+ FGP+ES+YL+  N    
Sbjct: 260 PLVVSYKILPKGTDEFRTRSLLLENIN--QSIDTRTLVKNFINFGPIESVYLIKLNPGSK 317

Query: 199 -HSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVC 240
            +SILLSF+++  CLDFYNN+LQR  EFKT+L S  L++SFV 
Sbjct: 318 YNSILLSFVSREICLDFYNNVLQRLMEFKTELSSKSLTLSFVI 360

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (90%)

Query: 56  MPPVPQTPFDPTYGASLLPSHMLMGSPFLSTP 87
           +P  P TPFDP+YGA+LLPSH+LMGSPF+STP
Sbjct: 101 IPSAPPTPFDPSYGATLLPSHLLMGSPFVSTP 132

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 31/48 (64%), Gaps = 6/48 (12%)

Query: 978  PTNANYKSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGAT 1025
            P N N K+R  R     K I G DVMSQYL QL HSTF+YA NILG +
Sbjct: 1305 PRNKN-KNRNTR-----KTIPGSDVMSQYLTQLQHSTFMYAANILGVS 1346

 Score = 38.9 bits (89), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 57/128 (44%), Gaps = 27/128 (21%)

Query: 250 LQMNVVTRGATRSLTVEFEDSVKE---LNEDFVRLKFPWLFCSQRFVLERIDLINAT--- 303
           LQ ++V RGATRSL ++F   V +   +NE            + R++LE I L+N     
Sbjct: 432 LQSDLVKRGATRSLLLKFNGVVSKDQLINEKLNLFI--NNNLNNRYILESISLVNIENNT 489

Query: 304 -----------------TVNQHFGTRYMILHFISISMALEVDDFLQQPSQKRQLNISRIQ 346
                            T    FG  Y +L F +I MA+E  D+ +  ++  +LNI    
Sbjct: 490 KNNKNTIGDDNEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFK--AKLNELNIFDCF 547

Query: 347 FVNVNGHH 354
           FV+   +H
Sbjct: 548 FVSKTNYH 555

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
           RNA-binding protein that associates with mRNAs encoding
           cell wall proteins in high-throughput studies; deletion
           mutants display increased sensitivity to some cell wall
           disrupting agents; expression negatively regulated by
           cAMP
          Length = 1134

 Score =  353 bits (907), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 201/426 (47%), Positives = 269/426 (63%), Gaps = 61/426 (14%)

Query: 413 EYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVSSSLSGVLFMND 472
           +Y TP IE+HS HL+++ IS+ ++    ++     D  +    N H         +FMND
Sbjct: 547 DYQTPTIEEHSTHLSNVKISKTTE----NSRQFSQDIPSPLPLNEH---------MFMND 593

Query: 473 PSSSGSTPMIVPSELNLNTPVXXXXXXXXXXXXXXXXXSLHNPSDGNGGSPSYFMDPMV- 531
             S+ S   I+P +L + TP                             SP+  M+  V 
Sbjct: 594 --SNQSNGAIIPQQL-IATPSPV--------------------------SPNLQMNQRVL 624

Query: 532 GAPIGQTLQRQYLAGA----SQANGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWI 587
             PI Q+L++ +   A    S  + I NRT+YIGNI+PRSK EDICNVVRGGILQ+IK+I
Sbjct: 625 PNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYI 684

Query: 588 SSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASR 647
             K+ICFVTFIE  +AVQFYAN+ ++PIVLHGN+LRVGWG  SG LPK I+LAVTIGASR
Sbjct: 685 PEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASR 744

Query: 648 NVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWV 707
           NVYVSLPE++FKEK+I++P++K  H    LP  EQLR+DF+ YG +EQINYL D HCCW+
Sbjct: 745 NVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWI 804

Query: 708 NFMNIAHAIRLVED-------SNSPIEKNLEKF-HAQFDGRYKNLIIGYGKDRCGNVNKN 759
           NFMNI+ AI LVE+        N   E  L++    +F GRYK L+I YGKDRCGN+NKN
Sbjct: 805 NFMNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINKN 864

Query: 760 LAANKNSRFYKKIKKQSYSMKQGK--QPRKEDGIVNSD---DLTKNNEVLPGVQMNSSKN 814
           L A KNSRFYKK+K+ SY+++  K  + R+++ I   +   D   N E L G+ +++ K+
Sbjct: 865 LIAGKNSRFYKKVKRPSYNIRLSKLEEKRRQNEIDEKEKAFDKPLNLESL-GISLDAHKD 923

Query: 815 GGVGES 820
            G GE+
Sbjct: 924 NGGGET 929

 Score =  148 bits (373), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 94/249 (37%), Positives = 139/249 (55%), Gaps = 47/249 (18%)

Query: 143 PYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLM-----DD 197
           P+ IN+K+LP G D Y TRSLL+ N++    +D+H+ + +FVK   +ES YL+     DD
Sbjct: 196 PFCINYKVLPTGDDAYRTRSLLIENVD--HSIDLHSIVKNFVKSNTLESAYLIEGGKSDD 253

Query: 198 -------NHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVCQD-------- 242
                  N SIL+SFLTK  CL+FYNN+LQR SEFKT L S  L++ FVC +        
Sbjct: 254 SKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPKCLPT 313

Query: 243 --ESSWF-----------------KYLQMNVVTRGATRSLTVEFEDSVKELNEDFVRLKF 283
             ES                      L  N+  + ATRS+ +EF+  V++   D  + K 
Sbjct: 314 FIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFKSPVEK--SDLFKKKL 371

Query: 284 PWLFCS--QRFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQQPSQKRQLN 341
            +L  S  +R++LE IDL+N    +  F   Y +L F++ISMA+EV D+L++ S  + L 
Sbjct: 372 QFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDYLKKYS--KNLG 429

Query: 342 ISRIQFVNV 350
           IS+  +V++
Sbjct: 430 ISKCFYVSL 438

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/32 (68%), Positives = 27/32 (84%)

Query: 56 MPPVPQTPFDPTYGASLLPSHMLMGSPFLSTP 87
          +P +P TPFD  YGASL PSH+LMGSPF+S+P
Sbjct: 60 LPNIPPTPFDTAYGASLFPSHLLMGSPFVSSP 91

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 44/77 (57%), Gaps = 10/77 (12%)

Query: 959  RHTPGR--STDSSASQYNSQTP-----TN---ANYKSRRRRQAKFSKPIAGQDVMSQYLE 1008
            R  P R  ST S     N++TP     TN   AN + ++R      + I G DVM+QYL 
Sbjct: 1049 RQAPPRAPSTLSYNHSKNNETPMQDIFTNGETANNRKKKRGSFARHRTIPGSDVMAQYLA 1108

Query: 1009 QLHHSTFLYATNILGAT 1025
            Q+ HSTF+YA NILGA+
Sbjct: 1109 QVQHSTFMYAANILGAS 1125

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
           (REAL)
          Length = 1131

 Score =  349 bits (896), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 195/426 (45%), Positives = 261/426 (61%), Gaps = 63/426 (14%)

Query: 413 EYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVSSSL--SGVLFM 470
           +Y TP + +HS HL+++ IS   KT+  S                H + S L  +  +FM
Sbjct: 545 DYQTPTVHEHSTHLSNVKIS---KTVENSRQF------------PHDIPSPLPLNERMFM 589

Query: 471 NDPSSSGSTPMIVPSELNLNTPVXXXXXXXXXXXXXXXXXSLHNPSDGNGGSPSYFMDPM 530
           ND + S  +  IVP +L + TP                             S       +
Sbjct: 590 NDSNHSNGS--IVPQQL-MATPSPV-------------------------SSTIQMNQRV 621

Query: 531 VGAPIGQTLQRQYLAGA----SQANGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKW 586
           +  PI Q+L++ +   A    S  + + NRT+YIGNI+PRS+ EDICNVVRGGILQ+IK+
Sbjct: 622 LPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKY 681

Query: 587 ISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGAS 646
           +  KRICFVTFIE  +AVQFYAN+ ++PIVLHGN+LRVGWG  SG LPK+I+LAVTIGAS
Sbjct: 682 MPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGAS 741

Query: 647 RNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCW 706
           RNVYVSLPE++FKEK+I++P++K  H    LP  EQLR+DF+ YG +EQINYL D HCCW
Sbjct: 742 RNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCW 801

Query: 707 VNFMNIAHAIRLVEDSNSPIEKNLEK--------FHAQFDGRYKNLIIGYGKDRCGNVNK 758
           +NFMNI+ AI LVE+ N     + E            +F GRY+ L+I YGKDRCGN+NK
Sbjct: 802 INFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINK 861

Query: 759 NLAANKNSRFYKKIKKQSYSMKQGK-----QPRKEDGIVNSDDLTKNNEVLPGVQMNSSK 813
           NL A KNSRFYKK+K+ SY+++  K     +  + D    + D   N E L G+ ++S K
Sbjct: 862 NLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKERAFDKALNLESL-GISLDSHK 920

Query: 814 NGGVGE 819
           + G+GE
Sbjct: 921 DIGIGE 926

 Score =  147 bits (370), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 91/247 (36%), Positives = 137/247 (55%), Gaps = 43/247 (17%)

Query: 143 PYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLM-----DD 197
           P+ IN+KILP G D Y TRSLL+ N++  R  D+H+ + +FVK   +ES Y++     DD
Sbjct: 195 PFRINYKILPTGDDAYRTRSLLIENVD--RSTDLHSIVKNFVKSNTLESTYIIGNEKSDD 252

Query: 198 -------NHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVC---------- 240
                  N SIL+SFLT++ CL+FYNN+LQR SEFKT L S  L++ FVC          
Sbjct: 253 LKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYDFKCLST 312

Query: 241 -----------------QDESSWFKYLQMNVVTRGATRSLTVEFEDSVKELNEDFVRLKF 283
                             D S     L  ++  + ATRS+ VEF+  +K       +L+F
Sbjct: 313 FIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSPLKSTELFNKKLQF 372

Query: 284 PWLFCSQRFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQQPSQKRQLNIS 343
                ++R++LE ID++N    +  F   Y +L F++I MA+EV D+L++ S+K  L IS
Sbjct: 373 LDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYLKKYSKK--LGIS 430

Query: 344 RIQFVNV 350
           +  +V++
Sbjct: 431 KCFYVSL 437

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/32 (71%), Positives = 28/32 (87%)

Query: 56 MPPVPQTPFDPTYGASLLPSHMLMGSPFLSTP 87
          +P +P TPFD  YGASLLPSH+LMGSPF+S+P
Sbjct: 60 LPNIPPTPFDTAYGASLLPSHLLMGSPFVSSP 91

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 977  TPTNANYKSRRRRQAKF--SKPIAGQDVMSQYLEQLHHSTFLYATNILGAT 1025
             P      +R++ +  F   + I G DVM+QYL Q+ HSTF+YA NILGA+
Sbjct: 1072 VPNGETTSNRKKNRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGAS 1122

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,
           1032 aa] {ON} (7832..9475,9855..9863,10320..11765) [3099
           nt, 1033 aa]
          Length = 1032

 Score =  345 bits (885), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 160/256 (62%), Positives = 202/256 (78%), Gaps = 8/256 (3%)

Query: 540 QRQYLAGASQAN----GINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFV 595
           + Q+   A  AN    G  NRTVYIGNI+PRSK EDICNVVRGG LQ IK+   K ICFV
Sbjct: 561 KHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFV 620

Query: 596 TFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPE 655
           TFIE A+A QFYAN+ ++PI+LH N LRVGWG  SG LPK+I+LAVT+GASRNVYVSLPE
Sbjct: 621 TFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPE 680

Query: 656 YSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHA 715
           Y+FK+K+IN+PE+K YH KY LPTEE+LR+DF+ +G++EQ+N+L DGHCCW+NFMNI  A
Sbjct: 681 YAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSA 740

Query: 716 IRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSRFYKKIKKQ 775
           I+LVE  NS      + FH ++  RYK LIIGYGKDRCGNVNK+L + KNS+FY+K+KK 
Sbjct: 741 IKLVESVNS--SNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKP 798

Query: 776 SYSMK--QGKQPRKED 789
           SY+++  Q ++ RK++
Sbjct: 799 SYNIRLQQLEEERKQE 814

 Score =  184 bits (466), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 128/397 (32%), Positives = 184/397 (46%), Gaps = 115/397 (28%)

Query: 56  MPPVPQTPFDPTYGASLLPSHMLMGSPFLSTPLRPQAHFH------PSTPGXXXXXXXXX 109
           +P  P TPFD  YGASLLPSH+LMGSPF+STP   Q++        PS  G         
Sbjct: 118 IPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSKGGNSMGRLSSA 177

Query: 110 XXXXXXFLYYPQPPMLKPIPPRRK------------------------------------ 133
                    YP PP +   P  R                                     
Sbjct: 178 ---------YPAPPTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNSHRNTN 228

Query: 134 ------------KSVTLNHSEPYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLN 181
                       K    N    + I++K+LPKG DEY TRSLL  N++  + +D+H F+ 
Sbjct: 229 NNGGRFTQKNIIKRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVD--KSVDLHCFIK 286

Query: 182 SFVKFGPVESIYLMDDN-------------------------------HSILLSFLTKAT 210
            FV FGP+ES+YL++ N                                SILLSFL++  
Sbjct: 287 KFVNFGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPI 346

Query: 211 CLDFYNNLLQRFSEFKTKLHSPKLSVSFVC---------QDESSWFK-----YLQMNVVT 256
           CLDFYN++LQR SEFKT+L+S  L++SFV           DE S F       L+ +++ 
Sbjct: 347 CLDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIK 406

Query: 257 RGATRSLTVEFEDSVKELNEDFVRLKFPWLFC--SQRFVLERIDLINATTVNQHFGTRYM 314
           RGATRS+ VEF   +    E F+  K  +L    ++R+++E +D+INA   + +     +
Sbjct: 407 RGATRSIAVEFNQPITS-KEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTV 465

Query: 315 ILHFISISMALEVDDFLQQPSQKRQLNISRIQFVNVN 351
           IL F++ISM ++V D ++   +++   IS+  FV  N
Sbjct: 466 ILTFLNISMTVDVMDRIRL--ERKDSGISKCVFVTFN 500

 Score = 57.0 bits (136), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/60 (51%), Positives = 39/60 (65%), Gaps = 3/60 (5%)

Query: 979  TNANYKSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYDSN 1038
            T++   S +R   K  K + G DVMSQYL QL HSTF+YA NILGA++  EP   +YD N
Sbjct: 969  TSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASS-DEP--EFYDEN 1025

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
           (REAL)
          Length = 1128

 Score =  347 bits (889), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/434 (43%), Positives = 264/434 (60%), Gaps = 52/434 (11%)

Query: 408 QVVPSEYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVSSSLSGV 467
           ++   +Y TP I +HS HL++I IS+  +             N+ +          L+  
Sbjct: 539 EITSHDYSTPTINEHSTHLSNIKISKTVE-------------NSRHFPQDIPSPLPLNEQ 585

Query: 468 LFMNDPSSSGSTPMIVPSELNLNTPVXXXXXXXXXXXXXXXXXSLHNPSDGNGGSPSYFM 527
           +FMND  S+ S   ++P +L +  P                     +P   N       +
Sbjct: 586 MFMND--SNQSNGAVIPQQL-IAAP---------------------SPLSSNLQINQRVL 621

Query: 528 DPMVGAPIGQTLQRQYLAGASQANGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWI 587
              +   + Q         +S  + + NRT+YIGNI+PRS+ EDICNVVRGGILQ+IK+I
Sbjct: 622 PNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYI 681

Query: 588 SSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASR 647
             KRI FVTFIE  +AVQFYAN+ ++PIVLHGN+LRVGWG  SG LPK+I+LAVTIGASR
Sbjct: 682 PEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASR 741

Query: 648 NVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWV 707
           NVYVSLPE++FKEK+I++P++K  H    LP  EQLR+DF+ YG +EQINYL D HCCW+
Sbjct: 742 NVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWI 801

Query: 708 NFMNIAHAIRLVEDSNSPIEKNLE--------KFHAQFDGRYKNLIIGYGKDRCGNVNKN 759
           NFMNI+ AI LVE+ N     + +            +FDGRYK L+I YGKDRCGN+NKN
Sbjct: 802 NFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINKN 861

Query: 760 LAANKNSRFYKKIKKQSYSMK----QGKQPRKEDGIVNSDDLTKNNEVLPGVQMNSSKNG 815
           L A KNSRFYKK+K+ SY+++    + ++ + E+    S D   N E L G+ ++  K+ 
Sbjct: 862 LVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKESFDKVLNLESL-GISLDPHKDA 920

Query: 816 GVG--ESQSLVGDQ 827
           G+G  E++++ GD+
Sbjct: 921 GIGVIETENITGDE 934

 Score =  148 bits (373), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 88/247 (35%), Positives = 136/247 (55%), Gaps = 43/247 (17%)

Query: 143 PYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMD------ 196
           P+ IN+KILP G D Y TRSLL+ N++  R  D+H+ + +FVKF  +ES Y +D      
Sbjct: 195 PFRINYKILPTGDDAYRTRSLLIENVD--RSTDLHSLVKNFVKFNTLESAYFVDNDKNDD 252

Query: 197 ------DNHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVC---------- 240
                 +N S+L+SFLT++ CL+FYNN+LQR SEFK  L S  L++ FVC          
Sbjct: 253 LEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYESECLST 312

Query: 241 -----------------QDESSWFKYLQMNVVTRGATRSLTVEFEDSVKELNEDFVRLKF 283
                             D       L  +V  + ATRS+ +EF+ ++++      RL+F
Sbjct: 313 FVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSALEKTELFRKRLQF 372

Query: 284 PWLFCSQRFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQQPSQKRQLNIS 343
                ++R++LE IDL+N    +  F   Y +L F++I MA+EV D+L++ S  + L IS
Sbjct: 373 LDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYLKKFS--KSLEIS 430

Query: 344 RIQFVNV 350
           +  +V++
Sbjct: 431 KCFYVSL 437

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (87%)

Query: 56 MPPVPQTPFDPTYGASLLPSHMLMGSPFLSTP 87
          +P VP TPFD  YGASLLPSH+LMGSPF+S+P
Sbjct: 60 LPNVPPTPFDTAYGASLLPSHLLMGSPFVSSP 91

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 36/59 (61%)

Query: 968  SSASQYNSQTPTNANYKSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGATT 1026
            S  S  +S+    AN + R+R      + I G DVM+QYL Q+ HSTF+YA NILGA+ 
Sbjct: 1062 SETSFQDSRNAETANNRERKRGSLPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASA 1120

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  347 bits (891), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 162/271 (59%), Positives = 212/271 (78%), Gaps = 9/271 (3%)

Query: 523 PSYFMDPMVGAPIGQTLQRQYLAGASQANGIN----NRTVYIGNIHPRSKPEDICNVVRG 578
           P++  DP +  PI +TL+ ++   A  A+ +     NRT+YIGN++PRSK ED+CNVVRG
Sbjct: 692 PTFNTDPTM-YPIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRG 750

Query: 579 GILQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIA 638
           GILQ+IK I+SKRICFVTFIE +AAVQFYAN+ ++P++LHGN L++GWG     L K+IA
Sbjct: 751 GILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIA 810

Query: 639 LAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINY 698
           LAVTIGASRNVYVSLPE++FK+K++N+PE+K +H KYKLP+E+QLR DF KYG +EQINY
Sbjct: 811 LAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINY 870

Query: 699 LEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNK 758
           L D HCCWVNFMNI  AI+LVED N+  + N   F  +F+ RY  LII YGKDRCGNVN+
Sbjct: 871 LSDSHCCWVNFMNITSAIKLVEDVNNNPKDNT--FSKKFNHRYDGLIINYGKDRCGNVNR 928

Query: 759 NLAANKNSRFYKKIKK--QSYSMKQGKQPRK 787
           NL +NKNSR Y+K+KK   +Y ++Q ++ R+
Sbjct: 929 NLISNKNSRHYRKVKKFSDNYKLRQLQEKRR 959

 Score =  134 bits (336), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 110/401 (27%), Positives = 169/401 (42%), Gaps = 113/401 (28%)

Query: 41  RFFPGAEGMSLAAGSMPPVPQTPFDPTYGASLLPSHMLMGSPFLSTP--------LRPQA 92
           ++F   +        +P  P TPFD  YGA+LLPSH+LMGSP++STP         + Q 
Sbjct: 64  QYFATTQQAYYIPSPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSSQQQSQM 123

Query: 93  HFHPSTPG--------XXXXXXXXXXXXXXXFLYYPQPPMLKPIPPRRKKSVTLNH--SE 142
             +  +P                        F         +  P  R   V  N    +
Sbjct: 124 FLYSQSPAGTPNRKSFSQLNSMLNQPSSRSNFFTDSYNNRYQNNPQTRIPEVDPNELFQK 183

Query: 143 PYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLM---DD-- 197
           P+ I++K+LP G D Y TRSLL +N+     +D+H+F+  FV++  +ESIYL+   DD  
Sbjct: 184 PFVISYKLLPTGDDAYRTRSLLFSNV--ASSIDLHSFIYDFVQYSSIESIYLISNTDDEK 241

Query: 198 ---------NHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVCQD------ 242
                      SILLSFL++  CL FYNN+LQR +EFKT L S  L+++FV  +      
Sbjct: 242 DQDNENDKNKRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYLEKTD 301

Query: 243 ----------------------ESSWFKY---------LQMNVVTRGATRSLTVEFEDSV 271
                                  ++ F Y         L+ +++   ATR + +E +   
Sbjct: 302 DGSTANISNNQLNQIQENENDVNTNEFDYRNSMNTVNALKFDLINPDATRFIMIELKTKC 361

Query: 272 KELNEDFVRLKFPWLFCSQ---RFVLERIDLIN---------------ATTVNQH----- 308
            +  E  +     +L  ++   R++LE IDL N               A   N++     
Sbjct: 362 DK--ETLLNKHLSFLIDNKKNIRYILESIDLFNIIENENSSENKSIIEAKNENENSPQGK 419

Query: 309 -----------------FGTRYMILHFISISMALEVDDFLQ 332
                            F   Y +L FI+I MA+E+ D+L+
Sbjct: 420 EKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLK 460

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 28/46 (60%), Gaps = 3/46 (6%)

Query: 991  AKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYD 1036
             K  + I G DVM+QYL QL HSTF+YA NILG +        YYD
Sbjct: 1151 GKQQRVIPGADVMAQYLTQLQHSTFMYAANILGVSAED---NTYYD 1193

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
           Anc_8.844 YML117W
          Length = 1039

 Score =  342 bits (876), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 169/366 (46%), Positives = 242/366 (66%), Gaps = 32/366 (8%)

Query: 525 YFMDPMVGAPIGQTLQRQYLAGASQAN----GINNRTVYIGNIHPRSKPEDICNVVRGGI 580
           ++ + +   P+ QTLQ Q+   A  A+    G+ NRT++IGNI+PRSK EDICNV RGGI
Sbjct: 585 HYNNQLYNVPLPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGI 644

Query: 581 LQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALA 640
           +Q +K+I  K ICFV FI+  AA QFYAN+ ++PI+LH N L++GWG   G LPK I LA
Sbjct: 645 IQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELA 704

Query: 641 VTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLE 700
           VT GASRNVYVSLPE++FK+KYIN+P +K YH KY LP+E+QLR+DF+K+G++EQIN+L+
Sbjct: 705 VTAGASRNVYVSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLK 764

Query: 701 DGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNL 760
           D HCCW+NF NI  AI+LVE   +    N   FH ++  RYK LIIGYGKDRCGNVNK+L
Sbjct: 765 DKHCCWINFTNIRSAIKLVELVKNEDNNN---FHERYKNRYKGLIIGYGKDRCGNVNKSL 821

Query: 761 AANKNSRFYKKIKKQSYSMK--QGKQPRKEDGIVNSDDLTKNNEVLPGVQMNSSKNGGVG 818
            +NKNSR+++K+KK SY+++  Q ++ RK +  +   D  + N  L  + + +S N  + 
Sbjct: 822 VSNKNSRYFRKVKKPSYNIRLQQLEEERKRNDEIKQIDNKRIN--LDSLGITTSPNQNIQ 879

Query: 819 ESQSLVGDQELAEGLGISLTSAQISPDTGHTHHYSXXXXXXXXXXXXXXXYSTSGSSDID 878
           E ++L            SL   +++ DTG  +  +                +++ S+D++
Sbjct: 880 EDETL------------SLAKLKLTSDTGFKNSENESDIDDS---------ASNSSTDVE 918

Query: 879 IIVAPP 884
           +I+  P
Sbjct: 919 LIINSP 924

 Score =  161 bits (407), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 121/436 (27%), Positives = 203/436 (46%), Gaps = 76/436 (17%)

Query: 64  FDPTYGASLLPSHMLMGSPFLSTPLRPQAHFHPSTPGXXXXXXXXXXXXXXXFLYYPQPP 123
           FD  YG +LLPSH+LM SPF+STP +    F  S P                 + +P PP
Sbjct: 112 FDYAYGTTLLPSHILMNSPFVSTPNKSYLSFQAS-PSRGISYNRRNSNQ----MVFPNPP 166

Query: 124 MLKP---IPPRRKKSVTLNHSE--------------------PYHINFKILPKGKDEYMT 160
           ++     +  + +++ + N+ +                     Y I+++ILPKG D Y T
Sbjct: 167 IITSPHLVGDKSERAKSDNYEKVDTLDDEKRNREVFEEESAIAYKISYQILPKGDDTYHT 226

Query: 161 RSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLM-------DDNHSILLSFLTKATCLD 213
           RSLL  N+     +D+H F+  FV +G +ES+Y++       +   SILLSF +++ CLD
Sbjct: 227 RSLLFENIN--ESIDLHTFIEKFVNYGLIESVYVVPSYETHQNSVKSILLSFTSRSICLD 284

Query: 214 FYNNLLQRFSEFKTKLHSPKLSVSFV--C-----------------QDESSWFK---YLQ 251
           FYN++LQ+ SE+KT+L+S  L +SFV  C                 Q   + F+    +Q
Sbjct: 285 FYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNNINKGNGKISVESQKNETDFELTSLIQ 344

Query: 252 MNVVTRGATRSLTVEFEDSVKELNEDFVRLKFPWLF--CSQRFVLERIDLINATTVNQHF 309
             V   GATRSL +EF+  V ++ +DF+    P+L    ++R+++E + ++N    +  F
Sbjct: 345 YQVANFGATRSLCIEFDKRVDKI-DDFIETYLPFLSSNANKRYIIESLYIVNNNGKDNEF 403

Query: 310 GTRYMILHFISISMALEVDDFLQQPSQKRQL------NISRIQFVNVNGHHSKLSDEEAA 363
              Y+IL F++ISM +EV  +++  +  + +      +  R +    N +   LS +  +
Sbjct: 404 PAHYVILSFLNISMVIEVLHYIRSKNLSKTIKNCLYVSFDRTKHAVSNSNRQSLSKKGTS 463

Query: 364 AAANG------LQQDXXXXXXXXXXXXXXNTADLAALFHXXXXXXXXXXXQVVPSEYPTP 417
              N       +  +              N  ++A                +  S Y  P
Sbjct: 464 DTLNTYTLESPINHNTEVDMNDIPSIYDENEIEIANKLSELEIQTHTFNLDI--SNYSNP 521

Query: 418 LIEQHSEHLTSITISR 433
            IE  +EHL +++ISR
Sbjct: 522 HIEIRAEHLPNVSISR 537

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 38/57 (66%), Gaps = 3/57 (5%)

Query: 982  NYKSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYDSN 1038
            N +S R R+    K I G DVMSQYL Q+ HSTF+YA N+L A +++EP   +YD N
Sbjct: 979  NPRSERTRKRTHKKIIPGSDVMSQYLAQVQHSTFMYAANVLNA-SIEEP--EFYDEN 1032

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
           Anc_8.844 YML117W
          Length = 1053

 Score =  342 bits (876), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 203/497 (40%), Positives = 274/497 (55%), Gaps = 52/497 (10%)

Query: 413 EYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVSSSLSGVLFMND 472
           +YP PL EQ SEH   I  S P     P              G    +S+  +   F ND
Sbjct: 469 DYPEPLFEQFSEHSNGIVQSLPVPQTRPI------------GGPQSSISTPRAFGAFPND 516

Query: 473 PSSSGSTPM-IVPSELNLNTPV---------XXXXXXXXXXXXXXXXXSLHNPSDGNGGS 522
               GS P   +P +LN +  V                          S     D  GG 
Sbjct: 517 ---IGSPPASFLPLDLNHSNSVPNLPPGFIPATPSGPMSPQQQQLFLNSQRQQRDHAGGK 573

Query: 523 PSYFMDPMVGAPIGQTLQRQYLAGASQANGI----NNRTVYIGNIHPRSKPEDICNVVRG 578
                      PI  +L+ Q       A  +    NNRT+YIGNI+PRS+ EDICNVVRG
Sbjct: 574 --------FAHPITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRG 625

Query: 579 GILQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIA 638
           GILQ IK+I +K ICF+TFIE +AAVQFYANA ++PIVLHGN L++GWG  +G LPK IA
Sbjct: 626 GILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIA 685

Query: 639 LAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINY 698
           LAVTIGASRNVY+SLPE +FK+KYI +P+FK+YH  +KLP +E LR+DF  YG +EQIN 
Sbjct: 686 LAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINM 745

Query: 699 LEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNK 758
           L D HCCWVNFMNI+ AIRLVED+++      + F+  FD RY+ L+I YGKDRCGN+N+
Sbjct: 746 LNDSHCCWVNFMNISSAIRLVEDAST----KQDHFNQLFDHRYEGLVINYGKDRCGNINR 801

Query: 759 NLAANKNSRFYKKIKKQSYSMKQGKQPRKEDGIVNSDDLTKNNEVLPGV--QMNSSKNGG 816
           NL A K S+++KK+KK +  ++  +   K     N D   +  E++ G   + N      
Sbjct: 802 NLVAGKTSKYHKKVKKHTRDVRLSQLEEKRR---NQD--AERREMVNGTIPEENPFDAFA 856

Query: 817 VGESQSLVGDQELAEGLGISL----TSAQISPDTGHTHHYSXXXXXXXXXXXXXXXYSTS 872
           +    +   D+   + LGIS+    +++ ISP  G    ++                ++ 
Sbjct: 857 INTGSAEKKDELSLDSLGISIMEVESASPISPVMGDLEDHTNGSYTDAGIAPLNYTNNSG 916

Query: 873 GSSDIDIIVAPPDEFKR 889
            SSDI++I+ PP++  R
Sbjct: 917 SSSDIELIINPPNDPNR 933

 Score =  166 bits (421), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 110/315 (34%), Positives = 163/315 (51%), Gaps = 45/315 (14%)

Query: 62  TPFDPTYGASLLPSHMLMGSPFLSTPLRPQAHFHPSTPGXXXXXXXXXXXXXXXFLYYPQ 121
           TPFD  YGA+LLPSH+LMGSPF+STP  PQ ++     G                 YY  
Sbjct: 92  TPFDTAYGATLLPSHLLMGSPFVSTPNLPQTNYTAQRKGSHTGMANGTGSMN----YYRT 147

Query: 122 PPMLKPIPPRRKKSVTLNHSEPYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLN 181
            P +          +      P+ I++KILPKG D Y TRSLLL N++ +  +D+H F++
Sbjct: 148 DPQI----------INGLFQIPFEISYKILPKGDDLYRTRSLLLGNIDDM--VDLHTFVS 195

Query: 182 SFVKFGPVESIYLMD-----DNHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSV 236
            FV+   VES+Y+       + +  LLSFL+   CL+FYNN+LQR  EFK +L +  L +
Sbjct: 196 KFVQNNSVESVYITKEGQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLEL 255

Query: 237 SFV-----------------CQDESSWFKYLQMNVVTR-GATRSLTVEFEDSVKELNEDF 278
           SFV                   D+      L  ++  + GATRS+ +EF D    L  D 
Sbjct: 256 SFVSMRQRPTKVEGKIYRRFAADDGDGMANLHFDMAAQTGATRSIAIEFVDKDVILTRDE 315

Query: 279 V---RLKFPWLFCSQRFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQQPS 335
           +   +LKF     + R++LE I +       + FG  Y I+ F+SI MA+E+ D+L+   
Sbjct: 316 LLNKKLKF-LSEGNNRYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEIMDYLKL-- 372

Query: 336 QKRQLNISRIQFVNV 350
             +QL++++  +V V
Sbjct: 373 NIKQLHLTKFFYVQV 387

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (75%), Gaps = 1/41 (2%)

Query: 986  RRRRQ-AKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGAT 1025
            R R+Q  + ++ I G DVM+QYL QL HSTF+YA N+LGA+
Sbjct: 1003 RHRQQLPRNARTIPGSDVMAQYLAQLQHSTFMYAANVLGAS 1043

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  338 bits (866), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 156/262 (59%), Positives = 202/262 (77%), Gaps = 9/262 (3%)

Query: 534 PIGQTLQRQYLAGASQANGIN----NRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISS 589
           PI +TL++     +   N +     NRT+YIGNI+ RSK EDICNVVRGGILQ +K+I  
Sbjct: 595 PISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEH 654

Query: 590 KRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNV 649
           K ICF+TFIE +AA+ FYAN+ ++PIVLH + L++GWG     LPK +ALAVT+GASRNV
Sbjct: 655 KHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNV 714

Query: 650 YVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNF 709
           YVSLPE++FK+K+IN+PE++ YH KYKLP  +QLR DF+KYG +EQINYL+D HCCWVNF
Sbjct: 715 YVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNF 774

Query: 710 MNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSRFY 769
           +NI+ AIRLVED+++P+E    KF  +F+ RY  LII YGKDRCGNVNK+L +NKNSRFY
Sbjct: 775 LNISAAIRLVEDAHNPVES---KFSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFY 831

Query: 770 KKIKKQS--YSMKQGKQPRKED 789
           KK+K  S    +K+ ++ RK D
Sbjct: 832 KKVKSISNNVKLKELEEKRKAD 853

 Score =  180 bits (456), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 116/318 (36%), Positives = 162/318 (50%), Gaps = 43/318 (13%)

Query: 56  MPPVPQTPFDPTYGASLLPSHMLMGSPFLSTPLRPQAHFHPSTPGXXXXXXXXXXXXXXX 115
           +P VP TPFD  YGA+LLPSH+LMGSPF++TP    +                       
Sbjct: 75  LPNVPPTPFDTAYGATLLPSHLLMGSPFVATPTTGHSQSAIFQQPYMMTPNRASFSQIPS 134

Query: 116 FLYYPQPPMLKP-----IPPRRKKSVTLNHSE---------PYHINFKILPKGKDEYMTR 161
            L    PP  +       P RR+ S      E         P+ +++KILP G D Y TR
Sbjct: 135 MLNVGNPPSARRQGNQNDPNRRRSSYRSKVPETDPKTLFLQPFRMSYKILPSGDDAYRTR 194

Query: 162 SLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLM--------DDN---HSILLSFLTKAT 210
           SLL  N+  +  +++H F+  FV+F P+ES+YL+        DD+    SILLSFLT+  
Sbjct: 195 SLLFENV--VNSIELHTFMTEFVRFSPIESVYLINHHDSDKPDDDTECRSILLSFLTREV 252

Query: 211 CLDFYNNLLQRFSEFKTKLHSPKLSVSFV--------------CQDESSWF--KYLQMNV 254
           CL FYNN+LQR  EFK KL S  L +SFV                DE S++  + +   +
Sbjct: 253 CLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQDENEEEETNIVDEPSFYTKESVYFEL 312

Query: 255 VTRGATRSLTVEFEDSVKELNEDFVRLKFPWLFCSQRFVLERIDLINATTVNQHFGTRYM 314
               ATRS+ ++F++   E      +LKF     + R++LE IDL+N T     F   Y 
Sbjct: 313 SNPQATRSILIQFKNPCSEQELFDKKLKFLNQENNSRYILESIDLVNVTQTENEFPKHYA 372

Query: 315 ILHFISISMALEVDDFLQ 332
           IL FI+I MA+E+ D+L+
Sbjct: 373 ILTFINILMAMEICDYLK 390

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/45 (57%), Positives = 31/45 (68%), Gaps = 3/45 (6%)

Query: 992  KFSKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYD 1036
            K ++ I G DVM+QYL QL HSTF+YA NILGA+      G YYD
Sbjct: 1036 KEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAED---GSYYD 1077

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  176 bits (446), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 129/206 (62%), Gaps = 24/206 (11%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRTVY+GN+    K E+ICN VRGG+LQ++K +S + +CFVTFI+  AA QFYA +
Sbjct: 396 NNLGNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMS 455

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKL 670
           SL  + +H    ++GWG+ SG LP  +ALAV+ GASRN+YV   +++            +
Sbjct: 456 SLHGLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDFN-----------AI 504

Query: 671 YHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNL 730
                 + TE+ LR+ F ++G+VEQIN+L + +CC++NF NI++AI  ++          
Sbjct: 505 DETGETIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAID---------- 554

Query: 731 EKFHAQFDGRYKNLIIGYGKDRCGNV 756
                + +  +KNL + +GKDRCGNV
Sbjct: 555 ---KIKCNPYFKNLKVNFGKDRCGNV 577

 Score =  104 bits (260), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 111/206 (53%), Gaps = 23/206 (11%)

Query: 556 RTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPI 615
           RTVY+GNI P    + + + VR G+++ +K +  +   F++F++ ++A+ F+++A L+ +
Sbjct: 161 RTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAILKRL 220

Query: 616 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHG-- 673
            + G  ++VGWG+P+   P   A   + GA+RNVY+         +   +P+     G  
Sbjct: 221 NIEGRDIKVGWGKPTPIDPIVAAGIASDGATRNVYIG--------RLNTDPQLAPQFGTD 272

Query: 674 -KYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEK 732
              ++ +EE+LR+D   +G++E I  + D    +V+F +I  AI++V         NL  
Sbjct: 273 PNEEIVSEEKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVS--------NL-- 322

Query: 733 FHAQFDGRYKNLIIGYGKDRCGNVNK 758
             A  +  Y N  I YGKDRC  + K
Sbjct: 323 --ASVNPYYTNKKIFYGKDRCAFITK 346

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  177 bits (448), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 133/206 (64%), Gaps = 24/206 (11%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRTVY+GN+    K E+ICNVVRGG+LQ++K +S + +CFVTFI+  AA QFYA +
Sbjct: 443 NNLGNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLSDRYVCFVTFIDPTAAAQFYAMS 502

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKL 670
           SL  + +     +VGWG+ SG LP  +ALAV+ GASRNVY+     +F++  + +P    
Sbjct: 503 SLHGLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIG--NINFEKDAMRDP---- 556

Query: 671 YHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNL 730
                ++ TE+ LR+ F +YG+VEQIN+L + +CC++NF NI++AI  ++   S      
Sbjct: 557 -----RIFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILALDKIKS------ 605

Query: 731 EKFHAQFDGRYKNLIIGYGKDRCGNV 756
                  +  +++L I +GKDRCGNV
Sbjct: 606 -------NPHFEDLKINFGKDRCGNV 624

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 104/203 (51%), Gaps = 23/203 (11%)

Query: 556 RTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPI 615
           RTVY+GNI      +++ + VR G+++ +K I  K   F++F++ ++A+ F+++A L+ +
Sbjct: 214 RTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAILKRL 273

Query: 616 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKY 675
            + G  +++GWG+P+   P   A  +   A+RNV++     +  +     P         
Sbjct: 274 NIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFIGHLNKTDNDSCTKEPI-------- 325

Query: 676 KLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHA 735
              TE +LR+D   +G++E +  + +    +V+F +I  AI+ V +  S           
Sbjct: 326 ---TEAKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNLRS----------- 371

Query: 736 QFDGRYKNLIIGYGKDRCGNVNK 758
             +  Y+N  I YGKDRC  + K
Sbjct: 372 -MNPYYENKKIAYGKDRCAFITK 393

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  174 bits (441), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/206 (42%), Positives = 125/206 (60%), Gaps = 28/206 (13%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRT+Y+GN+    K E+ICNVVRGG+LQ IK +S +  CF+TFI+  AA QFYA +
Sbjct: 351 NNLGNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMS 410

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKL 670
           SL  + +  N  +VGWG+ SG L   +ALA++ GASRN+Y+   ++  K +Y N      
Sbjct: 411 SLHGLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYFN------ 464

Query: 671 YHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNL 730
                    EE LR+ F ++G+VEQIN+L +  CC+VNF NI HAI  ++   S  E   
Sbjct: 465 ---------EEHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKIKSLPE--- 512

Query: 731 EKFHAQFDGRYKNLIIGYGKDRCGNV 756
                     +++L I +GKDRCGN+
Sbjct: 513 ----------FEDLKINFGKDRCGNI 528

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 114/204 (55%), Gaps = 31/204 (15%)

Query: 556 RTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPI 615
           RTVY+GNI      +++ + VR G+++++K + +K   F++FI+   A+ F+++A L+ +
Sbjct: 128 RTVYLGNIPQGLTIKELLDHVRSGVVESVKILPTKLCAFISFIDERGALLFHSDAILKRL 187

Query: 616 VLHGNILRVGWGQPSGELPKNIALAVT-IGASRNVYVSLPEYSFKEKYINNPEFKLYHGK 674
            + G  +++GWG+ S  +   +A  +T  GA+RNVY+         +  ++P        
Sbjct: 188 NIRGKDIKIGWGK-SNHIDSIVAARITNDGATRNVYIG--------QLNDDP-------- 230

Query: 675 YKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFH 734
             + TE++L +D  K+G+++ I +L +    +V+F +I+ AI +V+        NL K +
Sbjct: 231 -TITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQ--------NLSKLN 281

Query: 735 AQFDGRYKNLIIGYGKDRCGNVNK 758
                +YKN  I YGKDRC  + K
Sbjct: 282 E----KYKNKRIFYGKDRCAFITK 301

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  171 bits (434), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 128/206 (62%), Gaps = 24/206 (11%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRTVY+GN+    K E+ICN VR G+LQ++K +S + +CFVTFI+  AA QFYA +
Sbjct: 404 NNLGNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMS 463

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKL 670
           SL  ++L     +VGWG+ SG LP  IALAV+ GASRNVY+      F+E    N     
Sbjct: 464 SLHGLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIG--NIDFEEDSKRNE---- 517

Query: 671 YHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNL 730
                ++ TE+ LR+ F +YG+VEQIN+L   +CC++N+ NI++AI  ++   S      
Sbjct: 518 -----RVFTEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKIKS------ 566

Query: 731 EKFHAQFDGRYKNLIIGYGKDRCGNV 756
                  +  +K+L I +GKDRCGN+
Sbjct: 567 -------NPYFKDLKINFGKDRCGNI 585

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 112/204 (54%), Gaps = 19/204 (9%)

Query: 556 RTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPI 615
           RTVY+GNI      +++ + VR G+++ +K +  K   F++F++ ++A+ F+++A L+ +
Sbjct: 169 RTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAILKRL 228

Query: 616 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVS-LPEYSFKEKYINNPEFKLYHGK 674
            + G  +++GWG+P+   P       T GA+RNVY+  L   +   + +N P+      +
Sbjct: 229 NIEGRDIKIGWGKPTKIDPIVANGITTDGATRNVYIGQLYTDAEVAESLNIPK------E 282

Query: 675 YKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFH 734
            ++ TEE+L  D   YG ++ +  +++    +++F +I  AI++V         NL    
Sbjct: 283 SEIVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVV--------NNL---- 330

Query: 735 AQFDGRYKNLIIGYGKDRCGNVNK 758
           A  +  Y+N  I YGKDRC  + K
Sbjct: 331 AASNRYYQNRKIFYGKDRCAFITK 354

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  173 bits (438), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 127/206 (61%), Gaps = 23/206 (11%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRTVY+GN+    K ++ICN VRGG+LQ IK ++ + +CFVTFI+  AA QFYA +
Sbjct: 523 NNLGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLTDRHVCFVTFIDPTAAAQFYAMS 582

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKL 670
           SL  + +     +VGWG+ SG LP  IALAV+ GASRNVY+   ++    K  N P F  
Sbjct: 583 SLHGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRNVYLGNIDFENDIKLHNPPIF-- 640

Query: 671 YHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNL 730
                   TE  LR  F +YG VEQIN+L + +CC++NF NI++AI  +E     I+ N 
Sbjct: 641 --------TELSLRNIFQQYGDVEQINFLPEKNCCFINFTNISNAILAIEK----IKNNP 688

Query: 731 EKFHAQFDGRYKNLIIGYGKDRCGNV 756
           +         +K+L I +GKDRCGN+
Sbjct: 689 D---------FKDLKINFGKDRCGNI 705

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 75/267 (28%), Positives = 128/267 (47%), Gaps = 36/267 (13%)

Query: 515 PSDGNGGS----PSYFMDPMVGAPIGQ---TLQRQYLAGASQANGINNRTVYIGNIHPRS 567
           P D NG +    P Y M  +  A I     ++Q   L   +      +RTVY+GNI    
Sbjct: 220 PFDNNGDNMRDEPPYMMASVAAATIANPNTSIQTSTLPNNNTFGNTPSRTVYLGNIPSDL 279

Query: 568 KPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWG 627
             +D+ + VR G+++ IK +  K   F++F++ ++A+ F+++A L+ + + G  +++GWG
Sbjct: 280 SVKDLLDHVRSGVVENIKILPDKMCAFISFVDESSALLFHSDAILKRLNIGGRDIKIGWG 339

Query: 628 QPSGELPKNIALAVTIGASRNVYVS----------------LPEYSFKEKYINNPEFKLY 671
           +P+   P      VT GA+RNVY+                     S      ++ E K  
Sbjct: 340 KPTPIDPIVATSIVTDGATRNVYIGQLSNSSNNNTSSSSSSTSPSSPSNNTSDDLEKKKN 399

Query: 672 HGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLE 731
                L TEE+LR+D   YG+++ +  ++D    +V+  +I  AI++V +          
Sbjct: 400 IDDSPL-TEEKLREDLKDYGEIDCVKIVQDKGFAFVHMSSILSAIKVVNNL--------- 449

Query: 732 KFHAQFDGRYKNLIIGYGKDRCGNVNK 758
              AQ +  Y+N  I YGKDRC  + K
Sbjct: 450 ---AQTNPYYQNKRIFYGKDRCAFITK 473

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  171 bits (432), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 130/208 (62%), Gaps = 28/208 (13%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRT+Y+GN+    K E+ICNVVRGG+LQ+IK ++ + +CFVTFI+  AA Q YA A
Sbjct: 381 NNLGNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMA 440

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKL 670
           SL  + +H    ++GWG+ SG L   +ALAV+ GASRN+            Y+ N +FK 
Sbjct: 441 SLHGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNI------------YLGNIDFKA 488

Query: 671 -YHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVED-SNSPIEK 728
               ++ + TE+ LR  F ++G+VEQIN+L + +CC+VNF NI++AI  ++   N+P   
Sbjct: 489 DSETEHPIFTEQNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKIKNNP--- 545

Query: 729 NLEKFHAQFDGRYKNLIIGYGKDRCGNV 756
                      ++ +L I +GKDRCGNV
Sbjct: 546 -----------QFSDLKINFGKDRCGNV 562

 Score =  103 bits (258), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 110/205 (53%), Gaps = 21/205 (10%)

Query: 556 RTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPI 615
           RTVY+GNI P  +   + + VR G+++ I+ +  K   F++F++ ++A+ F+++A L+ +
Sbjct: 146 RTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAILKRL 205

Query: 616 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSL--PEYSFKEKYINNPEFKLYHG 673
            + G  +++GWG+P+   P   +     GA+RNVY+     + SF  +   +P       
Sbjct: 206 NIDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADP------- 258

Query: 674 KYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKF 733
           + ++ TE++LR D + YG++E +  + +    +V+F +I  AI++V              
Sbjct: 259 RDEVVTEQKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSL----------- 307

Query: 734 HAQFDGRYKNLIIGYGKDRCGNVNK 758
            A  +  Y N  I YGKDRC  + K
Sbjct: 308 -AAVNPYYANKKIFYGKDRCAFITK 331

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  169 bits (427), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 86/206 (41%), Positives = 127/206 (61%), Gaps = 24/206 (11%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRT+Y+GN+    K E+ICN VRGG+LQ IK +S + +CFVTFI+  AA QFYA +
Sbjct: 337 NNLGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMS 396

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKL 670
           SL  + +H    ++GWG+ SG LP  +ALAV+ GASRN+Y+   +++  +K         
Sbjct: 397 SLHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFAADKK--------- 447

Query: 671 YHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNL 730
              ++ + TE  LR  F ++G+VEQIN+L + +CC++NF NI+ AI  ++   S      
Sbjct: 448 --SQHPIFTEAALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSI----- 500

Query: 731 EKFHAQFDGRYKNLIIGYGKDRCGNV 756
                     +K+L I +GKDRCGNV
Sbjct: 501 --------PTFKDLKINFGKDRCGNV 518

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/207 (28%), Positives = 110/207 (53%), Gaps = 23/207 (11%)

Query: 555 NRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEP 614
           +RTVY+GN+ P    +++ + VR G+++ +K +  K   F++F+E  +A+ F+++A L+ 
Sbjct: 102 SRTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAILKR 161

Query: 615 IVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHG- 673
           + +    +++GWG+P+   P   A     GA+RNVY+         K   N +     G 
Sbjct: 162 LNIDDRDIKIGWGKPTQIDPIVAAGITNDGATRNVYIG--------KLNTNKDICAQWGV 213

Query: 674 --KYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLE 731
               ++ TEE+LR D + +G+VE +  + +    +V+F +I  AI++V +       N+ 
Sbjct: 214 DPNEEVITEEKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANL-----ANIN 268

Query: 732 KFHAQFDGRYKNLIIGYGKDRCGNVNK 758
            ++AQ         I YGKDRC  + K
Sbjct: 269 PYYAQKK-------IFYGKDRCAFITK 288

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  169 bits (429), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 128/208 (61%), Gaps = 28/208 (13%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRT+Y+GN+    K E+ICN VRGG+LQ+IK ++ + +CFVTFI+  AA Q YA  
Sbjct: 383 NNLGNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMT 442

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKL 670
           SL  + +H    ++GWG+ SG L   +ALAV+ GASRN+            Y+ N +FK 
Sbjct: 443 SLHGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNI------------YLGNIDFKA 490

Query: 671 YHGKYKLP--TEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEK 728
              +  +P  TE+ LR+ F +YG+VEQIN+L +  CC+VNF NI++AI  ++   S    
Sbjct: 491 -DSERDVPVFTEQNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKIKS---- 545

Query: 729 NLEKFHAQFDGRYKNLIIGYGKDRCGNV 756
                    + ++K+L I +GKDRCGNV
Sbjct: 546 ---------NEQFKDLKINFGKDRCGNV 564

 Score =  102 bits (253), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 109/206 (52%), Gaps = 21/206 (10%)

Query: 555 NRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEP 614
           +RTVY+GNI P  +  ++ + VR G+++ ++ +  K   F++F++ ++A+ F+++A L+ 
Sbjct: 147 SRTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAILKR 206

Query: 615 IVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSL--PEYSFKEKYINNPEFKLYH 672
           + + G  ++VGWG+P+   P   A     GA+RNVY+     +     ++  +P      
Sbjct: 207 LNIGGRDIKVGWGKPTPIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADP------ 260

Query: 673 GKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEK 732
            +  + TEE+LR D   YG++E +  + +    +V+F +I  AI++V             
Sbjct: 261 -RDLIATEEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSL---------- 309

Query: 733 FHAQFDGRYKNLIIGYGKDRCGNVNK 758
             A  +  Y N  I YGKDRC  V K
Sbjct: 310 --ATVNPYYSNKKIFYGKDRCAFVTK 333

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  169 bits (427), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 128/206 (62%), Gaps = 24/206 (11%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRT+Y+GN+    K E+ICN VRGG+LQ IK ++ + +CFVTFI+  AA QFYA +
Sbjct: 390 NNLGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMS 449

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKL 670
           SL  + +H    ++GWG+ SG LP  +ALAV+ GASRN+Y+   ++   ++ +  P F  
Sbjct: 450 SLHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFE-DDRKLEQPIF-- 506

Query: 671 YHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNL 730
                   TE  LR  F ++G+VEQIN+L + +CC++NF NI+ AI  ++       K++
Sbjct: 507 --------TETSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKI-----KSI 553

Query: 731 EKFHAQFDGRYKNLIIGYGKDRCGNV 756
             F        K+L I +GKDRCGNV
Sbjct: 554 PTF--------KDLKINFGKDRCGNV 571

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 107/206 (51%), Gaps = 23/206 (11%)

Query: 556 RTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPI 615
           RTVY+GN+ P     ++ + VR G+++ +K +  K   F++F++  +A+ F+++A L+ +
Sbjct: 156 RTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAILKRL 215

Query: 616 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHG-- 673
            +    +++GWG+P+   P   A     GA+RNVY+         K   NP+     G  
Sbjct: 216 NIDDRDIKIGWGKPTQIDPIVAAGINNDGATRNVYLG--------KLNTNPKMCAQWGAD 267

Query: 674 -KYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEK 732
              +  TEE+LR D   +G+VE +  + +    +V+F +I  AI++V +       N+  
Sbjct: 268 PNEETITEEKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVVANL-----ANVNP 322

Query: 733 FHAQFDGRYKNLIIGYGKDRCGNVNK 758
           ++AQ         I YGKDRC  + K
Sbjct: 323 YYAQKK-------IFYGKDRCAFITK 341

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  169 bits (429), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 124/206 (60%), Gaps = 24/206 (11%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRTVY+GN+    K E+ICNVVRGG+LQ +K +S + +CFVTFI+  AA QFYA +
Sbjct: 446 NNLGNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMS 505

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKL 670
           SL  I +     RVGWG+  G L   +ALAV+ GASRNVYV    +    K   +P F  
Sbjct: 506 SLHGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFDEDSKR-EDPIF-- 562

Query: 671 YHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNL 730
                   TE  LR  F ++G+VEQINYL + +CC+VN+ NI++AI  ++          
Sbjct: 563 --------TESSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKI-------- 606

Query: 731 EKFHAQFDGRYKNLIIGYGKDRCGNV 756
            K H  F    K+L I +GKDRCGNV
Sbjct: 607 -KGHPVF----KDLKINFGKDRCGNV 627

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 113/212 (53%), Gaps = 24/212 (11%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N   ++TVY+GN       +++ + VR G+++ ++ +  K   FV+F++ +AA+ F+++A
Sbjct: 205 NNAPSKTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDA 264

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYV----SLPEYSFKEKYINNP 666
            L+ + + G  +++GWG+P+   P          A+RNVY+    + P+ S +   ++  
Sbjct: 265 ILKRLHIDGRDIKIGWGKPTPIDPVVATAVANDNATRNVYIGQLNTGPKLSSQVSPVDVT 324

Query: 667 EFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPI 726
           E         + TE++LR D  ++G+++ I  +E+    +V+F +I +AI+ V       
Sbjct: 325 E--------PVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAV------- 369

Query: 727 EKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNK 758
             NL    A  +  Y+N  I YGKDRC  + K
Sbjct: 370 -ANL----ANINPYYRNKKIFYGKDRCAFITK 396

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 46/99 (46%), Gaps = 10/99 (10%)

Query: 652 SLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMN 711
           S+P+      + N P   +Y G   +    +   D  + G VE +  L D  C +V+F++
Sbjct: 194 SIPQLGSNRNFNNAPSKTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVD 253

Query: 712 IAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGK 750
            + A+    D+       L++ H   DGR  ++ IG+GK
Sbjct: 254 ESAALLFHSDA------ILKRLH--IDGR--DIKIGWGK 282

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  168 bits (425), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 91/207 (43%), Positives = 127/207 (61%), Gaps = 26/207 (12%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRTVY+GN+    K E+ICNVVRGGILQ IK +S + +CFVTFI+  AA QFYA +
Sbjct: 398 NNLGNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMS 457

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKL 670
           SL  I +     RVGWG+  G LP  IALAV+ GASRNVY+   ++ +++     P F  
Sbjct: 458 SLHGITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-YEDSKRQEPIF-- 514

Query: 671 YHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNS-PIEKN 729
                   T + LR+ F +YG+VEQ+N+L + +C +VN+ NI++AI  ++   S P+   
Sbjct: 515 --------TADYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKIKSNPL--- 563

Query: 730 LEKFHAQFDGRYKNLIIGYGKDRCGNV 756
                      +KNL I +GKDRCG +
Sbjct: 564 -----------FKNLKINFGKDRCGTI 579

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 110/206 (53%), Gaps = 23/206 (11%)

Query: 556 RTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPI 615
           +TVY+GNI P     ++ + VR G+++ +K +  K   F+TF++ +AA+ F+++A L+ +
Sbjct: 163 KTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAILKRL 222

Query: 616 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHG-- 673
            + G  +++GWG+ +   P       + GA+RNVY+ L           + +  L  G  
Sbjct: 223 HIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLN--------TDSDIALQVGAD 274

Query: 674 -KYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEK 732
              +  TEE+LR D  ++G+++ +  +E+    +++F +I  A+++V         NL  
Sbjct: 275 PNDEKITEEKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVV--------ANL-- 324

Query: 733 FHAQFDGRYKNLIIGYGKDRCGNVNK 758
             A  +  Y+N  I YGKDRC  + K
Sbjct: 325 --AGINPYYENKKIYYGKDRCAFITK 348

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  169 bits (429), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 132/207 (63%), Gaps = 26/207 (12%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRT+Y+GN+    + E+ICNVVRGG+LQ++K +  + +CFVTFI+  AA QF+A +
Sbjct: 494 NNLGNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMS 553

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKL 670
           SL  + +     +VGWG+ SG L   +ALAV+ GASRN+Y+   +++  +K  +NP F  
Sbjct: 554 SLHGLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFATDKKR-DNPIF-- 610

Query: 671 YHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNS-PIEKN 729
                   TE+ LR+ F+ YG++EQIN+L + +CC++NF NI++AI  ++   S P+   
Sbjct: 611 --------TEDSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKIKSNPV--- 659

Query: 730 LEKFHAQFDGRYKNLIIGYGKDRCGNV 756
                      +K+L I +GKDRCGN+
Sbjct: 660 -----------FKDLKINFGKDRCGNI 675

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 107/235 (45%), Gaps = 44/235 (18%)

Query: 556 RTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPI 615
           RTVY+GNI      +++ + VR G+++ +K I  K   F++F++  +A+ F+++A L+ +
Sbjct: 222 RTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAFISFLDENSALLFHSDAILKRL 281

Query: 616 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVS-LPEYSF---KEKYINNPEFKLY 671
            ++G  +++GWG+ +   P      +  GA+RNV++  L   SF   K K    P  + +
Sbjct: 282 NINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQLKTKSFDPNKAKVTKMPPSRNH 341

Query: 672 HGKYKLPTEE----------------------------QLRQDFTKYGQVEQINYLEDGH 703
                +  E                             +LR+D   +G ++ I  +ED  
Sbjct: 342 DINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAKLRKDLADFGDIDCIKIVEDKG 401

Query: 704 CCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNK 758
             +++F +I  AI+ V + NS             +  Y    I YGKDRC  + K
Sbjct: 402 IAFIHFASITSAIKCVHNLNS------------MNDYYSTKKIFYGKDRCAFITK 444

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  169 bits (427), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 125/206 (60%), Gaps = 24/206 (11%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRTVY+GN+    K E+ICN +RGG+LQ IK ++ + +CFVTFI+  AA QFYA +
Sbjct: 467 NNLGNRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMS 526

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKL 670
           SL  + +H    ++GWG+ SG LP  IALAV+ GASRN+Y  L   +F+E          
Sbjct: 527 SLHGLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIY--LGNINFEED--------- 575

Query: 671 YHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNL 730
              +  +  E+ LR  F ++G VEQIN+L + +CC++NF NI++AI  ++   S      
Sbjct: 576 AKQEESVFAEDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKIKS------ 629

Query: 731 EKFHAQFDGRYKNLIIGYGKDRCGNV 756
                  +  + NL I +GKDRCGNV
Sbjct: 630 -------NPHFNNLKINFGKDRCGNV 648

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 107/205 (52%), Gaps = 21/205 (10%)

Query: 556 RTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPI 615
           RTVY+GNI      + + + VR G+++ +K +S K   FV+F++   A+ F+++A L+ +
Sbjct: 233 RTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAILKRL 292

Query: 616 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFK--EKYINNPEFKLYHG 673
            + G  +++GWG+P    P   A     GA+RNVY+     +    EK+  +P       
Sbjct: 293 NIDGRDIKIGWGKPQPIDPIVRAGIANDGATRNVYIGKLNTNKDSCEKWGADP------- 345

Query: 674 KYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKF 733
           K  L T+E+L  D +++G++E I  +ED    +V+F +I  AI+ V +  S         
Sbjct: 346 KEILVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAVANIGS--------- 396

Query: 734 HAQFDGRYKNLIIGYGKDRCGNVNK 758
               D  Y N  + YGKDRC  + K
Sbjct: 397 ---IDPYYSNKKVFYGKDRCAFITK 418

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  167 bits (422), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 88/206 (42%), Positives = 126/206 (61%), Gaps = 24/206 (11%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRTVY+G++    K E+ICN VRGG+LQ+IK ++ + +CFVTFI+  AA QFYA +
Sbjct: 410 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 469

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKL 670
           SL    +     +VGWG+ SG LP  +ALAV+ GASRNVYV      F    +N+     
Sbjct: 470 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG--NIDFASDSLNDE---- 523

Query: 671 YHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNL 730
                ++ TE  LR  F +YG+VEQIN+L + +CC++N+ NI++AI  ++   S      
Sbjct: 524 -----RIFTENNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKS------ 572

Query: 731 EKFHAQFDGRYKNLIIGYGKDRCGNV 756
                  +  +K+L I +GKDRCGNV
Sbjct: 573 -------NPYFKDLKINFGKDRCGNV 591

 Score =  108 bits (270), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 67/221 (30%), Positives = 119/221 (53%), Gaps = 33/221 (14%)

Query: 544 LAGASQANGINN------RTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTF 597
           L+  SQAN   N      RTVY+GN+ P    +++ + VR G+++ +K I  K   F++F
Sbjct: 167 LSVNSQANNSLNFTSAPTRTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISF 226

Query: 598 IETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYS 657
           ++ +AA+ F+++A L+ + +    +++GWG+P+   P   A   T GA+RNVY+      
Sbjct: 227 VDESAALLFHSDAILKRLNIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIGRMTVE 286

Query: 658 FKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIR 717
            +E ++               +EEQLR D  +YG+++ I  +++    +++F +I +AI+
Sbjct: 287 GEESHL---------------SEEQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIK 331

Query: 718 LVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNK 758
           +V  +N PI           +  Y+N  I YGKDRC  + K
Sbjct: 332 VV--TNLPIR----------NPYYQNKRIFYGKDRCAFITK 360

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  166 bits (419), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 128/209 (61%), Gaps = 30/209 (14%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRTVY+G++    K E+ICN VRGG+LQ+IK ++ + +CFVTFI+  AA QFYA +
Sbjct: 439 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 498

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEY---SFKEKYINNPE 667
           SL    +     +VGWG+ SG LP  +ALAV+ GASRNVYV   ++   S +++      
Sbjct: 499 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFVSDSLRDE------ 552

Query: 668 FKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIE 727
                   ++ TE  LR  F +YG+VEQIN+L + +CC+VN+ NI++AI  ++   S   
Sbjct: 553 --------RIFTESNLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKIKS--- 601

Query: 728 KNLEKFHAQFDGRYKNLIIGYGKDRCGNV 756
                     +  +K+L I +GKDRCGNV
Sbjct: 602 ----------NPYFKDLKINFGKDRCGNV 620

 Score =  109 bits (273), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 113/203 (55%), Gaps = 27/203 (13%)

Query: 556 RTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPI 615
           RTVY+GN+ P    +++ + VR G+++ +K IS K   F++F++ +AA+ F+++A L+ +
Sbjct: 214 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAILKRL 273

Query: 616 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKY 675
            +    +++GWG+P+   P   A   T GA+RNVY+       +E ++            
Sbjct: 274 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIDGEESHL------------ 321

Query: 676 KLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHA 735
              +EEQLR D  +YG+++ I  +++    +++F +I +AI++V  +N PI         
Sbjct: 322 ---SEEQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVV--TNLPIR-------- 368

Query: 736 QFDGRYKNLIIGYGKDRCGNVNK 758
             +  Y+N  I YGKDRC  + K
Sbjct: 369 --NPYYQNKRIFYGKDRCAFITK 389

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  166 bits (419), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 121/206 (58%), Gaps = 24/206 (11%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRTVY+GN+    K E+ICN VRGG+LQ+IK +  + +CFVTFI+  AA QFYA +
Sbjct: 453 NNLGNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMS 512

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKL 670
           SL    +     +VGWG+ SG LP  +ALAV+ GASRNVY+   ++    K    P F  
Sbjct: 513 SLYGFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFEADSKK-EQPIF-- 569

Query: 671 YHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNL 730
                    E  LR  F +YG+VEQIN+L +  CC++NF NI +AI  ++   S      
Sbjct: 570 --------NETALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKIKS------ 615

Query: 731 EKFHAQFDGRYKNLIIGYGKDRCGNV 756
                  +  +K+L I +GKDRCGNV
Sbjct: 616 -------NPHFKSLKINFGKDRCGNV 634

 Score =  103 bits (258), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 106/203 (52%), Gaps = 23/203 (11%)

Query: 556 RTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPI 615
           RTVY+GNI P    +++ + VR G+++  K +  K   F++F+E ++A+ F+++A L+ +
Sbjct: 224 RTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAILKRL 283

Query: 616 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKY 675
            +    ++VGWG+P+   P   +  +  GA+RNVY+         K    P         
Sbjct: 284 NIDNRDIKVGWGKPTVLDPSIASRIINDGATRNVYIGQGNNDRSSKENKEP--------- 334

Query: 676 KLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHA 735
              TEE+LR+D  +YG+++ I  + +    +V+F +IA AI++V               A
Sbjct: 335 --LTEEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTL------------A 380

Query: 736 QFDGRYKNLIIGYGKDRCGNVNK 758
           Q +  Y+   I YGKDRC  + K
Sbjct: 381 QKNPFYQEKKIFYGKDRCAFITK 403

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  165 bits (417), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 129/209 (61%), Gaps = 30/209 (14%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRTVY+G++    K E+ICN VRGG+LQ+IK ++ + +CFVTFI+  AA QFYA +
Sbjct: 428 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 487

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEY---SFKEKYINNPE 667
           SL    +     +VGWG+ SG LP  +ALAV+ GASRNVYV   +Y   S +++      
Sbjct: 488 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDYVSDSVRDE------ 541

Query: 668 FKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIE 727
                   ++ TE +LR  F +YG+VEQIN+L + +CC++N+ NI++AI  ++   S   
Sbjct: 542 --------RIFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKS--- 590

Query: 728 KNLEKFHAQFDGRYKNLIIGYGKDRCGNV 756
                     +  +K+L I +GKDRCGNV
Sbjct: 591 ----------NPYFKDLKINFGKDRCGNV 609

 Score =  105 bits (263), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 113/203 (55%), Gaps = 27/203 (13%)

Query: 556 RTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPI 615
           RTVY+GN+ P    +++ + VR G+++ +K I  K   F++F++ +AA+ F+++A L+ +
Sbjct: 203 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 262

Query: 616 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKY 675
            +    +++GWG+P+   P   A   T GA+RNVY+       +E ++            
Sbjct: 263 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL------------ 310

Query: 676 KLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHA 735
              + EQLR D  +YG+++ I  +++    +++F +I +AI++V  +N PI +NL     
Sbjct: 311 ---SGEQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVV--TNLPI-RNL----- 359

Query: 736 QFDGRYKNLIIGYGKDRCGNVNK 758
                Y+N  I YGKDRC  + K
Sbjct: 360 ----YYQNKRIFYGKDRCAFITK 378

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  165 bits (417), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 87/209 (41%), Positives = 128/209 (61%), Gaps = 30/209 (14%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRTVY+G++    K E+ICN VRGG+LQ+IK ++ + +CFVTFI+  AA QFYA +
Sbjct: 426 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 485

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEY---SFKEKYINNPE 667
           SL    +     +VGWG+ SG LP  +ALAV+ GASRNVYV   ++   S +++      
Sbjct: 486 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFVGDSLRDE------ 539

Query: 668 FKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIE 727
                   ++ TE  LR  F +YG+VEQIN+L + +CC++N+ NI++AI  ++   S   
Sbjct: 540 --------RVFTESNLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKS--- 588

Query: 728 KNLEKFHAQFDGRYKNLIIGYGKDRCGNV 756
                     +  +K+L I +GKDRCGNV
Sbjct: 589 ----------NPYFKDLKINFGKDRCGNV 607

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 112/203 (55%), Gaps = 27/203 (13%)

Query: 556 RTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPI 615
           RTVY+GN+ P    +++ + VR G+++ +K I  K   FV+FI+ +AA+ F+++A L+ +
Sbjct: 201 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAILKRL 260

Query: 616 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKY 675
            +    +++GWG+P+   P   A   T GA+RNVY+       +E ++            
Sbjct: 261 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL------------ 308

Query: 676 KLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHA 735
              +EEQLR D  +YG+++ I  +++    +++F +I +AI++V  +N PI         
Sbjct: 309 ---SEEQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVV--TNLPIR-------- 355

Query: 736 QFDGRYKNLIIGYGKDRCGNVNK 758
             +  Y+N  I YGKDRC  + K
Sbjct: 356 --NPYYQNKRIFYGKDRCAFITK 376

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  163 bits (412), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/212 (40%), Positives = 126/212 (59%), Gaps = 34/212 (16%)

Query: 550 ANGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYAN 609
           +N + NRTVY+GN+    + EDICN +R G+LQ IK +S + +CFVTFI+  +A QFYA 
Sbjct: 409 SNNLGNRTVYLGNLPNDIRIEDICNTIRCGLLQNIKLLSDRHVCFVTFIDPVSAAQFYAM 468

Query: 610 ASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSF----KEKYINN 665
           +S+   VL     +VGWG+ SG L   + LAV+ GASRNVY+   +++     +E+Y   
Sbjct: 469 SSIYGFVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYIGNIDFTADGTKRERYF-- 526

Query: 666 PEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVED-SNS 724
                        T+  LR+ F++YG+VEQIN+L   +CC+VN+ NI +AI  ++   N+
Sbjct: 527 -------------TDSNLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAIDKIKNN 573

Query: 725 PIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNV 756
           P               +KNL I +GKDRCGN+
Sbjct: 574 PT--------------FKNLKINFGKDRCGNI 591

 Score =  105 bits (262), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 112/207 (54%), Gaps = 18/207 (8%)

Query: 556 RTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPI 615
           RTVY+GNI P     D+ + VR G+++ +K +  K   F++F++  +++ F+++A L+ +
Sbjct: 168 RTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAILKRL 227

Query: 616 VLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGK- 674
            + G  +++GWG+PS   P       T GA+RN+++     +   K  +N +  +YHG  
Sbjct: 228 NIDGKDIKIGWGKPSPLSPIIATSVATDGATRNIFIGQLNTTDHNKQKDN-DATIYHGSD 286

Query: 675 --YKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVED-SNSPIEKNLE 731
               + TEE+LR+D  +YG ++ I   ++    +V+F +I  AI++V + SNS       
Sbjct: 287 DFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLSNS------- 339

Query: 732 KFHAQFDGRYKNLIIGYGKDRCGNVNK 758
                 +  Y    I YGKDRC  + K
Sbjct: 340 ------NPYYSKKKIYYGKDRCAFITK 360

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  154 bits (389), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 121/206 (58%), Gaps = 26/206 (12%)

Query: 551 NGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANA 610
           N + NRT+Y+GN+  R + E++CNVVRGG+LQ++K++  + +CFVTF +  AA QFYA A
Sbjct: 260 NNLGNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFYAMA 319

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKL 670
           SL  + +     ++GWG+ SG LP ++A A++ GASRNVY       F      +P    
Sbjct: 320 SLHGLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPAVAE 372

Query: 671 YHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNL 730
           +        E  LRQ  + +G++EQ+N + +  C +VNF N+  AI  VE         +
Sbjct: 373 FF------EERHLRQAMSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVE--------QV 418

Query: 731 EKFHAQFDGRYKNLIIGYGKDRCGNV 756
           +K+      +++ L + YGKDRCGNV
Sbjct: 419 KKWP-----QFQQLKVNYGKDRCGNV 439

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 108/228 (47%), Gaps = 35/228 (15%)

Query: 555 NRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEP 614
           +RTVY+GNI P     ++ + V+ G+++  +   +K   FV+F++  +A+ F+++A L  
Sbjct: 38  SRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDAILNR 97

Query: 615 IVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYV-SLPEYSFKEKYINNPEFKLYHG 673
           + +    +++GW   +   P       + GA+RNVY+ +LP+                  
Sbjct: 98  LRIGDRDVKIGWATATLMDPLVATRIQSEGATRNVYLGNLPDGV---------------- 141

Query: 674 KYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKF 733
                +  +L +D + YG+++ +  L      +V+  +I  AI  V         NL++ 
Sbjct: 142 -----SRYELTKDLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAV--------ANLQRD 188

Query: 734 HAQFDGRYKNLIIGYGKDRCGNVNKNLAANKNSRFYKKIKKQSYSMKQ 781
           +  +  R     + +GKDRC  V K L  ++ ++F    ++ +  M+Q
Sbjct: 189 NKIYSDRR----VSFGKDRCAYVTK-LQQSRAAQFLGLPEEDAVRMEQ 231

>Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W
           (REAL)
          Length = 664

 Score = 35.8 bits (81), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 52/105 (49%), Gaps = 12/105 (11%)

Query: 555 NRTVYIGNIHPRSKPEDICNVVRG-GILQTIKWISSKRICFVTF---IETAAAVQFYANA 610
           N TV++G + P++    + ++ +  G +  ++  + K   FV F   I+  A++Q     
Sbjct: 358 NTTVFVGGLVPKTAEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQ----- 412

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIG---ASRNVYVS 652
            L+  ++ G+ +R+ WG+PS    K  +  +  G   +S NV  S
Sbjct: 413 GLQGFIVGGSPIRLSWGRPSSSNAKAASTVMGTGQYLSSNNVRAS 457

>Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W
           (REAL)
          Length = 663

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 43/80 (53%), Gaps = 9/80 (11%)

Query: 555 NRTVYIGNIHPRSKPEDICNVVRG-GILQTIKWISSKRICFVTF---IETAAAVQFYANA 610
           N TV++G + P++    + ++ +  G +  ++  + K   FV F   I+  A++Q     
Sbjct: 355 NTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQ----- 409

Query: 611 SLEPIVLHGNILRVGWGQPS 630
            L+  ++ G+ +R+ WG+PS
Sbjct: 410 GLQGFIVGGSPIRLSWGRPS 429

>SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {ON}
           weakly similar to uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 490

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 9/82 (10%)

Query: 555 NRTVYIGNIHPR-SKPEDICNVVRGGILQTIKWISSKRICFVTF---IETAAAVQFYANA 610
           N TV+IG +  + S+P+     +  G +  ++    K   FV F   I+  AA+Q     
Sbjct: 366 NTTVFIGGLASQISEPQLYSLFLPFGSITNVRIPQGKGCGFVKFESRIDAEAAIQ----- 420

Query: 611 SLEPIVLHGNILRVGWGQPSGE 632
            ++  ++ GN +R+ WG+ SGE
Sbjct: 421 GMQGFIVGGNPIRLSWGRSSGE 442

>Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W
           (REAL)
          Length = 736

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 555 NRTVYIGNIHPRSKPEDICNVVRG-GILQTIKWISSKRICFVTF---IETAAAVQFYANA 610
           N TV++G + P++    + ++ +  G +  ++  + K   FV F   I+  A++Q     
Sbjct: 358 NTTVFVGGLGPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQ----- 412

Query: 611 SLEPIVLHGNILRVGWGQPSGELPK 635
            L+  ++ G+ +R+ WG+PS    K
Sbjct: 413 GLQGFIVGGSPIRLSWGRPSSSSAK 437

>YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA
           binding protein that negatively regulates growth rate;
           interacts with the 3' UTR of the mitochondrial porin
           (POR1) mRNA and enhances its degradation; overexpression
           impairs mitochondrial function; interacts with Dhh1p to
           mediate POR1 mRNA decay; expressed in stationary phase
          Length = 672

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 50/97 (51%), Gaps = 11/97 (11%)

Query: 555 NRTVYIGNIHPRSKPEDICNVVRG-GILQTIKWISSKRICFVTF---IETAAAVQFYANA 610
           N TV++G + P++    + ++ +  G +  ++  + K   FV F   I+  A++Q     
Sbjct: 359 NTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQ----- 413

Query: 611 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASR 647
            L+  ++ G+ +R+ WG+PS    K    +  +GAS+
Sbjct: 414 GLQGFIVGGSPIRLSWGRPSSSNAK--TNSTIMGASQ 448

>ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {ON}
           similar to uniprot|Q75EC3 Ashbya gossypii AAR151W
           AAR151Wp and weakly similar to YBR212W uniprot|P32831
           Saccharomyces cerevisiae YBR212W NGR1 negative growth
           regulatory protein
          Length = 716

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 11/80 (13%)

Query: 554 NNRTVYIGNIHPRSKPEDICNVVR--GGILQTIKWISSKRICFVTF---IETAAAVQFYA 608
           NN TV+IG + P+     +  +    G IL T+K    K   FV F   I+  AA+Q   
Sbjct: 419 NNTTVFIGGLTPKINENQLQTLFSPFGNIL-TVKIPQGKNCGFVKFEKRIDAEAAIQ--- 474

Query: 609 NASLEPIVLHGNILRVGWGQ 628
              ++  V+ G  +R+ WG+
Sbjct: 475 --GMQGFVVGGCPIRLSWGR 492

>TBLA0D02810 Chr4 complement(688830..689750) [921 bp, 306 aa] {ON}
           Anc_8.466 YDL209C
          Length = 306

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 6/53 (11%)

Query: 663 INNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHA 715
           INN E K          E +LR  F++ G ++++ YLE+ +C ++ F N  +A
Sbjct: 150 INNKELKPSQ------IESRLRYMFSRLGLLDRLRYLENKNCAFIKFKNQCNA 196

>TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {ON}
           Anc_6.104 YBR212W
          Length = 617

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 11/80 (13%)

Query: 554 NNRTVYIGNIHPRSKPEDICNVVR--GGILQTIKWISSKRICFVTF---IETAAAVQFYA 608
           NN TV+IG + P+     +  +    G IL T+K    K   FV +   I+  AA+Q   
Sbjct: 384 NNTTVFIGGLTPKINEAQLQALFSPFGNIL-TVKIPQGKNCGFVKYENRIDAEAAIQ--- 439

Query: 609 NASLEPIVLHGNILRVGWGQ 628
              ++  ++ GN +R+ WG+
Sbjct: 440 --GMQGFIVGGNPVRLSWGR 457

>KNAG0A02400 Chr1 complement(236366..237271) [906 bp, 301 aa] {ON}
           Anc_8.466 YDL209C
          Length = 301

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%)

Query: 677 LPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHA 715
           L  E +LR  F K G +++I Y+E  +C +V F + A+A
Sbjct: 155 LQIESRLRYLFNKLGALDRIRYVEAKNCAFVTFKSTANA 193

>Skud_4.47 Chr4 complement(83397..84428) [1032 bp, 343 aa] {ON}
           YDL209C (REAL)
          Length = 343

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 24/37 (64%)

Query: 679 TEEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHA 715
            E ++R  F++ G +++I Y+ED +C +V F   A+A
Sbjct: 156 VESRIRFVFSRLGDIDRIRYVEDKNCAFVKFKYQANA 192

>Suva_4.39 Chr4 complement(74438..75484) [1047 bp, 348 aa] {ON}
           YDL209C (REAL)
          Length = 348

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 23/36 (63%)

Query: 680 EEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHA 715
           E ++R  F++ G +++I Y+ED  C +V F + A A
Sbjct: 157 ESRVRFVFSRLGDIDRIRYVEDKSCAFVKFKHQASA 192

>Smik_4.31 Chr4 complement(64414..65439) [1026 bp, 341 aa] {ON}
           YDL209C (REAL)
          Length = 341

 Score = 32.7 bits (73), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 24/36 (66%)

Query: 680 EEQLRQDFTKYGQVEQINYLEDGHCCWVNFMNIAHA 715
           E ++R  F++ G +++I Y+ED +C +V F   A+A
Sbjct: 157 ESRIRFVFSRLGAIDRIRYVEDKNCAFVKFKYQANA 192

>KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {ON}
           some similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 547

 Score = 32.7 bits (73), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 48/100 (48%), Gaps = 9/100 (9%)

Query: 554 NNRTVYIGNIHPRSKPEDICNVVRG-GILQTIKWISSKRICFVTF---IETAAAVQFYAN 609
           NN TV+IG +   +    + ++    G +  +K    K   FV +   I+  AA+Q    
Sbjct: 404 NNTTVFIGGLTSHTSERQLHSLFAPFGTIINVKIPPGKGCGFVKYAYRIDAEAAIQ---- 459

Query: 610 ASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNV 649
             ++  ++ GN +R+ WG+ S +  ++ A+     + RNV
Sbjct: 460 -GMQGFIVGGNPIRLSWGRTSTDTSRHPAMQDMPSSLRNV 498

>TBLA0C01820 Chr3 complement(429227..430411) [1185 bp, 394 aa] {ON}
           Anc_8.670 YOR242C
          Length = 394

 Score = 32.3 bits (72), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 8/70 (11%)

Query: 683 LRQDFTKYGQVEQINYLEDGHCCW-VNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRY 741
           L+ DF KYG +  +  +     C+ V+F N+A AIR ++      E    + + ++   Y
Sbjct: 323 LKNDFKKYGTILDVTPIVSRKLCFAVHFANVASAIRAMQ----AFELKGTELNKKY---Y 375

Query: 742 KNLIIGYGKD 751
           K   + YGKD
Sbjct: 376 KRWAMWYGKD 385

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 99,754,309
Number of extensions: 4295741
Number of successful extensions: 14518
Number of sequences better than 10.0: 64
Number of HSP's gapped: 14692
Number of HSP's successfully gapped: 145
Length of query: 1043
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 923
Effective length of database: 39,721,479
Effective search space: 36662925117
Effective search space used: 36662925117
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)