Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ABL121C8.845ON1285128555310.0
SAKL0D01342g8.845ON1270129524880.0
KLTH0C03762g8.845ON1206127422540.0
KLLA0D01452g8.845ON1445101222110.0
Kwal_27.102328.845ON1209126421840.0
TDEL0B005308.845ON1301131821050.0
Ecym_46168.845ON157773620380.0
ZYRO0G14278g8.845ON1250110418730.0
KAFR0B039508.845ON1246104215430.0
Suva_13.4688.845ON141895114671e-179
Smik_13.4938.845ON1433114914381e-175
YMR280C (CAT8)8.845ON143392414141e-171
Skud_13.4528.845ON143295613911e-168
NDAI0K003908.845ON149589113641e-163
KNAG0J002508.845ON123794812061e-143
NCAS0C003908.845ON116465611881e-141
CAGL0M03025g8.845ON125466010421e-120
Kpol_1016.201.277ON1086482195e-17
AFR096W1.277ON852482096e-16
KAFR0A014801.277ON725492087e-16
TPHA0I028201.277ON1044502062e-15
ZYRO0G15136g1.277ON1027482062e-15
KLLA0F14322g1.277ON717482052e-15
Ecym_63401.277ON952482043e-15
SAKL0D05654g1.277ON919482034e-15
KLTH0D03564g1.277ON862482024e-15
Smik_10.1531.277ON829482016e-15
YJL089W (SIP4)1.277ON829481991e-14
Skud_10.1251.277ON833481972e-14
Kwal_26.7397singletonOFF201481832e-14
Suva_6.1611.277ON832481962e-14
TDEL0D014501.277ON945481944e-14
CAGL0L03377g1.277ON1209481928e-14
NDAI0G055301.277ON1186481901e-13
KNAG0B018401.277ON1072491873e-13
TBLA0D054201.277ON757481792e-12
NCAS0A094101.277ON932451561e-09
KLLA0E13993gsingletonON678441282e-06
TBLA0G026102.231ON1000421264e-06
KLLA0C10923g5.235ON775491256e-06
NDAI0F012206.279ON960481212e-05
KLLA0F04609g2.231ON916331212e-05
SAKL0C02024gsingletonON898481212e-05
NDAI0A087907.17ON1059341212e-05
YPL248C (GAL4)6.279ON881471203e-05
Smik_6.4526.279ON878471193e-05
KAFR0J017102.231ON848331193e-05
KNAG0D006906.279ON875501193e-05
NCAS0D041906.279ON890451193e-05
YJL206C1.128ON7581751193e-05
NCAS0B065502.231ON906331193e-05
SAKL0G11902g5.235ON906481183e-05
ZYRO0E08272g6.279ON794471184e-05
Smik_9.392.231ON1012331184e-05
NDAI0B038502.231ON930331184e-05
YIL130W (ASG1)2.231ON964331184e-05
Ecym_7440na 1ON898421184e-05
Skud_9.372.231ON954331184e-05
TPHA0F013802.231ON8901281175e-05
Suva_9.592.231ON926331175e-05
Suva_6.2851.128ON7861751175e-05
TDEL0C044802.231ON852331176e-05
NCAS0G011006.279ON935451176e-05
KLTH0G09108g2.231ON782331166e-05
SAKL0E08998g2.231ON823331166e-05
Kwal_23.47542.231ON812331167e-05
Kpol_1018.306.279ON881501167e-05
CAGL0G08844g2.231ON847411167e-05
Kpol_1039.112.231ON992331158e-05
KNAG0E017602.231ON902331158e-05
NCAS0D025405.235ON890441158e-05
KLTH0D07260g2.547ON979501159e-05
SAKL0A02860g6.279ON745451159e-05
KNAG0B051205.235ON888441159e-05
Suva_16.596.279ON895451131e-04
Smik_10.251.128ON7721761132e-04
KLTH0E14454gna 1ON902451122e-04
NDAI0I023505.235ON889441122e-04
Kpol_495.213.109ON1085371122e-04
TPHA0H019806.279ON993471122e-04
Skud_10.101.128ON8331211122e-04
TBLA0G018006.279ON1154451122e-04
KAFR0J006905.235ON864441112e-04
KLTH0D02222gna 2ON847471112e-04
KNAG0E002107.17ON948331103e-04
TDEL0E00160singletonON631471103e-04
Kwal_23.29055.235ON881481103e-04
KAFR0A002202.651ON9182321103e-04
KAFR0F014901.128ON658371104e-04
TPHA0N002307.17ON1232331104e-04
TDEL0C056801.128ON6911711094e-04
ZYRO0E06270g2.565ON912461104e-04
KLTH0G07898g5.235ON866481104e-04
Suva_10.945.235ON906441094e-04
TDEL0E039105.235ON862441094e-04
SAKL0C03938g1.128ON780331094e-04
ZYRO0A10956g5.235ON855441094e-04
SAKL0B06732gna 1ON878421095e-04
KLTH0H16170gna 3ON619331085e-04
KAFR0F034104.113ON995371095e-04
NDAI0I007406.279ON1033451085e-04
KLLA0A02585gna 4ON370371075e-04
Smik_1.137.17ON1046331086e-04
KAFR0C049807.17ON951411086e-04
CAGL0M12298g7.17ON994461086e-04
SAKL0H24860gna 5ON9711271077e-04
Smik_2.438na 6ON469421067e-04
AER370W2.231ON801331078e-04
KAFR0F010406.279ON834471078e-04
YBR297W (MAL33)na 6ON468421068e-04
AER183Cna 1ON879421078e-04
Smik_18.8singletonON775381060.001
SAKL0A09856g2.547ON1020501060.001
TBLA0A012101.380ON1422301070.001
Ecym_53972.231ON826331060.001
TBLA0C040504.113ON1207361060.001
Smik_12.775.235ON903441060.001
NDAI0D00900singletonON865331060.001
KAFR0I002307.17ON1045331060.001
SAKL0B04620gna 4ON362371030.001
ZYRO0C18150g1.128ON571381040.001
Smik_11.2402.654ON9761381050.001
KLTH0B00352gsingletonON934391050.001
SAKL0D14520g7.17ON983331050.001
TPHA0A045403.109ON1178371050.001
Suva_1.147.17ON1045331050.001
YLR014C (PPR1)5.235ON904441040.002
Kpol_538.427.17ON1088421050.002
ACL093C2.651ON10102061040.002
CAGL0A00451g4.113ON1107421040.002
KLTH0H02684g6.279ON749451040.002
Ecym_50177.17ON978331040.002
Skud_1.107.17ON1040331040.002
YGL013C (PDR1)4.113ON1068381040.002
CAGL0I07755g3.109ON1053361040.002
NDAI0F00110singletonON508331030.002
ADR403C7.17ON970461030.002
NCAS0I002707.17ON944341030.002
SAKL0A00704gna 7ON718461030.002
CAGL0J07150g7.17ON1022431030.002
KLLA0D12672g6.279ON865451030.002
Skud_12.825.235ON899441030.002
SAKL0D00264g8.879ON848291030.003
ZYRO0C00726g7.17ON1035471030.003
YAL051W (OAF1)7.17ON1047331030.003
Skud_15.546na 8ON542461020.003
ACL058Wna 5ON817791020.003
TBLA0E007007.17ON1274331020.003
Kwal_26.81092.547ON970501020.003
TPHA0A06090singletonON847331020.003
Skud_5.331singletonON17038960.003
Smik_7.2774.113ON1069381020.003
SAKL0D01100g4.113ON940361020.003
NCAS0A035804.113ON1113371020.003
Skud_7.2744.113ON1080381020.004
TBLA0C062306.60ON795331010.004
SAKL0D14542gna 9ON946331010.004
Suva_15.773.109ON1029471010.004
TDEL0H043407.17ON989331010.004
Smik_15.561na 8ON546471000.004
SAKL0H00682gna 10ON922331010.004
TBLA0G011308.879ON1132341010.005
NDAI0H019907.17ON1161331000.005
Suva_8.436na 8ON545381000.005
KAFR0C039002.654ON8181441000.005
KLLA0F22990g1.380ON1253301000.005
KLLA0A09119g4.113ON1082361000.005
KLLA0C14212gna 10ON1040361000.006
TDEL0D051503.109ON996471000.006
KNAG0E041507.17ON1136331000.006
Skud_2.427na 6ON46839990.006
Smik_17.27singletonON68833990.006
YKL015W (PUT3)2.654ON979138990.006
YOR380W (RDR1)na 8ON54637990.006
SAKL0C09944g3.109ON106136990.006
TBLA0D006307.389ON107740990.006
KLLA0F09559gsingletonON65838990.007
Ecym_2522na 7ON92634990.007
Skud_11.1902.547ON117150990.007
Smik_13.1832.565ON91146990.007
CAGL0F07909g3.109ON104936990.007
YOR363C (PIP2)7.17ON99647990.008
Skud_15.5327.17ON100047990.008
CAGL0K05841g1.380ON137230990.008
KLLA0A10329gna 11ON63939980.008
NCAS0C002208.879ON83929980.008
NCAS0A076107.17ON102233980.009
NCAS0A03070singletonON65633980.009
AFL160C6.279ON64847980.009
TBLA0A058601.128aON81046980.009
CAGL0B03421g1.380ON135530980.009
KAFR0B014502.547ON108850980.009
KAFR0I020301.380ON123330980.010
TBLA0A097606.75ON153043980.010
Suva_16.25singletonON14342910.010
KNAG0I014501.380ON147630980.010
KNAG0A071002.547ON128650980.010
Kpol_467.11.380ON128930980.010
NCAS0A047502.547ON114150970.011
KLTH0E06666gna 5ON946206970.011
NCAS0D04860singletonON70139970.011
NDAI0D035504.113ON111842970.011
Skud_15.643.109ON103236970.011
KNAG0A02300singletonON72931970.012
Suva_7.2684.113ON100038970.012
Smik_11.2102.547ON116950970.012
ZYRO0G22550gsingletonON72437970.013
CAGL0F09229gna 12ON83533970.013
KLLA0F19602g8.283ON60341960.013
YGR288W (MAL13)na 13ON47330960.013
Ecym_27321.380ON119830970.013
TBLA0G00490singletonON91838960.014
TPHA0H012405.59ON87739960.014
Kwal_34.15751na 3ON62833960.015
Skud_9.220singletonON79335960.015
Skud_3.181singletonON83150960.015
YKL038W (RGT1)2.547ON117050960.015
NDAI0G052601.380ON158130960.015
TDEL0B004808.879ON83529960.015
NCAS0C027308.423ON77540960.015
NDAI0G041403.109ON100146960.015
NCAS0A088401.380ON147830960.016
NCAS0H00780singletonON90938960.016
Suva_11.1872.547ON117150960.017
CAGL0F07865g8.423ON84433960.017
NDAI0A034204.113ON110833960.017
TBLA0G005106.60ON93537950.018
KLLA0A03421gna 9ON88034950.018
CAGL0L01903g2.547ON128736960.018
Kwal_YGOB_0.1391.380ON124030960.018
TPHA0B036301.380ON142932960.018
SAKL0D07898g1.380ON124430950.019
KAFR0C03730singletonON79135950.019
KLLA0A06039g1.199ON65744950.019
KNAG0A025508.423ON73054950.019
KLLA0A03443g7.17ON97533950.020
AFR117C1.380ON115230950.020
KLTH0H11572g1.380ON123730950.020
NDAI0K001508.879ON95329950.020
ZYRO0G19338gna 14ON65329950.021
Kpol_260.25.59ON75641940.022
Klac_YGOB_39601.128aON81037950.022
ZYRO0A13596gsingletonON64837940.022
TDEL0A02690singletonON72244940.023
KLLA0F02750g3.109ON114836950.023
Kwal_26.68057.17ON94433950.023
YLR256W (HAP1)1.380ON150230950.023
TPHA0F008304.113ON119249950.023
Suva_13.1862.565ON89440940.024
AGL233Cna 7ON87234940.025
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL121C
         (1285 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...  2135   0.0  
SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...   962   0.0  
KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...   872   0.0  
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...   856   0.0  
Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...   845   0.0  
TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.84...   815   0.0  
Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...   789   0.0  
ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...   726   0.0  
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...   598   0.0  
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...   569   e-179
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...   558   e-175
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...   549   e-171
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...   540   e-168
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845    530   e-163
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...   469   e-143
NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845     462   e-141
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...   405   e-120
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    89   5e-17
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    85   6e-16
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    85   7e-16
TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {...    84   2e-15
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    84   2e-15
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    84   2e-15
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    83   3e-15
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    83   4e-15
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    82   4e-15
Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089...    82   6e-15
YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zi...    81   1e-14
Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089...    80   2e-14
Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OF...    75   2e-14
Suva_6.161 Chr6 complement(283370..284500,284547..284764,284948....    80   2e-14
TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.2...    79   4e-14
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    79   8e-14
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            78   1e-13
KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1....    77   3e-13
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    74   2e-12
NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa] ...    65   1e-09
KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]...    54   2e-06
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    53   4e-06
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    53   6e-06
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    51   2e-05
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    51   2e-05
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    51   2e-05
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    51   2e-05
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    51   3e-05
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    50   3e-05
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    50   3e-05
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    50   3e-05
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     50   3e-05
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    50   3e-05
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    50   3e-05
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    50   3e-05
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    50   4e-05
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    50   4e-05
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    50   4e-05
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    50   4e-05
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    50   4e-05
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    50   4e-05
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    50   5e-05
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    50   5e-05
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    50   5e-05
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    50   6e-05
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    50   6e-05
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    49   6e-05
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    49   6e-05
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    49   7e-05
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    49   7e-05
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    49   7e-05
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    49   8e-05
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    49   8e-05
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    49   8e-05
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    49   9e-05
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    49   9e-05
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               49   9e-05
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    48   1e-04
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    48   2e-04
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    48   2e-04
NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235     48   2e-04
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    48   2e-04
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    48   2e-04
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    48   2e-04
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    48   2e-04
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    47   2e-04
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    47   2e-04
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    47   3e-04
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 47   3e-04
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    47   3e-04
KAFR0A00220 Chr1 complement(42494..45250) [2757 bp, 918 aa] {ON}...    47   3e-04
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    47   4e-04
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    47   4e-04
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    47   4e-04
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    47   4e-04
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    47   4e-04
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    47   4e-04
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    47   4e-04
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    47   4e-04
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    47   4e-04
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    47   5e-04
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    46   5e-04
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    47   5e-04
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    46   5e-04
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    46   5e-04
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    46   6e-04
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    46   6e-04
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    46   6e-04
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    46   7e-04
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    45   7e-04
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    46   8e-04
KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {O...    46   8e-04
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    45   8e-04
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    46   8e-04
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    45   0.001
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    45   0.001
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    46   0.001
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    45   0.001
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    45   0.001
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    45   0.001
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               45   0.001
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    45   0.001
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    44   0.001
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    45   0.001
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    45   0.001
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    45   0.001
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    45   0.001
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    45   0.001
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    45   0.001
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    45   0.002
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    45   0.002
ACL093C Chr3 complement(178239..181271) [3033 bp, 1010 aa] {ON} ...    45   0.002
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    45   0.002
KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {...    45   0.002
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    45   0.002
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    45   0.002
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    45   0.002
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    45   0.002
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 44   0.002
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    44   0.002
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    44   0.002
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    44   0.002
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    44   0.002
KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]...    44   0.002
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    44   0.002
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    44   0.003
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    44   0.003
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    44   0.003
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    44   0.003
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    44   0.003
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    44   0.003
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    44   0.003
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    44   0.003
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    42   0.003
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    44   0.003
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    44   0.003
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    44   0.003
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    44   0.004
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    44   0.004
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    44   0.004
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    44   0.004
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    44   0.004
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...    43   0.004
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    44   0.004
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    44   0.005
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    43   0.005
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...    43   0.005
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    43   0.005
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    43   0.005
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    43   0.005
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    43   0.006
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    43   0.006
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    43   0.006
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    43   0.006
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    43   0.006
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    43   0.006
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...    43   0.006
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    43   0.006
TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {...    43   0.006
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    43   0.007
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    43   0.007
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    43   0.007
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    43   0.007
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    43   0.007
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    43   0.008
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    43   0.008
CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} simi...    43   0.008
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    42   0.008
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       42   0.008
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    42   0.009
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               42   0.009
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    42   0.009
TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON}             42   0.009
CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa] ...    42   0.009
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    42   0.009
KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {...    42   0.010
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    42   0.010
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    40   0.010
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              42   0.010
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    42   0.010
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    42   0.010
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    42   0.011
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    42   0.011
NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON}               42   0.011
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    42   0.011
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    42   0.011
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    42   0.012
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    42   0.012
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    42   0.012
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    42   0.013
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    42   0.013
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    42   0.013
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    42   0.013
Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} simila...    42   0.013
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                42   0.014
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    42   0.014
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    42   0.015
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    42   0.015
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    42   0.015
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    42   0.015
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    42   0.015
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    42   0.015
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     42   0.015
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    42   0.015
NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON} Anc_...    42   0.016
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    42   0.016
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    42   0.017
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    42   0.017
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    42   0.017
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    41   0.018
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    41   0.018
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    42   0.018
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    42   0.018
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    42   0.018
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    41   0.019
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               41   0.019
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    41   0.019
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    41   0.019
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    41   0.020
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    41   0.020
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    41   0.020
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    41   0.020
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    41   0.021
Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON} co...    41   0.022
Klac_YGOB_3960 Chr3 (291786..293297,293300..294220) [2433 bp, 81...    41   0.022
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    41   0.022
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               41   0.023
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    41   0.023
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    41   0.023
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    41   0.023
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    41   0.023
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    41   0.024
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    41   0.025
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    41   0.025
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    41   0.025
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    41   0.026
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    41   0.026
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    41   0.027
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    40   0.027
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    41   0.028
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    41   0.028
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    41   0.029
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    41   0.029
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      41   0.030
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    40   0.030
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    41   0.030
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    40   0.031
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    40   0.032
Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR25...    41   0.032
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    41   0.032
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    41   0.032
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    40   0.033
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    40   0.033
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    40   0.033
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    40   0.034
TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa] {O...    40   0.034
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    40   0.035
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    40   0.036
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    40   0.036
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    40   0.037
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    40   0.037
TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON} Anc_...    40   0.038
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    40   0.038
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    40   0.038
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    40   0.039
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    40   0.039
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               40   0.040
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    40   0.040
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    40   0.041
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     40   0.041
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    40   0.042
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    40   0.042
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    40   0.043
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    40   0.044
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    40   0.044
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    40   0.044
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    40   0.045
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    40   0.045
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    40   0.047
KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.5...    40   0.048
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    40   0.050
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    40   0.050
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    40   0.051
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    40   0.051
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    40   0.051
TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {...    40   0.052
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    40   0.052
SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakl...    40   0.053
ZYRO0G21626g Chr7 complement(1781790..1783031) [1242 bp, 413 aa]...    39   0.055
Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W...    39   0.057
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    40   0.057
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    40   0.057
SAKL0G19404g Chr7 (1667193..1670582) [3390 bp, 1129 aa] {ON} sim...    40   0.059
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    40   0.059
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    40   0.060
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    40   0.061
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    40   0.063
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    40   0.065
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    40   0.065
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    40   0.065
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    40   0.065
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    40   0.066
Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]...    39   0.067
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    39   0.068
KLTH0A03498g Chr1 complement(301696..303915) [2220 bp, 739 aa] {...    39   0.068
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    39   0.071
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    39   0.073
KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {...    39   0.073
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    39   0.073
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    39   0.074
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    39   0.074
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    39   0.075
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    39   0.080
Kwal_47.18089 s47 complement(680481..682718) [2238 bp, 745 aa] {...    39   0.081
CAGL0L04576g Chr12 (528957..531554) [2598 bp, 865 aa] {ON} simil...    39   0.081
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    39   0.082
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    39   0.085
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    39   0.086
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    39   0.086
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    39   0.087
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    39   0.089
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    39   0.090
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    39   0.090
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    39   0.091
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    39   0.091
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    39   0.093
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    39   0.094
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    39   0.097
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    39   0.098
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    39   0.098
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    39   0.099
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    39   0.099
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       39   0.10 
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    39   0.10 
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    39   0.10 
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    39   0.11 
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    39   0.11 
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    39   0.11 
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    39   0.11 
SAKL0H01958g Chr8 complement(193079..195055) [1977 bp, 658 aa] {...    39   0.11 
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    39   0.11 
Ecym_3395 Chr3 complement(750356..753481) [3126 bp, 1041 aa] {ON...    39   0.11 
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    39   0.11 
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    39   0.12 
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    39   0.12 
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      36   0.12 
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    39   0.12 
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    39   0.12 
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    39   0.12 
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    39   0.12 
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    39   0.12 
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               39   0.12 
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    39   0.12 
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    38   0.13 
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    39   0.13 
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    39   0.13 
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    38   0.13 
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    39   0.13 
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    39   0.13 
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    39   0.13 
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    39   0.14 
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    39   0.14 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    38   0.14 
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    39   0.14 
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...    38   0.14 
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    39   0.15 
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    39   0.15 
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    39   0.15 
AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON} S...    38   0.15 
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    38   0.15 
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    38   0.15 
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    38   0.16 
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    38   0.16 
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    38   0.16 
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    38   0.16 
TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa] ...    38   0.16 
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    38   0.16 
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    38   0.16 
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    38   0.17 
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    38   0.17 
Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON} (1252...    38   0.17 
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    38   0.18 
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    38   0.18 
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    38   0.18 
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    38   0.18 
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    38   0.18 
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    38   0.19 
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       38   0.19 
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    38   0.19 
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    38   0.19 
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    38   0.19 
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    38   0.19 
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    38   0.21 
KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some...    38   0.22 
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    38   0.22 
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    38   0.22 
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    38   0.22 
YBR150C Chr2 complement(541209..544493) [3285 bp, 1094 aa] {ON} ...    38   0.22 
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    38   0.22 
TDEL0G03970 Chr7 (720080..723187) [3108 bp, 1035 aa] {ON} Anc_6....    38   0.23 
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    38   0.23 
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    38   0.23 
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    38   0.23 
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    38   0.23 
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...    37   0.23 
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    38   0.24 
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    38   0.24 
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    37   0.24 
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    38   0.25 
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    38   0.25 
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    37   0.25 
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    38   0.25 
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    38   0.25 
CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some ...    38   0.26 
KLTH0C00880g Chr3 complement(85841..89098) [3258 bp, 1085 aa] {O...    38   0.26 
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    37   0.26 
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    37   0.27 
TPHA0K01100 Chr11 (228134..231619) [3486 bp, 1161 aa] {ON} Anc_6...    37   0.27 
KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} simila...    37   0.28 
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    37   0.28 
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    37   0.29 
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    37   0.29 
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    37   0.29 
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     37   0.29 
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    37   0.30 
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    37   0.30 
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    37   0.30 
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 37   0.31 
TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.3...    37   0.31 
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    37   0.31 
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    37   0.32 
YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}  RDS1Putati...    37   0.32 
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    37   0.32 
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    37   0.32 
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    37   0.32 
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    37   0.33 
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    37   0.34 
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    37   0.34 
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    37   0.35 
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    37   0.35 
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    37   0.35 
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    37   0.35 
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    37   0.35 
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    37   0.35 
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    37   0.35 
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    37   0.35 
CAGL0H01507g Chr8 complement(147689..150073) [2385 bp, 794 aa] {...    37   0.36 
KLTH0A00484g Chr1 (42443..44149) [1707 bp, 568 aa] {ON} conserve...    37   0.36 
KLTH0E00176g Chr5 (8605..10311) [1707 bp, 568 aa] {ON} conserved...    37   0.36 
NCAS0F00310 Chr6 (49514..52084) [2571 bp, 856 aa] {ON}                 37   0.36 
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    37   0.37 
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    35   0.38 
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    37   0.38 
Kpol_1061.37 s1061 complement(102667..104616) [1950 bp, 649 aa] ...    37   0.38 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    37   0.40 
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    37   0.44 
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    37   0.44 
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      37   0.45 
SAKL0C03960g Chr3 (380387..383488) [3102 bp, 1033 aa] {ON} conse...    37   0.45 
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    37   0.45 
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    37   0.45 
TBLA0A05850 Chr1 complement(1446872..1448845) [1974 bp, 657 aa] ...    37   0.46 
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     37   0.48 
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    37   0.48 
Kwal_14.931 s14 complement(119423..122608) [3186 bp, 1061 aa] {O...    37   0.48 
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    37   0.49 
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    37   0.49 
KLLA0E18195g Chr5 complement(1622300..1625701) [3402 bp, 1133 aa...    37   0.51 
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     37   0.51 
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    36   0.51 
Ecym_3001 Chr3 (1150..3042) [1893 bp, 630 aa] {ON} similar to As...    37   0.51 
KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON...    37   0.52 
KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some s...    37   0.52 
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    37   0.53 
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    37   0.53 
KAFR0D04590 Chr4 (900318..902840) [2523 bp, 840 aa] {ON} Anc_5.3...    37   0.54 
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    37   0.55 
Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222...    37   0.56 
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    37   0.56 
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    36   0.59 
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    37   0.60 
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    36   0.60 
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    36   0.62 
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    36   0.63 
Kwal_56.23308 s56 complement(485779..487092) [1314 bp, 438 aa] {...    36   0.64 
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    36   0.68 
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    36   0.69 
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    36   0.69 
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    36   0.70 
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    36   0.73 
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    36   0.74 
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    36   0.74 
Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196...    36   0.75 
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    36   0.76 
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    36   0.78 
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    36   0.79 
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    36   0.80 
Ecym_7239 Chr7 (501580..504774) [3195 bp, 1064 aa] {ON} similar ...    36   0.81 
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    36   0.81 
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    36   0.81 
KLLA0F20680g Chr6 (1924148..1926511) [2364 bp, 787 aa] {ON} weak...    36   0.83 
AFR722C Chr6 complement(1765861..1768293) [2433 bp, 810 aa] {ON}...    36   0.83 
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    36   0.90 
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    36   0.92 
AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON...    36   0.96 
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    36   0.98 
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    36   0.99 
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    35   1.0  
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    35   1.0  
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      35   1.0  
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    35   1.0  
SAKL0B12518g Chr2 (1072142..1073932) [1791 bp, 596 aa] {ON} cons...    35   1.0  
Smik_4.68 Chr4 (133172..134758) [1587 bp, 528 aa] {ON} YDL170W (...    35   1.1  
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    35   1.1  
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    35   1.1  
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    35   1.1  
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               35   1.2  
NDAI0F04500 Chr6 complement(1093752..1096181) [2430 bp, 809 aa] ...    35   1.2  
TBLA0A07010 Chr1 (1713923..1716046) [2124 bp, 707 aa] {ON}             35   1.2  
TPHA0M00150 Chr13 (29607..31919) [2313 bp, 770 aa] {ON}                35   1.3  
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    35   1.3  
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    35   1.3  
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    35   1.3  
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    35   1.3  
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    35   1.4  
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     35   1.4  
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      35   1.4  
AER291C Chr5 complement(1172383..1174374) [1992 bp, 663 aa] {ON}...    35   1.4  
ZYRO0G00374g Chr7 complement(28649..30553) [1905 bp, 634 aa] {ON...    35   1.5  
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    35   1.5  
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    35   1.6  
Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar ...    35   1.7  
SAKL0A08074g Chr1 (711985..715425) [3441 bp, 1146 aa] {ON} simil...    35   1.7  
Kpol_1042.7 s1042 (12882..15233) [2352 bp, 783 aa] {ON} (12882.....    35   1.8  
CAGL0L09383g Chr12 (1020856..1021956) [1101 bp, 366 aa] {ON} som...    34   1.8  
TBLA0B07050 Chr2 (1669768..1671996) [2229 bp, 742 aa] {ON}             35   1.8  
KLTH0G15180g Chr7 (1326581..1329871) [3291 bp, 1096 aa] {ON} sim...    35   1.9  
Skud_4.87 Chr4 (152240..153826) [1587 bp, 528 aa] {ON} YDL170W (...    35   1.9  
Suva_15.3 Chr15 complement(4971..6152) [1182 bp, 393 aa] {ON} YK...    34   1.9  
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    34   1.9  
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    35   2.1  
Kwal_14.819 s14 complement(63184..64890) [1707 bp, 568 aa] {ON} ...    34   2.1  
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    34   2.4  
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     34   2.4  
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    34   2.4  
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    34   2.4  
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    34   2.5  
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    34   2.5  
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    34   2.5  
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    34   2.6  
SAKL0G14256g Chr7 (1230063..1232306) [2244 bp, 747 aa] {ON} cons...    34   2.6  
TDEL0G00830 Chr7 complement(170169..172229) [2061 bp, 686 aa] {O...    34   2.7  
SAKL0H13266g Chr8 (1138536..1140362) [1827 bp, 608 aa] {ON} some...    34   3.0  
ZYRO0E00638g Chr5 complement(44716..48036) [3321 bp, 1106 aa] {O...    34   3.1  
NDAI0E04190 Chr5 complement(944753..948466) [3714 bp, 1237 aa] {...    34   3.1  
TDEL0C05790 Chr3 (1045249..1047057) [1809 bp, 602 aa] {ON}             34   3.3  
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    34   3.4  
SAKL0A06072g Chr1 (551181..552518) [1338 bp, 445 aa] {ON} simila...    33   3.4  
CAGL0I02552g Chr9 (227257..230274) [3018 bp, 1005 aa] {ON} weakl...    34   3.6  
YHR178W Chr8 (459299..461530) [2232 bp, 743 aa] {ON}  STB5Transc...    34   3.6  
ZYRO0C11880g Chr3 (929030..930943) [1914 bp, 637 aa] {ON} simila...    34   3.6  
TBLA0E01110 Chr5 (243534..246755) [3222 bp, 1073 aa] {ON} Anc_6....    34   3.7  
Smik_12.341 Chr12 complement(613817..615922) [2106 bp, 701 aa] {...    33   3.8  
Skud_6.15 Chr6 complement(24031..25701) [1671 bp, 556 aa] {ON} Y...    33   3.8  
SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly s...    34   3.9  
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    33   4.2  
AGL083W Chr7 (550291..552861) [2571 bp, 856 aa] {ON} Syntenic ho...    33   4.3  
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             33   4.7  
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    33   5.4  
Skud_12.92 Chr12 complement(179488..185094) [5607 bp, 1868 aa] {...    33   5.5  
TDEL0B04000 Chr2 (715716..716981) [1266 bp, 421 aa] {ON} Anc_6.1...    33   5.5  
SAKL0F16588g Chr6 complement(1369763..1371610) [1848 bp, 615 aa]...    33   5.8  
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    33   5.8  
KLLA0A09251g Chr1 (808253..810319) [2067 bp, 688 aa] {ON} simila...    33   5.8  
Skud_8.242 Chr8 (430739..432958) [2220 bp, 739 aa] {ON} YHR178W ...    33   5.8  
CAGL0F08635g Chr6 (857724..859997) [2274 bp, 757 aa] {ON} simila...    33   5.8  
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    33   6.8  
Smik_8.262 Chr8 (436380..438584) [2205 bp, 734 aa] {ON} YHR178W ...    33   7.3  
Suva_15.378 Chr15 (665572..667815) [2244 bp, 747 aa] {ON} YHR178...    32   8.7  
YFL052W Chr6 (28232..29629) [1398 bp, 465 aa] {ON} Putative zinc...    32   9.7  
KLLA0A03091g Chr1 (276333..277484) [1152 bp, 383 aa] {ON} some s...    32   9.7  

>ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR280C
            (CAT8)
          Length = 1285

 Score = 2135 bits (5531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1071/1285 (83%), Positives = 1071/1285 (83%)

Query: 1    MAGPRKEKDGYGPRIIRTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
            MAGPRKEKDGYGPRIIRTL                                         
Sbjct: 1    MAGPRKEKDGYGPRIIRTLGSQALGGAGGSSRASSVSQSPGGPEGATGGASPAAAPQSTT 60

Query: 61   XXXXXXXXXXNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
                      NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY
Sbjct: 61   GTPLSSLTPTNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120

Query: 121  XXXXXXXXXXXXXXXXXXXXXCDLKEEQLRLVSKYGCXXXXXXXXXXXNKKGDSDHTTLE 180
                                 CDLKEEQLRLVSKYGC           NKKGDSDHTTLE
Sbjct: 121  TETLEERVRELEAENRRLVALCDLKEEQLRLVSKYGCASAPATSSSSANKKGDSDHTTLE 180

Query: 181  DEQILQQLSNSDGGALRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLRSNPYTRATLSP 240
            DEQILQQLSNSDGGALRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLRSNPYTRATLSP
Sbjct: 181  DEQILQQLSNSDGGALRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLRSNPYTRATLSP 240

Query: 241  SHVAEADHVTDLRKGLPANPVAISSSVGQVPPYPFTNLNDPTSISFEQDQAPGLPAVKXX 300
            SHVAEADHVTDLRKGLPANPVAISSSVGQVPPYPFTNLNDPTSISFEQDQAPGLPAVK  
Sbjct: 241  SHVAEADHVTDLRKGLPANPVAISSSVGQVPPYPFTNLNDPTSISFEQDQAPGLPAVKAL 300

Query: 301  XXXXXXXXXXXXXXXVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKE 360
                           VAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKE
Sbjct: 301  SSLASHEESSQLAALVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKE 360

Query: 361  ITPRKTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSSGDFNLENPNGYKLENEYHQ 420
            ITPRKTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSSGDFNLENPNGYKLENEYHQ
Sbjct: 361  ITPRKTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSSGDFNLENPNGYKLENEYHQ 420

Query: 421  TKDAHPELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFKDNVSTPGFFT 480
            TKDAHPELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFKDNVSTPGFFT
Sbjct: 421  TKDAHPELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFKDNVSTPGFFT 480

Query: 481  SGDTLFDRRHKSISYKIFACLLLTVCQMGLMSKVKRERHERGDRLNNLMTYYDRAISHVI 540
            SGDTLFDRRHKSISYKIFACLLLTVCQMGLMSKVKRERHERGDRLNNLMTYYDRAISHVI
Sbjct: 481  SGDTLFDRRHKSISYKIFACLLLTVCQMGLMSKVKRERHERGDRLNNLMTYYDRAISHVI 540

Query: 541  MNPXXXXXXXXXXXXXXXXXXXXXXXNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGS 600
            MNP                       NVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGS
Sbjct: 541  MNPYFSSSSTSIQSLQLLSLLLFYFLNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGS 600

Query: 601  DGSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAG 660
            DGSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAG
Sbjct: 601  DGSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAG 660

Query: 661  QMIALEGKMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPD 720
            QMIALEGKMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPD
Sbjct: 661  QMIALEGKMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPD 720

Query: 721  NLRFQLDVNGTINMEDLNQLKRDYLNKDTALKLNNAIFMALYFLAKIMIHLPVVATKPII 780
            NLRFQLDVNGTINMEDLNQLKRDYLNKDTALKLNNAIFMALYFLAKIMIHLPVVATKPII
Sbjct: 721  NLRFQLDVNGTINMEDLNQLKRDYLNKDTALKLNNAIFMALYFLAKIMIHLPVVATKPII 780

Query: 781  DKPQPVVDTNIPGSQIDRSSSSYVLLQQATNTFXXXXXXXXXXXXXXXXXITRTKTRFGL 840
            DKPQPVVDTNIPGSQIDRSSSSYVLLQQATNTF                 ITRTKTRFGL
Sbjct: 781  DKPQPVVDTNIPGSQIDRSSSSYVLLQQATNTFLNVLSSVSSLYLPLPLNITRTKTRFGL 840

Query: 841  VSARGSLEYTKGGALFQXXXXXXXXXXXXXXXXXXXXMPGTISWHSLKLLDMAVNLILQP 900
            VSARGSLEYTKGGALFQ                    MPGTISWHSLKLLDMAVNLILQP
Sbjct: 841  VSARGSLEYTKGGALFQDNKNLLLDLLKDLEADKKLNMPGTISWHSLKLLDMAVNLILQP 900

Query: 901  PNTKPXXXXXXXXXXINYYNKLIDSHLGPTASLPTPGQTAPRKPEPAHARPIXXXXXXXX 960
            PNTKP          INYYNKLIDSHLGPTASLPTPGQTAPRKPEPAHARPI        
Sbjct: 901  PNTKPEKQEKLLQKKINYYNKLIDSHLGPTASLPTPGQTAPRKPEPAHARPIPEKEKPPS 960

Query: 961  XXRHRGDDNAAASMPPLLEKKVKLEAPASNMPTPPAPISALHEDVPRVLDGHLGANSSLA 1020
              RHRGDDNAAASMPPLLEKKVKLEAPASNMPTPPAPISALHEDVPRVLDGHLGANSSLA
Sbjct: 961  SKRHRGDDNAAASMPPLLEKKVKLEAPASNMPTPPAPISALHEDVPRVLDGHLGANSSLA 1020

Query: 1021 VLAAKHEPEGSLHSSAGNAITEAFQLDPILQPTPFSNTDLPSFFGVDQYAAPPELQPFPA 1080
            VLAAKHEPEGSLHSSAGNAITEAFQLDPILQPTPFSNTDLPSFFGVDQYAAPPELQPFPA
Sbjct: 1021 VLAAKHEPEGSLHSSAGNAITEAFQLDPILQPTPFSNTDLPSFFGVDQYAAPPELQPFPA 1080

Query: 1081 GYAAPDKVPQAAAQGPSATAGPPLSSKDSLFKVPSNGDFLKDYYSGMSSAQLNSLFTXXX 1140
            GYAAPDKVPQAAAQGPSATAGPPLSSKDSLFKVPSNGDFLKDYYSGMSSAQLNSLFT   
Sbjct: 1081 GYAAPDKVPQAAAQGPSATAGPPLSSKDSLFKVPSNGDFLKDYYSGMSSAQLNSLFTAPD 1140

Query: 1141 XXXXXXXXXXXXXXXSDGLQQQPGYGFVVDASLGLAPLLAWSPRPXXXXXXXXXXXXXXX 1200
                           SDGLQQQPGYGFVVDASLGLAPLLAWSPRP               
Sbjct: 1141 RRDVRPRAPQPDRAPSDGLQQQPGYGFVVDASLGLAPLLAWSPRPADDLLLDDKGAKLAS 1200

Query: 1201 XRSFTHVNKLSSIPTLMSTQPPPASAPHAKLGQPAPPDQDDGILTIPPRDQRGPRRLWNS 1260
             RSFTHVNKLSSIPTLMSTQPPPASAPHAKLGQPAPPDQDDGILTIPPRDQRGPRRLWNS
Sbjct: 1201 ARSFTHVNKLSSIPTLMSTQPPPASAPHAKLGQPAPPDQDDGILTIPPRDQRGPRRLWNS 1260

Query: 1261 ALNQARPAAALDDSISDLFRWQNSG 1285
            ALNQARPAAALDDSISDLFRWQNSG
Sbjct: 1261 ALNQARPAAALDDSISDLFRWQNSG 1285

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1270

 Score =  962 bits (2488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/1295 (44%), Positives = 713/1295 (55%), Gaps = 189/1295 (14%)

Query: 71   NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXX 130
            NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY          
Sbjct: 84   NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLEERVRE 143

Query: 131  XXXXXXXXXXXCDLKEEQLRLVSKYGCXXXXXXXXXXXNKKGDSDHTTLEDEQILQQLSN 190
                       CDLKEEQL LVSKY             + K  S+ +  EDEQILQQLS 
Sbjct: 144  LEAENRRLVALCDLKEEQLHLVSKY-------------SNKRTSEISENEDEQILQQLSA 190

Query: 191  SDGGALRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLRSNPYTRATLSPSHVAEADHVT 250
            ++GG+LRVSSTNLYLLNK T       P  Q     Q+ S           + +   ++ 
Sbjct: 191  ANGGSLRVSSTNLYLLNKTT-------PGDQQDEEDQMSSKTTVDCNGVGCNHSHQPNIH 243

Query: 251  DLRKGLPANPVAISSSVGQVPPYPFTNLNDPTSISFEQDQAPGLPAVKXXXXXXXXXXXX 310
            D        PV+             TNLNDPTSISFEQ++APGLPAVK            
Sbjct: 244  D-------KPVS-------------TNLNDPTSISFEQNEAPGLPAVKALTSMANHEHSV 283

Query: 311  XXXXXVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKEITPRKTSSIL 370
                 VA+S+PR+TEEIL +PQLLARIGQ+HG TSKQ LYTAS+LASLKE  P    + +
Sbjct: 284  QLATLVALSVPRSTEEILLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIPLTLPTNV 343

Query: 371  EQLKAKNLWEIDNVDTFLLEGLQIDIRRGSSGDFNLENPNGYKLENEYHQTKDAHPELQE 430
            + LK+ NLWE+D+V  F     + DI+  SS                   T   H     
Sbjct: 344  DMLKSTNLWEVDDVIQFFQTVFKFDIQAESS------------------TTSQDH----- 380

Query: 431  LTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFKDNVSTPGFFTSGDTLFDRRH 490
               L   EI+ L+  FF  WY+ IPI D+ EF +Y+ KFK ++  P FF     LF++R+
Sbjct: 381  ---LIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDLMDPNFFDDEKNLFNKRN 437

Query: 491  KSISYKIFACLLLTVCQMGLMSKVKRERHERGDRLNNLMTYYDRAISHVIMNPXXXXXXX 550
            KSISYKIF C+LL +CQMGL+SKVK E     ++ + LM YYD  +  ++MNP       
Sbjct: 438  KSISYKIFGCILLIICQMGLISKVKAENLPATNKYSQLMAYYDIVVRQLMMNPYFNLKST 497

Query: 551  XXXXXXXXXXXXXXXXNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTVGKIQQ 610
                            N+G+VS+VY+LRGKVVS++QQLRLHRCPSAVLG +GS V K QQ
Sbjct: 498  SIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGNGSAVSKAQQ 557

Query: 611  GERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQMIALEGKMS 670
            GERR+LFWG+YYLDVFS+LQLGVPRL+KDHEIECALPV+ +DD  VNLAGQMIALEG++S
Sbjct: 558  GERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQMIALEGRVS 617

Query: 671  PFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDNLRFQLDVNG 730
              SLS+IRF+KVLGN+LDSIFKRGM+ S+TKQ++LVHENALDNWR  LP  L+F+LDVNG
Sbjct: 618  MLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQLKFELDVNG 677

Query: 731  TINMEDLNQLKRDYLNKDTALKLNNAIFMALYFLAKIMIHLPVVATKPIIDKPQPVVDTN 790
            TINM++ N LK+   + +   K N ++ M LYF+AK MIHLPVVA +P+++ P+   +++
Sbjct: 678  TINMDEFNHLKQLDTSGNMYSKENKSL-MVLYFMAKCMIHLPVVAKRPLVNDPEQSPESS 736

Query: 791  IPGSQI-DRSSSSYVLLQQATNTFXXXXXXXXXXXXXXXXXITRTKTRFGLVSARGSLEY 849
             P +   DRSSSSYVLLQQATNT                  ++RTKTRF L+SARGSLEY
Sbjct: 737  TPSNNCGDRSSSSYVLLQQATNTLLNVFTSLRNVYPPIPINVSRTKTRFSLLSARGSLEY 796

Query: 850  TKGGALFQXXXXXXXXXXXXXXXXXXXXMPGTISWHSLKLLDMAVNLILQPPNTKPXXXX 909
            TKGGALFQ                    +PGT+SWHSLKLLDM+++LILQP NTKP    
Sbjct: 797  TKGGALFQDNKALLLDLVKELEVDKKLELPGTLSWHSLKLLDMSISLILQPANTKPEKLE 856

Query: 910  XXXXXXINYYNKLID--SHLGPTASLPTPGQTAPRKPEPAHARPIXXXXXXXXXXRHRGD 967
                  +NYYNKL +  S+LG   S  +PG  + RK                       D
Sbjct: 857  KMLQRKLNYYNKLTNRRSNLGGGRSASSPGGNSKRKL----------------------D 894

Query: 968  DNAAASMPPLLEKKVKLEAPASNMPTPPAPISALHED--VP-RVLDGHLGANSS-LAVLA 1023
            +N  ++ PP      KL   +S   TPP     L +   VP R +  H  ++S       
Sbjct: 895  ENQGSAEPP------KLTPASSKGDTPPDKKIKLEDTGFVPVRAVSQHSQSDSEKFENFQ 948

Query: 1024 AKHEPEGSLHSSAGNAITEAFQLDPILQPTPFSNTDLPSFFGVDQYAAPPELQPFPAGYA 1083
                P+        N+I EAF LDP+L   PFSNTDL +FF  +    P  L+   +G +
Sbjct: 949  PPVAPQ--------NSIAEAFHLDPVLNNNPFSNTDLNAFFNTNNGNVPAALR---SGGS 997

Query: 1084 APDKVPQAAAQGPSATAGPPLSS-KDSLFKVPSNGDFLKDYYS--GMSSAQLNSLFTXXX 1140
              +    AAA G +A +  P ++  + LFKVPSNGDFLKDYY+  G SS+Q         
Sbjct: 998  LFNIAATAAASGNNANSTAPSNTLNEGLFKVPSNGDFLKDYYNVPGASSSQ--LNLLFLN 1055

Query: 1141 XXXXXXXXXXXXXXXSDGLQQQ----PGYGFVVDASLGLAPLLAWSP--RP--------- 1185
                             G Q Q     G+GF VDAS GLAPLL WSP  +P         
Sbjct: 1056 NNASNGKPQLNGSSAHSGTQAQNNDNNGFGFAVDASWGLAPLLEWSPAGKPVDPGTCNAN 1115

Query: 1186 -----------XXXXXXXXXXXXXXXXRSFTHVNKLSSIPTL----------------MS 1218
                                       RS+T    L  +PTL                 S
Sbjct: 1116 ENSIILDTSAANMESEMATGGRLHSNTRSYTDAKNLDIVPTLPSSKQQQQQQHRLQKGAS 1175

Query: 1219 TQPPPASAPHAKLG------QPAPPDQDDGILTIPPRDQRGPRRLWNSALNQ-------- 1264
             QP  AS P  K          A   +DDG+LT+  R+ RGPRR WNS   Q        
Sbjct: 1176 QQPRSASIPTRKQSLCESNPTTATGSRDDGVLTMGTRNHRGPRRRWNSTTGQNTRTQLAT 1235

Query: 1265 --------------ARPAAALDDSISDLFRWQNSG 1285
                            P +  +DS+ DLFRWQNSG
Sbjct: 1236 MNTPQSERSKSQNIGEPGST-EDSLHDLFRWQNSG 1269

>KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P39113 Saccharomyces cerevisiae YMR280C CAT8 Zinc
            cluster transcriptional activator
          Length = 1206

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/1274 (42%), Positives = 698/1274 (54%), Gaps = 194/1274 (15%)

Query: 71   NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXX 130
            NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+SDKLSRRAFPRGY          
Sbjct: 67   NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTETLEERVRE 126

Query: 131  XXXXXXXXXXXCDLKEEQLRLVSKYGCXXXXXXXXXXXNKKGDSDHTTLEDEQILQQLSN 190
                       CDLK+EQ+ LV KY             NK+ +   T  E+EQ+L+QLS+
Sbjct: 127  LEAENRRLVALCDLKDEQMHLVYKYS-----------SNKRPEPSST--EEEQMLEQLSS 173

Query: 191  SDGGALRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLRSNPYTRATLSPSHVAEADHVT 250
            S+GG+LRVSSTNLYLLNK +   P    V +N     +  N       S  H+ E     
Sbjct: 174  SNGGSLRVSSTNLYLLNKTS---PAGHEVPENHKCQGIDCN-----HTSHPHLHE----- 220

Query: 251  DLRKGLPANPVAISSSVGQVPPYPFTNLNDPTSISFEQDQAPGLPAVKXXXXXXXXXXXX 310
                     PV+             T L+DPT+ISFEQ +APGLPAVK            
Sbjct: 221  --------KPVS-------------TTLSDPTTISFEQHEAPGLPAVKALSSMANHEYST 259

Query: 311  XXXXXVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKE----ITPRKT 366
                 VA+S+PR+TEEILF+PQLLAR+GQ+HG TSKQCLYTAS+LASLKE    + P  T
Sbjct: 260  QLACLVALSVPRSTEEILFIPQLLARLGQVHGLTSKQCLYTASLLASLKEPSQAVVP--T 317

Query: 367  SSILEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSSGDFNLENPNGYKLENEYHQTKDAHP 426
            +  L +LK  +LWEID+   F  +          S  FNL + N  +L            
Sbjct: 318  TDGLTELKCTSLWEIDDPMRFFKD----------SCKFNLGSDNDVEL------------ 355

Query: 427  ELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFKDNVST-PGFFTSGDTL 485
                   L+  EIE+LI ++F++ ++LIP+ + +EF  Y+ KFK++++  P FF   ++ 
Sbjct: 356  -------LSISEIEDLISIYFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFGKANSS 408

Query: 486  FDRRHKSISYKIFACLLLTVCQMGLMSKVKRERHERGDRLNNLMTYYDRAISHVIMNPXX 545
            F  R KSISYKIFAC+LL VCQ+G+MSKVKRE+     + + +M YY+ AI  + +NP  
Sbjct: 409  FAHRSKSISYKIFACILLVVCQLGIMSKVKREQLPAKSKFSRIMAYYNNAILALKLNPYF 468

Query: 546  XXXXXXXXXXXXXXXXXXXXXNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTV 605
                                 NVG+VS+VYELRG +VS+ QQLRLHRCPSAVLG++GST+
Sbjct: 469  SVKTTSVKTLQLMSLLLFYFLNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTM 528

Query: 606  GKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQMIAL 665
             K +QG+RR+LFWG+YYLDVFS+LQLGVPRL+KDHEIECALP+S +    V+LA Q+I L
Sbjct: 529  SKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRL 588

Query: 666  EGKMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDNLRFQ 725
            EG++S FSLS++RFSK+LGN+LDSIFKRGMT S+ +QVAL+HENALD+WR  LP NL F+
Sbjct: 589  EGQVSEFSLSLLRFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLPKNLTFE 648

Query: 726  LDVNGTINMEDLN---QLKRDYLNKDTALKLNNAIFMALYFLAKIMIHLPVVATKPIIDK 782
            LDVNGTINME+LN     K+DY    TA   +N   M LYFL K ++HLPV+A KP++  
Sbjct: 649  LDVNGTINMEELNSGSHWKKDY---STAPSCDNRTLMVLYFLVKCLVHLPVLAAKPLLGG 705

Query: 783  PQPVVDTNIPGSQID------RSSSSYVLLQQATNTFXXXXXXXXXXXXXXXXXITRTKT 836
                VDT+   +  D      RSSSSYVLLQQATNTF                 + R K 
Sbjct: 706  ASE-VDTDATLAFDDASSGADRSSSSYVLLQQATNTFLSVQSSLKSRHLPLALNLPRIKA 764

Query: 837  RFGLVSARGSLEYTKGGALFQXXXXXXXXXXXXXXXXXXXXMPGTISWHSLKLLDMAVNL 896
            RF L+SARG LEYTKGGALFQ                    +PG++SWHSL LLDMAV+L
Sbjct: 765  RFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRLEIPGSLSWHSLILLDMAVSL 824

Query: 897  ILQPPNTKPXXXXXXXXXXINYYNKLIDSHLGPTASLPTPGQTAPRKPEPAHARPIXXXX 956
            I+QPP+TK           ++YYNKL    +G +A++ +                     
Sbjct: 825  IMQPPHTKAGKLDKLLEAKLSYYNKL----MGRSANVAS--------------------- 859

Query: 957  XXXXXXRHRGDDNA----AASMPPL-------LEKKVKLEAPASNMPTPPAPISALHEDV 1005
                  R + +DN     A  + PL        EK+VKLE       T   P+   +   
Sbjct: 860  ----TKRKKEEDNTSLSNATKLTPLSSDSSSPSEKRVKLEHTDKVGET---PVGVENTGQ 912

Query: 1006 PRVLDGHLGANSSLAVLAAKHEPEGSLHSSAGNAITEAFQLDPILQPTPFSNTDLPSFFG 1065
            P   +G+   + + A  + +++P    HS+    + EAF LDP+L   PFSN DL +FF 
Sbjct: 913  P---NGNTQEHYA-ATWSNQNQP----HST----VAEAFHLDPVLNNNPFSNGDLTAFFS 960

Query: 1066 VDQYAAPPELQPFPA--GYAAPDKVPQAAAQGPSATAGPPLSS----KDSLFKVPSNGDF 1119
             D     P L    +       D+    A      T            D LF+VPSNGDF
Sbjct: 961  TDN--GMPNLSGGASMLNMVGVDQAHSTAGNDAQNTVNANSQQSTLFNDGLFRVPSNGDF 1018

Query: 1120 LKDYYS--GMSSAQLNSLFTXXXXXXXXXXXXXXXXXXSDGLQQQPGYGFVVDASLGLAP 1177
            LKDYY   G SS+QLN +                    +      PG+GF VDASLGLAP
Sbjct: 1019 LKDYYRVPGASSSQLNLMLMGSGSSGSNQRQAKQQQTNT----TDPGFGFTVDASLGLAP 1074

Query: 1178 LLAWSPRPXXXXXXXXXXXXXXXXRSFTHVNKLSSIPT----------LMSTQPPPASAP 1227
            LLAWSP                  R+ + + + S   T          L  +   PAS  
Sbjct: 1075 LLAWSPE---AAQEPIAETSDHDTRNDSGLRRKSGAETAGVLVAGHSQLADSSTDPASQQ 1131

Query: 1228 HAKLG---QPAPPDQ--DDGILTIPPRDQRGPRRLWNSALNQA-----------RPAAAL 1271
              ++G        DQ  +D  +T+P R  RGPRR WNS    A            PA+  
Sbjct: 1132 QRRVGSYDHTYAQDQSVEDSAITMPTRPHRGPRRRWNSTTGAAAITPNSDRPRNAPASET 1191

Query: 1272 DDSISDLFRWQNSG 1285
            D+++ DLFRWQNSG
Sbjct: 1192 DENLQDLFRWQNSG 1205

>KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1445

 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1012 (48%), Positives = 591/1012 (58%), Gaps = 121/1012 (11%)

Query: 72   YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXX 131
            YRVAQACDRCR+KK RCDGKRPQC+QCAAVGFECKISDKLSRRAFPRGY           
Sbjct: 177  YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYTETLEERVREL 236

Query: 132  XXXXXXXXXXCDLKEEQLRLVSKYGCXXXXXXXXXXXNKKGDS--DHTTLEDEQILQQLS 189
                      CDLKEEQL LVSKY             N K ++  +  + E+EQIL +LS
Sbjct: 237  EAENRRLVALCDLKEEQLHLVSKYS------------NSKDENGVEIPSTEEEQILHELS 284

Query: 190  NSDGGALRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLRSNPYTRATL---SPSHVAEA 246
             ++GG+LRVSSTNLYLLNKK +      P   +   +   S P  +  +   SP  ++  
Sbjct: 285  KTNGGSLRVSSTNLYLLNKKAS------PGDDSHIESSEPSIPVRKVAITAPSPRIMSPR 338

Query: 247  DHVTDLRKGLPANPVAISSSVGQVPPYPFTNLNDPTSISFEQDQAPGLPAVKXXXXXXXX 306
            + V D       N             +   N  DP  ISFEQ++APGLPA+K        
Sbjct: 339  NSVADSDPS-QTNTGNNDHIHSNNNNHNQNNSTDPYGISFEQNEAPGLPALKALSSLSKY 397

Query: 307  XXXXXXXXXVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKEITPRKT 366
                     VAVS+PRTTEEILFVPQLLARIGQ+HGFTSKQC+YTASVLASLKE      
Sbjct: 398  KQGTQLATLVAVSVPRTTEEILFVPQLLARIGQIHGFTSKQCIYTASVLASLKENNISSI 457

Query: 367  SSILEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSSGDFNLENPNGYKLENEYHQTKDAHP 426
               LE LK  NLWEID+V  F                      N +KL+   H   D   
Sbjct: 458  PPELEVLKNHNLWEIDDVLHFW--------------------KNVFKLDFMTHTAVD--- 494

Query: 427  ELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFKDNVSTPGFFT-SGDTL 485
                 T L F E+EEL+QLFF DWY LIP+FD++EF SY+ KFK NV+ P FF    DT+
Sbjct: 495  --HSSTHLNFAEVEELMQLFFQDWYELIPLFDKNEFNSYYEKFKLNVTDPNFFVRKDDTV 552

Query: 486  FDRRHKSISYKIFACLLLTVCQMGLMSKVKRERHERGDRLNNLMTYYDRAISHVIMNPXX 545
            F+ R +SISYKIF+CLL+ + QMG++SK+KR++   G +L+ LM YYD+ ++H+ +NP  
Sbjct: 553  FNNRTRSISYKIFSCLLIIIVQMGMLSKIKRDKITSG-KLSTLMKYYDKLMTHIWINPYF 611

Query: 546  XXXXXXXXXXXXXXXXXXXXXNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTV 605
                                 NVGD+S++YELRGKVVS++QQLRLHRCPSAVLG DGSTV
Sbjct: 612  NSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLHRCPSAVLGGDGSTV 671

Query: 606  GKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQMIAL 665
             K+QQGERR+LFW +YYLDVFS+LQLGVPRL+KD EIECALPV+SDDD  VNLAGQMIAL
Sbjct: 672  SKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSDDDRQVNLAGQMIAL 731

Query: 666  EGKMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDNLRFQ 725
            EGK+S FSLS+IRF+KV+GN+LDS FKRGMT S+TKQ ALVHENALDNWRH L  +L FQ
Sbjct: 732  EGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENALDNWRHGLQKDLFFQ 791

Query: 726  LDVNGTINMEDLNQLK---RDYLNKDTALKLNNAIFMALYFLAKIMIHLPVVATKPII-D 781
            LDVNGTINM++ NQ K   +    +  A   N+ + M LYF+AK MIHLPVVATKP++ +
Sbjct: 792  LDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCMIHLPVVATKPLVAE 851

Query: 782  KPQPVVDTNIPGSQIDRSSSSYVLLQQATNTFXXXXXXXXXXXXXXXXXITRTKTRFGLV 841
              Q   D       +DRS SSYVLLQQATNT                  + RTKTRFGL 
Sbjct: 852  AIQTPTDNQTENGSVDRSLSSYVLLQQATNTLLNVLTALNSIYLPLPINLARTKTRFGLF 911

Query: 842  SARGSLEYTKGGALFQXXXXXXXXXXXXXXXXXXXXMPGTISWHSLKLLDMAVNLILQPP 901
            SARGSLEYTKGGALFQ                    +PG  SWHSLKL D+++NLILQP 
Sbjct: 912  SARGSLEYTKGGALFQDNKALLLDLVKELETDKKLELPGNTSWHSLKLFDLSINLILQPV 971

Query: 902  NTKPXXXXXXXXXXINYYNKLIDSHLGPTASLPTPGQTAPRKPEPAHARPIXXXXXXXXX 961
            N+ P          INYYNKL+            P     RK +P               
Sbjct: 972  NSNPEKTEKMIQKKINYYNKLMGQ----------PTVAVKRKRDP--------------- 1006

Query: 962  XRHRGDDNAAASMPPLLEKKVKLEAPAS-----NMPTPPAPISA----LHEDVPRVLDGH 1012
               +  +N +        KKVK+E   S     N+ T     +     L +DVP+ L+ +
Sbjct: 1007 ---KATENTS--------KKVKVEDDHSQDNLHNITTGETTDTVHSEELVKDVPKELNVY 1055

Query: 1013 LGANSSLAVLAAKHEPEGSLHSSAGNAITEAFQLDPILQPTPFSNTDLPSFF 1064
                           PE          I EAFQ+DP+L    FSNTDL + F
Sbjct: 1056 ---------------PENY------TTIEEAFQMDPVLNTNLFSNTDLKTLF 1086

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 57/121 (47%), Gaps = 27/121 (22%)

Query: 1090 QAAAQGPSATAGPPLSSKDSLFKVPSNGDFLKDYY------SGMSS------------AQ 1131
            +    G S +    LS+ DSLFKVPSNGDFLKDYY      +G+S+            +Q
Sbjct: 1162 EGMKDGTSVSNLLNLSTSDSLFKVPSNGDFLKDYYINNMSNTGLSNLHTSSVNKGPSLSQ 1221

Query: 1132 LNSLF------TXXXXXXXXXXXXXXXXXXSDGLQQQP---GYGFVVDASLGLAPLLAWS 1182
            L SLF      T                   +  + QP   G+ F  DASLGLAPLLAWS
Sbjct: 1222 LGSLFMSSGSGTNLPYSNVRGESKHPSGVNLNKQRAQPAMDGFSFAADASLGLAPLLAWS 1281

Query: 1183 P 1183
            P
Sbjct: 1282 P 1282

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 28/39 (71%)

Query: 1245 TIPPRDQRGPRRLWNSALNQARPAAALDDSISDLFRWQN 1283
            +I   ++RGPRR WN+A + + P +A D S+SDL RWQN
Sbjct: 1405 SISSTNRRGPRRRWNNAASSSDPNSAGDSSVSDLLRWQN 1443

>Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR280C
            (CAT8) - Zinc-cluster protein involved in activating
            gluconeogenic genes; related to Gal4p [contig 39] FULL
          Length = 1209

 Score =  845 bits (2184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/1264 (43%), Positives = 688/1264 (54%), Gaps = 171/1264 (13%)

Query: 71   NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXX 130
            NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+SDKLSRRAFPRGY          
Sbjct: 67   NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTETLEERVRE 126

Query: 131  XXXXXXXXXXXCDLKEEQLRLVSKYGCXXXXXXXXXXXNKKGDSDHTTLEDEQILQQLSN 190
                       CDLK+EQ+ LVSKY             NK+ +   T  E+ ++L+QLSN
Sbjct: 127  LEAENRRLVALCDLKDEQMHLVSKYS-----------SNKRHEPSST--EEGRMLEQLSN 173

Query: 191  SDGGALRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLRSNPYTRATLSPSHVAEADHVT 250
            SDGG+LRVSSTNLYLLNK T A              Q  S  +    L  +H +      
Sbjct: 174  SDGGSLRVSSTNLYLLNKTTPA-------------VQDGSELHKCQGLGCNHASHPH--- 217

Query: 251  DLRKGLPANPVAISSSVGQVPPYPFTNLNDPTSISFEQDQAPGLPAVKXXXXXXXXXXXX 310
                 L   PV+             T+L+DP +ISFEQ++APGLPAVK            
Sbjct: 218  -----LHEKPVS-------------TSLSDPAAISFEQNEAPGLPAVKALNTMANHEYSA 259

Query: 311  XXXXXVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKEI--TPRKTSS 368
                 VA+S+PR+T+EILF+PQLLAR+GQ+HG TSKQCLY+AS+LA+LKE   T  + S 
Sbjct: 260  QLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCLYSASLLAALKESSQTSFQGSP 319

Query: 369  ILEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSSGDFNLENPNGYKLENEYHQTKDAHPEL 428
              + LK K+LWEID+  TF   G +          FNL +            +KDA    
Sbjct: 320  DYKDLKDKSLWEIDDCMTFFKTGCK----------FNLTS------------SKDAE--- 354

Query: 429  QELTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFKDNVST-PGFFTSGDTLFD 487
                 LT  EIEELI ++F + ++LIP+ + +EF  Y+ KFK N++T P FF +    F 
Sbjct: 355  ----CLTISEIEELISIYFGECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFA 410

Query: 488  RRHKSISYKIFACLLLTVCQMGLMSKVKRERHERGDRLNNLMTYYDRAISHVIMNPXXXX 547
            +R KSISYKIFAC+LL +CQ GLM+KVKRE+    ++ + LM+YY  A+  +  NP    
Sbjct: 411  QRSKSISYKIFACILLVICQFGLMAKVKREQLPTKNKFSLLMSYYSNALLALKTNPYFSV 470

Query: 548  XXXXXXXXXXXXXXXXXXXNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTVGK 607
                               NVG+VS+VYE+RG VVS+ QQLRLHRCPSAVLG++GST+ K
Sbjct: 471  KNTSIQTLQLLSLLLFYYLNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSK 530

Query: 608  IQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQMIALEG 667
             +QG+RR+LFWG+YYLDVF +LQLGVPRL+KDHEIECALP+S      V+LA Q+I LEG
Sbjct: 531  SEQGDRRLLFWGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEG 590

Query: 668  KMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDNLRFQLD 727
            ++S  SLS++RFSK+LGN+LDSIFKRGMT S  +QVAL+HENALDNWR  LP NL F+LD
Sbjct: 591  QVSELSLSLLRFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELD 650

Query: 728  VNGTINMEDLN---QLKRDYLNKDTALKLNNAIFMALYFLAKIMIHLPVVATKPII---- 780
            VNGTI +E+L    Q  +D+    ++ K    I M LYFL K ++HLPV+A KP++    
Sbjct: 651  VNGTIKIEELTGSAQNNQDFTKNASSDK---KILMLLYFLVKCLVHLPVLAAKPLLGGSS 707

Query: 781  --DK-PQPVVDTNIPGSQIDRSSSSYVLLQQATNTFXXXXXXXXXXXXXXXXXITRTKTR 837
              DK   P  D     S  DRSSSSYVLLQQATNTF                 + R K R
Sbjct: 708  EPDKDATPAFDD--ASSGADRSSSSYVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKAR 765

Query: 838  FGLVSARGSLEYTKGGALFQXXXXXXXXXXXXXXXXXXXXMPGTISWHSLKLLDMAVNLI 897
            F L+SARG LEYTKGGALFQ                    +PG++SWHSL LLDMA  LI
Sbjct: 766  FALLSARGILEYTKGGALFQDNKALLLEVVKELEASKKLELPGSLSWHSLILLDMATLLI 825

Query: 898  LQPPNTKPXXXXXXXXXXINYYNKLIDSHLGPTASLPTPGQTAPRKPEPAHARPIXXXXX 957
            +QPP TK           +NYYNKL+       ++L + G+   RK E   A        
Sbjct: 826  MQPPQTKTDKLDKLLETRLNYYNKLMGR-----STLTSNGK---RKNEENDATSKVSKLT 877

Query: 958  XXXXXRHRGDDNAAASMPPLLEKKVKLEAPASNMPTPPAPISALHEDVPRVLDGHLGANS 1017
                  +   D           K++K+E+  S+   P    S  H D  +        N 
Sbjct: 878  PLSSEYNTPSD-----------KRIKVESIGSSGNVPSNSESVHHFDDIQ--------ND 918

Query: 1018 SLAVLAAKHEPEGSLHSSAGNAITEAFQLDPILQPTPFSNTDLPSFF----GVDQYAAPP 1073
              +     + P+        NAI EAF LDP+L   PFSN DL +FF    G+ Q     
Sbjct: 919  KFSTNWPSNNPQ-------PNAIAEAFHLDPVLNGNPFSNGDLTAFFNSDNGIPQIGGGS 971

Query: 1074 ELQPFPAGYAAPDKVPQAAAQGPSATAGP---PLSSKDSLFKVPSNGDFLKDYYS--GMS 1128
             +    AG  A +          +A  GP     +  D LF+VPSNGDFLKDYY   G S
Sbjct: 972  SVLNL-AGIGAANSNELNNNNNEAAGGGPRKVATTVNDGLFRVPSNGDFLKDYYRIPGAS 1030

Query: 1129 SAQLNSLFTXXXXXXXXXXXXXXXXXXSDGLQQQPGYGFVVDASLGLAPLLAWS---PRP 1185
            S+QLN +F                          PG+GF VDASLGLAPLLAWS   P+P
Sbjct: 1031 SSQLNLMFMGPGNTGANQNAPNNQKNNF----TVPGFGFTVDASLGLAPLLAWSPEAPQP 1086

Query: 1186 XXXXXXXXXXXXXXXXRSFTHVNKLS---SIPTLMSTQPPPASAPHAK-------LGQPA 1235
                             S T +   +   S PT + +Q   ++  H +         Q  
Sbjct: 1087 SMPEIAQNADRRDSDPLSRTRLPSATIPASDPTHVISQ--DSNNVHLREQYRSNSFNQLY 1144

Query: 1236 PPDQ--DDGILTIPPRDQRGPRRLWNSAL-------NQARP-----AAALDDSISDLFRW 1281
              DQ  DD  +TIP R  RGPRR WNS+        N  RP     + + +++  DLFRW
Sbjct: 1145 AQDQSLDDTAITIPTRSHRGPRRRWNSSNGTTVITPNSDRPRNPPSSESENENYKDLFRW 1204

Query: 1282 QNSG 1285
            QNSG
Sbjct: 1205 QNSG 1208

>TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.845
            YMR280C
          Length = 1301

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/1318 (40%), Positives = 673/1318 (51%), Gaps = 216/1318 (16%)

Query: 71   NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXX 130
            N RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISDKLSRRAFPRGY          
Sbjct: 95   NLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGYTETLEERVRE 154

Query: 131  XXXXXXXXXXXCDLKEEQLRLVSKYGCXXXXXXXXXXXNKKGDSDHTTLEDEQILQQLSN 190
                       CD+KE+Q+ LVS +             NKK    +    DEQ+LQ+L+ 
Sbjct: 155  LEAENRRLVALCDIKEQQIHLVSHF-----------PTNKKKIGGN----DEQMLQELTG 199

Query: 191  SDGGALRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLRSNPYTRATLSPSHVAEADHVT 250
            ++ G LR+SSTNL+LLNK           +    P  + SN     T  P H     H  
Sbjct: 200  ANNGRLRISSTNLFLLNK----------ARDGKQPATI-SNGDDHMT-KPDHEHTGKHRC 247

Query: 251  D---LRKGLPANPVAISSSVGQVPPYPFTNLNDPTSISFEQDQAPGLPAVKXXXXXXXXX 307
            D       L + PV+             TNLNDPT+ISFEQ++APGLPAVK         
Sbjct: 248  DELDCNNKLHSKPVS-------------TNLNDPTAISFEQNEAPGLPAVKALTSMATRE 294

Query: 308  XXXXXXXXVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKEITPR--- 364
                    VA+S+PR+TEEILF+PQLLARI Q+HGFTSKQCLY+ S+LASLK   P    
Sbjct: 295  QSTQLATLVALSVPRSTEEILFIPQLLARIIQIHGFTSKQCLYSVSLLASLKNNLPGPQL 354

Query: 365  KTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIRR-GSSGDFNLENPNGYKLENEYHQTKD 423
                 L+ LK  NLWE+DN+D F  E L+ +I R G S D                    
Sbjct: 355  VKWDELDYLKTTNLWEVDNLDKFFHETLKFNILRPGVSDD-------------------- 394

Query: 424  AHPELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFKDNVST-PGFFTSG 482
                  E   L+ +EI+EL+ LFFD W   IPI D+ EF SY+ K K ++ST PG F  G
Sbjct: 395  -----GESLGLSIKEIDELVNLFFDSWAVHIPILDKEEFFSYYDKLKKDISTQPGLFQEG 449

Query: 483  DTLFDRRHKSISYKIFACLLLTVCQMGLMSKVKRERHERGDR-LNNLMTYYDRAISHVIM 541
             + F RR+K ISYKIFAC+L TVCQMGL++KVK E+    D     L +YY RAIS + +
Sbjct: 450  PSNFARRNKIISYKIFACILFTVCQMGLLTKVKGEKITSADSPYVKLTSYYHRAISLIYL 509

Query: 542  NPXXXXXXXXXXXXXXXXXXXXXXXNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSD 601
            NP                       N G+VS +YELRG+VVS+ QQLRLHRCPSAVLG  
Sbjct: 510  NPYFGVLTTSLQSLQFLSLLLFYFVNTGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGS 569

Query: 602  GSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQ 661
            GST+ K +QG+RRVLFWG+YYLDVFS+LQLGVPRL+KD EIECALPV+ +DD  V+LAGQ
Sbjct: 570  GSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVAENDDREVSLAGQ 629

Query: 662  MIALEGKMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDN 721
            MI LEG++S FSL+IIRF+KVLGN+LD++FKRGMTES++K++AL+HENALDNWR  LP  
Sbjct: 630  MIRLEGRVSQFSLAIIRFAKVLGNILDTVFKRGMTESVSKKLALIHENALDNWRRGLPAE 689

Query: 722  LRFQLDVNGTINMEDLNQLKRDYLNKDTALKLNNAIFMALYFLAKIMIHLPVVATKPI-- 779
            L F+++VNGTINM+  N++K+   N  T   +   + +  YFLAK MIHLPVVAT+P+  
Sbjct: 690  LIFEIEVNGTINMDKFNEMKQ---NNATVENVEQMVLLVSYFLAKCMIHLPVVATRPLPS 746

Query: 780  -------IDKPQPVVDTNIPGSQIDRSSSSYVLLQQATNTFXXXXXXXXXXXXXXXXXIT 832
                   I + + V D N   +   RSSSSYVLLQQATNT                  + 
Sbjct: 747  SDDPNSDIKEEEEVNDKNGESNFAIRSSSSYVLLQQATNTMLNVLESLKSIYLPLPFNVA 806

Query: 833  RTKTRFGLVSARGSLEYTKGGALFQXXXXXXXXXXXXXXXXXXXXMPGTISWHSLKLLDM 892
            RTK RF L+SARGSLEY KGGALF                     +PG ISWH LKLLDM
Sbjct: 807  RTKARFALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRKLEIPGVISWHGLKLLDM 866

Query: 893  AVNLILQPPNTKPXXXXXXXXXXINYYNKLIDSHLGPTASLPTPGQTAPRKPEPAHARPI 952
             ++L+LQPPNTK           +NYY++++   +  T+SL        R          
Sbjct: 867  TISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRPILKTSSLRQEANGKRRNSSD------ 920

Query: 953  XXXXXXXXXXRHRGDDN-AAASMPPL--------LEKKVKLEAPASNMPTPPAPISALHE 1003
                      R   ++N  A ++ P+        +EKK+KLE  +S+  T  A +   + 
Sbjct: 921  ------DKLSRSGTEENFRATNLTPISSKSDGSPVEKKIKLEDESSD--TSNALVDKSYT 972

Query: 1004 DVPRVLDGHLGANSSLAVLAAKHEPEGSLHSSAGNAITEAFQLDPILQPTPFSNTDLPSF 1063
            D                + ++ ++P+  + +S   AI EA  LDP+L     S  DL +F
Sbjct: 973  D---------------DLSSSANQPQ--VPASTQTAIAEALHLDPVLNNNILSVADLAAF 1015

Query: 1064 F-------GVDQYAAPPELQPFPAGYAAPDKVPQAAAQGPSATAGPPLSSKDSLFKVPSN 1116
            F       G +Q+++      F   +   +K P  AA    A     ++  D LF+VPSN
Sbjct: 1016 FGGNMPAAGGNQHSSYTNQNDFAPKHMRKEKEP--AAFSDLAHKKSSVTGVDGLFRVPSN 1073

Query: 1117 GDFLKDYYSGMSSAQLN-SLFTXXXXXXXXXXXXXXXXXXSDGLQ--------------- 1160
             DFL D Y    ++ +N +LF                     G+                
Sbjct: 1074 ADFLMDEYYPSGTSHINLTLFNNNANNHDDTFGLSDGHGKDTGVNTNFNVKGGHQSTNHS 1133

Query: 1161 -----------QQPG------------YGFVVDASLGLAPLLAWSP-------------- 1183
                        Q G            + F VDASLGLAPLL WSP              
Sbjct: 1134 HLTNFNDRLQGNQLGFTNSGNMNSGSDFNFAVDASLGLAPLLDWSPEMHTHGKTVSHASD 1193

Query: 1184 RPXXXXXXXXXXXXXXXXRSFTHVNKLSSIPTLMSTQPPPASAPHAKLGQPAPPDQDDGI 1243
            R                      VNK  S+P        P  A H     PA   +    
Sbjct: 1194 RSGIILDSSIPQSEDALSTLADRVNKTQSVPV-------PTLASHGYKNLPATQSEQLA- 1245

Query: 1244 LTIPPRDQRGPRRL---------------WNSALNQAR--PAAALDDSISDLFRWQNS 1284
              I   D  GP  L               +NS  N +   P  A   ++S+LF WQNS
Sbjct: 1246 HGIDSNDDNGPAMLTLGSRRGPRRRRQMDYNSTSNTSNRVPQEA---NLSNLFHWQNS 1300

>Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {ON}
            similar to Ashbya gossypii ABL121C
          Length = 1577

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/736 (57%), Positives = 488/736 (66%), Gaps = 39/736 (5%)

Query: 434  LTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFKDNVSTPGFFTSGDTLFDRRHKSI 493
            L+FQE +E+I LFFD+WYSLIPIFD+SEF++YW KFK+NVSTP FFTSGDT+F +RHKSI
Sbjct: 594  LSFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFTSGDTIFAKRHKSI 653

Query: 494  SYKIFACLLLTVCQMGLMSKVKRERHERGDRLNNLMTYYDRAISHVIMNPXXXXXXXXXX 553
            SYKIFACLL+TV QMGLM+KVKRE   R  +LN LMTYYDRA+SH+I NP          
Sbjct: 654  SYKIFACLLVTVVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSIQ 713

Query: 554  XXXXXXXXXXXXXNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTVGKIQQGER 613
                         NVGD+SN+YELRGKVVS  QQLRLHRCPSAVLG DG TV +IQQGER
Sbjct: 714  SLQLLSLLLFYFLNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGER 773

Query: 614  RVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQMIALEGKMSPFS 673
            RVLFWGVYYLDVF+SLQLGVPRL+KDHEIECALPVSSD D  VNLAGQMI+LEGKMSPFS
Sbjct: 774  RVLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFS 833

Query: 674  LSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDNLRFQLDVNGTIN 733
            LS+IRFSKVLGNVLDSIFKRGMT S+TK+VALVHENALDNWRH LPD LRFQLDVNGTIN
Sbjct: 834  LSVIRFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTIN 893

Query: 734  MEDLNQLKRDYLNKDTALKLN--NAIFMALYFLAKIMIHLPVVATKPIIDKPQPVVDTNI 791
            M++ NQLK +YLN D + K N  N IFM LYFLAK MIH+PVVA KP +D    V + N 
Sbjct: 894  MDEFNQLKHEYLNNDNS-KFNKENFIFMTLYFLAKSMIHIPVVAGKPPVDT--SVQEKND 950

Query: 792  PG--SQIDRSSSSYVLLQQATNTFXXXXXXXXXXXXXXXXXITRTKTRFGLVSARGSLEY 849
            P    Q DRSSSSY+LLQQATNTF                 I+R KTRFGL SARGSLEY
Sbjct: 951  PAISRQADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEY 1010

Query: 850  TKGGALFQXXXXXXXXXXXXXXXXXXXXMPGTISWHSLKLLDMAVNLILQPPNTKPXXXX 909
            TKGGALFQ                    +PGTISWHSLKL DMA+NLILQPPNTKP    
Sbjct: 1011 TKGGALFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTKPEKEE 1070

Query: 910  XXXXXXINYYNKLIDSHLGPTASLPTPGQTAPRKPEPAHARPIXXXXXXXXXXRHRGDDN 969
                  I+YYNKLID  +G  AS+ T   +A  + +    +                  N
Sbjct: 1071 KLLQKKISYYNKLIDHSVGMHASVIT---SAAIQHQRQQQQQQQQQQQQQQLHYKENKGN 1127

Query: 970  AAASMPPL---------LEKKVKLEAPASNMPTPPAPISALHEDVPRVLDGHLGANSSLA 1020
             A   P +         L K+VK+E P+  +PT   P+SALHED   +L   L +N+ ++
Sbjct: 1128 GAKRKPEIGSSTTTNMSLNKRVKMEEPSVKIPTSNGPLSALHEDDSEMLGKSLRSNTIVS 1187

Query: 1021 VL--AAKHEPEGSLHSSAGNAITEAFQLDPILQPTPFSNTDLPSFF------GVDQYAAP 1072
             +    K E E  +  SA NAI EAFQLDP+L  TPFS+TDL SF           +A  
Sbjct: 1188 DVPTGQKMESEIPVSMSATNAIAEAFQLDPVLHATPFSSTDLTSFLNGEVVTNASMFADT 1247

Query: 1073 PELQPFPAGYA---------APDKVPQAAAQGPSATAGPP---LSSKDSLFKVPSNGDFL 1120
                    G           + + +   ++ G    +GP    LSSKD LFKVPSNGDFL
Sbjct: 1248 MHTTGIGGGLTDVSGHNGLPSNNSLLNMSSIGFGIGSGPSLANLSSKDGLFKVPSNGDFL 1307

Query: 1121 KDYYSGMSSAQLNSLF 1136
            KDYYSGMSSAQL SLF
Sbjct: 1308 KDYYSGMSSAQLASLF 1323

 Score =  344 bits (882), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 204/396 (51%), Positives = 235/396 (59%), Gaps = 59/396 (14%)

Query: 71  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXX 130
           +YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY          
Sbjct: 122 SYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLEERVRE 181

Query: 131 XXXXXXXXXXXCDLKEEQLRLVSKYG---------------------------------- 156
                      CDLKEEQLRLVSKY                                   
Sbjct: 182 LEAENRRLVALCDLKEEQLRLVSKYSAGSVGVGVGGPVTAGTTVGNRSSVNGAVNESASS 241

Query: 157 -----CXXXXXXXXXXXNKK-GDSDHTTLEDEQILQQLSNSDGGALRVSSTNLYLLNKKT 210
                            NKK   SD TT E+++ILQQLS SDGG LRVSSTNLYLLNKKT
Sbjct: 242 TVGSIATAGSTAGLAHQNKKCAGSDSTTPEEDRILQQLSKSDGGTLRVSSTNLYLLNKKT 301

Query: 211 AAFP-LVQPVQQN------LSPTQLRSNPYTRATLSPSHVAEADHVTDLRK------GLP 257
           +    L+ P   N      + P   +    +++T S SHVA++D+  + +K       LP
Sbjct: 302 SGQQQLLLPGSANKSEAFPIQPDSYKLQQRSQSTAS-SHVADSDNPAEFQKEHLQPRTLP 360

Query: 258 ANPVAISSSVGQVPP----YPFTNLNDPTSISFEQDQAPGLPAVKXXXXXXXXXXXXXXX 313
             PVA S+++   PP    Y   NLNDPTSISFEQDQAPGL AVK               
Sbjct: 361 NIPVA-STAIPSAPPGVTAYSLANLNDPTSISFEQDQAPGLSAVKALSTMANHEQSSQLA 419

Query: 314 XXVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKEITPRKTSSILEQL 373
             VA+SIPRTTEEILFVPQLLARIGQ+HGFTSKQCLYTASVLASLKEI P +TS  LE L
Sbjct: 420 TLVAMSIPRTTEEILFVPQLLARIGQVHGFTSKQCLYTASVLASLKEIVPYQTSPELELL 479

Query: 374 KAKNLWEIDNVDTFLLEGLQIDIRRGSSGDFNLENP 409
           ++K+LWEID+VD+FL +GL+      +S + N E P
Sbjct: 480 RSKSLWEIDDVDSFLSKGLRFSFPSATSAENNNEEP 515

 Score =  102 bits (254), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 82/181 (45%), Gaps = 56/181 (30%)

Query: 1161 QQPGYGFVVDASLGLAPLLAWSPRPXXXXXXXXXXX-------XXXXXRSFTHVNKLSSI 1213
            QQ GYGFVVDASLGLA LL WSP+P                       RSFT VNKL  I
Sbjct: 1397 QQQGYGFVVDASLGLASLLGWSPKPGNDDAIILGSDPKDDSEPKLNTARSFTTVNKLDMI 1456

Query: 1214 PTLMSTQPPPASAPH--------------------------------AKLGQPA----PP 1237
            PTLMST     +AP                                 A+ G P+     P
Sbjct: 1457 PTLMSTTKSTTTAPSDAGLPSSIRPNQNPASIKLVQNPLPLSTRKQFAQAGNPSRYPFSP 1516

Query: 1238 D--QDDGILTIPPRDQRGPRRLWNSAL-----------NQARPAAALDDSISDLFRWQNS 1284
            D  Q+DG+LTI  R  RGPRR WN+             N  + +  LDD+I+DLF+WQNS
Sbjct: 1517 DLLQEDGMLTINTRSPRGPRRYWNNTASSTDQPQIHKNNTQQQSQQLDDNINDLFKWQNS 1576

Query: 1285 G 1285
            G
Sbjct: 1577 G 1577

>ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa]
            {ON} similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
            ABL121Cp and similar to YMR280C uniprot|P39113
            Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
            transcriptional activator
          Length = 1250

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/1104 (42%), Positives = 589/1104 (53%), Gaps = 157/1104 (14%)

Query: 71   NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXX 130
            N RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD+LSRRAFPRGY          
Sbjct: 97   NLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYTETLEERVRE 156

Query: 131  XXXXXXXXXXXCDLKEEQLRLVSKYGCXXXXXXXXXXXNKKGDSDHTTLEDEQILQQLSN 190
                       CD+KE+Q+ L S+               ++ D       DE++L++L +
Sbjct: 157  LEAENRRLVALCDIKEQQIHLFSQ---------QHSPGGRRKD-------DERMLRELQS 200

Query: 191  SDGGALRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLRSNPYTRATLSPSHVAEADHVT 250
            ++GG+L +SSTNLYLLN  +      Q  QQ    TQ +  P               HV 
Sbjct: 201  ANGGSLNISSTNLYLLNTGSHQRQGPQGPQQQEQLTQQKRQP---------------HVC 245

Query: 251  DLRKGLPANPVAISSSVGQVPPYPF-TNLNDPTSISFEQDQAPGLPAVKXXXXXXXXXXX 309
            D   GL           G++   P  TNLNDPTS+SFEQ +APGLPAV+           
Sbjct: 246  D---GL--------CCAGKLHVKPVSTNLNDPTSVSFEQSEAPGLPAVQALTSVATREQS 294

Query: 310  XXXXXXVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKEITPR---KT 366
                  VA+S+PR+TEEILF+PQLLARI Q++GFTSKQCLYT S+L+SLK   P      
Sbjct: 295  NQLATLVALSVPRSTEEILFIPQLLARIRQIYGFTSKQCLYTVSLLSSLKSSLPEPHLVK 354

Query: 367  SSILEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSSGDFNLENPNGYKLENEYHQTKDAHP 426
               LE L + NLWE+D+++ F  E  +  +   S        P+ YK   +         
Sbjct: 355  HEPLETLASTNLWEMDDLEQFFAEIFKFKLESKS--------PSSYKGGAQ--------- 397

Query: 427  ELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFKDNVSTPGFFTS----G 482
                   L   EIEELI +FF+     IPI  + EF  Y+ +FK+NV     F      G
Sbjct: 398  -------LNLSEIEELISIFFEHSSIHIPILVKDEFYHYFNQFKENVLQNLEFLKTPLQG 450

Query: 483  DTLFDRRHKSISYKIFACLLLTVCQMGLMSKVKRERHERGDRLNNLMTYYDRAISHVIMN 542
              L  RR K ISYKIF C++L +CQ+GL+SK+K E      + + L +YY +AIS V MN
Sbjct: 451  PALTARRGKIISYKIFGCIILMLCQLGLLSKIKAENLGATSKHHRLASYYHKAISLVYMN 510

Query: 543  PXXXXXXXXXXXXXXXXXXXXXXXNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSDG 602
            P                       N+G+VS +YELRG+VVS+ QQLRLHRCPSAVLG  G
Sbjct: 511  PYFGVLSTSLQSLQFLSLVLFYFLNIGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGGAG 570

Query: 603  STVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQM 662
            ST+ K +QG+RRVLFWG+YYLDVFS+LQLGVPRL+KD EIECALPV+ +DD  VNLAGQ 
Sbjct: 571  STMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADNDDRTVNLAGQQ 630

Query: 663  IALEGKMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDNL 722
            I LEG+++ +SL+IIRFSKVLGN+LDSIFKRGMTES+TKQV+L+HENALDNWRH LP  L
Sbjct: 631  IRLEGQVTNYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLIHENALDNWRHGLPKEL 690

Query: 723  RFQLDVNGTINMEDLNQLKRDYLNKDTALKLNNAIFMALYFLAKIMIHLPVVATKPIIDK 782
             F+LDVNGTIN+++ N+LK+  +   T  +  N   + +YFLAK MIHLPVVAT+P+   
Sbjct: 691  IFELDVNGTINIDEFNRLKQMNV---TVERSENMTLLVMYFLAKCMIHLPVVATRPL--- 744

Query: 783  PQPVVDTNIPG-----------------------SQIDRSSSSYVLLQQATNTFXXXXXX 819
              P  D+N  G                       +  DRSSSSYVLLQQATNT       
Sbjct: 745  --PTNDSNDTGETSNATSNGNNVRARDPSTERNQAAADRSSSSYVLLQQATNTMLNVLES 802

Query: 820  XXXXXXXXXXXITRTKTRFGLVSARGSLEYTKGGALFQXXXXXXXXXXXXXXXXXXXXMP 879
                       I+RTK RF L+SARGSLEYTKGGALF                     +P
Sbjct: 803  LKTLFLPLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEEDRKLDLP 862

Query: 880  GTISWHSLKLLDMAVNLILQPPNTKPXXXXXXXXXXINYYNKLIDSHLGPTASLPTPGQT 939
            G ISW+SLKLLDM++NL+LQPPNT+           +NYYN+L+     PT         
Sbjct: 863  GVISWNSLKLLDMSINLLLQPPNTEVGKLDRLLKKKLNYYNRLMGR---PTV-------- 911

Query: 940  APRKPEPAHARPIXXXXXXXXXXRHRGDDNAAASMPPLLEKKVKLEAPASNMPT-PPAPI 998
               K EPA                   +D  AA    + E  + L  P        PAP+
Sbjct: 912  ---KQEPA-----SKGHDLTPASSKDEEDTPAAKRIKIEETSIPLAVPQQQQHMQAPAPV 963

Query: 999  SALHEDVPRVLDGHLGANSSLAVLAAKHEPEGSLHSSAGNAITEAFQLDPILQPTPFSNT 1058
                +  P+                 + +P+         A  EA QLDP+L     SN 
Sbjct: 964  MVQEKQQPQP------QPQPQPQPQPQLQPQPQQLQLPQTAFAEALQLDPVLN----SNV 1013

Query: 1059 DLPSFFGVDQYAAPPELQPFPAGYAAPDKVP-QAAAQGPSATAGPPLSSKDS-----LFK 1112
                     Q A P  L      Y  P   P Q      +    P L ++ S     LFK
Sbjct: 1014 SF-------QNAPPTTL------YDGPHDQPHQYQHHAQTQPQDPHLDTRSSDKLHGLFK 1060

Query: 1113 VPSNGDFLKDYYSGMSSAQLNSLF 1136
            VPS  DFL D     +++QLN L 
Sbjct: 1061 VPSTADFLMD---DSANSQLNFLL 1081

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 18/20 (90%)

Query: 1164 GYGFVVDASLGLAPLLAWSP 1183
            G+ F VDASLGLAPLLAW+P
Sbjct: 1146 GFNFAVDASLGLAPLLAWTP 1165

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {ON}
            Anc_8.845 YMR280C
          Length = 1246

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/1042 (38%), Positives = 532/1042 (51%), Gaps = 138/1042 (13%)

Query: 71   NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXX 130
            NYRV QACDRCRSKKTRCDG++PQCSQCAAVGFECK+SDKL R+A+PRGY          
Sbjct: 25   NYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIEERVRE 84

Query: 131  XXXXXXXXXXXCDLKEEQLRLVSKYGCXXXXX--XXXXXXNKKGDSDHTTLEDEQILQQL 188
                       CDLKE+Q+ LV+KY                   DSD T     ++ +  
Sbjct: 85   LEAENRRLLALCDLKEQQISLVAKYSSNKSNILPTDRCIIELNSDSDCTNNIKGELNKDR 144

Query: 189  SNS-----DGGALRVSSTNLYLLNKKTAAFPLV---QPVQQN------------LSPTQL 228
             N      +   L +S TNLYLLN+      L    +  QQN                +L
Sbjct: 145  QNDVTTIPNSLPLNISQTNLYLLNQTQKKAELNNGNKMFQQNQSNVSTSSSSSPFFANKL 204

Query: 229  RSN-----PYTRATLSPSHVAEADHVTDLRKGLPANPVAISSSV---GQVPPYPF-TNLN 279
             SN     P +  T+SP      +  +++R         +   +    ++ P P  TN N
Sbjct: 205  NSNGTIRSPESNTTVSPLESHTKNLKSNIRNNNTTTTTHVCDGICCTDKLHPQPVATNYN 264

Query: 280  DPTSISFEQDQAPGLPAVKXXXXXXXXXXXXXXXXXVAVSIPRTTEEILFVPQLLARIGQ 339
            DPTSISFEQ +APGL A K                 V++S+PR+TEEILF+PQLLA+I Q
Sbjct: 265  DPTSISFEQSEAPGLVAAKALKSINNQEEATQLAILVSLSVPRSTEEILFIPQLLAKIRQ 324

Query: 340  MHGFTSKQCLYTASVLASLKEITPRKTSSILEQ-------LKAKNLWEIDNVDTFLLEGL 392
            +HGFTSKQCLYT S+L+SLK   P   S  L         LK  N+W+I++++ F  + L
Sbjct: 325  VHGFTSKQCLYTVSLLSSLKNSLPSPKSDFLMDNSQNSLLLKNTNIWQINDLNVFFTDLL 384

Query: 393  QIDIRRGSSGDFNLENPNGYKLENEYHQTKDAHPELQELTPLTFQEIEELIQLFFDDWYS 452
            + +I   S                               T L+F +I++L  L+F+ W +
Sbjct: 385  KFNISNDSKTS----------------------------TLLSFDDIDDLTNLYFNHWSN 416

Query: 453  LIPIFDRSEFESYWVKFKDNVSTPGFFTSGDTLFDRRHKSISYKIFACLLLTVCQMGLMS 512
            LIP+ +  EF + +  FK    +   F  G+   + R     YK F C L+ +CQMGL+ 
Sbjct: 417  LIPVLNEEEFFNRYNNFKIQCQS---FIQGNQSNNLR----DYKFFGCFLMVMCQMGLLI 469

Query: 513  KVKRERHERGDRLNNLMTYYDRAISHVIMNPXXXXXXXXXXXXXXXXXXXXXXXNVGDVS 572
            K+K   H+  + L  ++TYY +    +  NP                       N+G++ 
Sbjct: 470  KLKE--HKSNNSLFKILTYYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIE 527

Query: 573  NVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSSLQLG 632
             +YELRG ++S+  QLRLHRCPSAVL   GST+ K++Q  RR+LFW +YYLDVFSSLQLG
Sbjct: 528  QIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLG 587

Query: 633  VPRLMKDHEIECALPVSSDDDNHVNL---AGQMIALEGKMSPFSLSIIRFSKVLGNVLDS 689
            VPRL+KD+EIECALPV    DN   +    G  I LEG +S  SL++ RF+KVLGN++DS
Sbjct: 588  VPRLLKDYEIECALPV----DNTTTMDAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDS 643

Query: 690  IFKRGMTESMTKQVALVHENALDNWRHALPDNLRFQLDVNGTINMEDLNQLKRDYLNKDT 749
            IFKR M+ S+++QVAL+HENALDNWR  LP+  +F+LDVNGTIN+ DL     D  N DT
Sbjct: 644  IFKRNMSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDL-----DTENSDT 698

Query: 750  ALKLNNAIFMALYFLAKIMIHLPVVATKPIIDKPQPVVDTNIPGSQIDRSSSSYVLLQQA 809
                     +  YFLAK MIHLPV +TK  +D    V +T       DR S+SYV LQQ+
Sbjct: 699  IF------LIVFYFLAKCMIHLPVCSTK--VDLEDKVTETGNDVIYNDRFSTSYVSLQQS 750

Query: 810  TNTFXXXXXXXXXXXXXXXXXITRTKTRFGLVSARGSLEYTKGGALFQXXXXXXXXXXXX 869
            TNT                  ++RT TRF L+SA+GSL+Y KGG+LF             
Sbjct: 751  TNTMLNALRMIRDKYLPMPFNVSRTLTRFTLISAKGSLDYIKGGSLFIDNKKLLLDCVQD 810

Query: 870  XXXXXXXXMPGTISWHSLKLLDMAVNLILQPPNTKPXXXXXXXXXXINYYNKLIDSHLGP 929
                    +PG ISWHSLKLLD+ +NL LQ  NTKP          +NYYNKL+   L  
Sbjct: 811  IEANRKLDLPGIISWHSLKLLDLTLNLFLQNSNTKPEKIEKLLQKKLNYYNKLMGKPL-- 868

Query: 930  TASLPTPGQTAPRKPEPAHARPIXXXXXXXXXXRHRGDDNAAASMPPLLEKKVKLEAPAS 989
              +LP   +T                       +++G++N   S      KKVK E    
Sbjct: 869  VKNLPIQKRT----------------------NQNKGNNNDEPS-----RKKVKKELEND 901

Query: 990  NMPTPPAPISALHEDVPRVLDGHLGANSSLAVLAAK-HEPEGSLHSSAGNAITEAFQLDP 1048
                    I++LH   P ++D      S  A L  K +    +   +  N   EA Q+DP
Sbjct: 902  --------INSLH---PILIDNEGVTPSDAAPLINKTNSNTNNPVVTTQNEFAEALQVDP 950

Query: 1049 ILQPT--PFSNTDLPSFFGVDQ 1068
            IL      FSN DL + F  D+
Sbjct: 951  ILNSDYYQFSNLDLATLFNSDK 972

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 52/130 (40%), Gaps = 24/130 (18%)

Query: 1165 YGFVVDASLGLAPLLAWSPRPXXXXXXXXXXXXXXXXRSFTHVNKLSSIPTLMSTQPPPA 1224
            + +++D SLGLAPLLA   +P                +           P ++S+Q   A
Sbjct: 1130 FSYIIDGSLGLAPLLANPFKPTGENNLVNVSSIETTGQCIN--------PKVLSSQSSDA 1181

Query: 1225 SAPHAKLGQPAPPDQDDGILTIPPRDQRGPRRLWNSALNQARPAAAL---DD-------S 1274
            +     L      + ++G +   PR   G   L  + +N     + L   DD       +
Sbjct: 1182 NKDDTDL------NLENGAVQRRPRRYNGNFGLGGTGMNSNFSVSDLLRPDDQKKREKET 1235

Query: 1275 ISDLFRWQNS 1284
            ++DLF WQNS
Sbjct: 1236 LNDLFNWQNS 1245

>Suva_13.468 Chr13 complement(809712..812654,812694..814007) [4257
           bp, 1418 aa] {ON} YMR280C (REAL)
          Length = 1418

 Score =  569 bits (1467), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 368/951 (38%), Positives = 497/951 (52%), Gaps = 144/951 (15%)

Query: 72  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXX 131
           YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISDKL R+A+P+GY           
Sbjct: 63  YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVREL 122

Query: 132 XXXXXXXXXXCDLKEEQLRLVSKYGCXXXXXXXXXXXNKKGDSDHTTLEDEQILQQLSNS 191
                     CD+KE+Q+ LVS+              N   D+    L+D          
Sbjct: 123 EAENKRLLALCDIKEQQINLVSQ------SRPPTSLDNTVSDNFKQDLKD---------- 166

Query: 192 DGGALRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLRSN--PYTRATLSPS-HVAEADH 248
               L +SSTN+YLLN         Q V + L   ++ +N    T   L+ S  + + DH
Sbjct: 167 --APLNLSSTNIYLLN---------QTVNKQLQNGKIDTNRSDSTMGLLATSPPLPQKDH 215

Query: 249 VTD---LRKGLPANPVAISSSVGQVPPYPFTNLNDPTSISFEQDQAPGLPAVKXXXXXXX 305
           V D       L A P +             T+LNDPT+ISFEQ++APGLPAVK       
Sbjct: 216 VCDGVSCTNNLHAKPTS-------------TSLNDPTAISFEQNEAPGLPAVKALKSMTT 262

Query: 306 XXXXXXXXXXVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLK------ 359
                     V++SIPR+TEEILF+PQLL RI Q+ GF SKQCLYT S+L+SLK      
Sbjct: 263 HQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAP 322

Query: 360 ---------EITPRKTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSSGDFNLENPN 410
                    +I     S  L   +  +L E  ++  FL+  L+ DI   S+    ++N  
Sbjct: 323 KLLLSSTSTKIKENDDSKFLNTFETTSLAEFGDLKKFLI-SLKFDINSFSNQQPEVQNN- 380

Query: 411 GYKLENEYHQTKDAHPELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFK 470
             K +N+                L+  EI+EL+ LFF  W + + I +   F  Y+  F 
Sbjct: 381 --KSDNDL---------------LSLNEIKELLHLFFKFWSNQVSILNNDHFLLYFNNFV 423

Query: 471 DNVSTPGF---FTSGDTLFDRRHKSISYKIFACLLLTVCQMGLMSKVKRERHE------R 521
           + +         T+G     + H + +++IFA  LL + QMGL+ KVKRE+ +      +
Sbjct: 424 EVIKALPLELKKTNG----TKTHATTNHQIFALKLLIMLQMGLLIKVKREKIKDTVPGNQ 479

Query: 522 GDRLNNLMTYYDRAISHVIMNPX-XXXXXXXXXXXXXXXXXXXXXXNVGDVSNVYELRGK 580
             +   LM YY +  S +  NP                        NVGD+  +Y LRG+
Sbjct: 480 NSKFAKLMVYYHQVSSIIPKNPYFLNMSTTSLPSLQLLSLTSFYFLNVGDIPAIYGLRGR 539

Query: 581 VVSLTQQLRLHRCPSAVLGSDGSTV-GKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKD 639
           +VS++QQLRLHRCPSAVL    + V  + +Q ERR+LFW VYY+DVF+SLQLGVPRL+KD
Sbjct: 540 IVSMSQQLRLHRCPSAVLSVHSNPVLQRFEQSERRLLFWAVYYIDVFASLQLGVPRLLKD 599

Query: 640 HEIECALPVSSDDDNHVNLAG---------QMIALEGKMSPFSLSIIRFSKVLGNVLDSI 690
            +IECALP+ SD +    LA          + I L+G++S FSL IIRF+K+LGN+LDSI
Sbjct: 600 FDIECALPI-SDVEFEDQLASENEKTKNKTKKIQLQGQVSSFSLQIIRFAKILGNILDSI 658

Query: 691 FKRGMT-ESMTKQVALVHENALDNWRHALPDNLRFQLDVNGTINMEDLNQLKRDYLNKDT 749
           FKRGM  E +T +VALVHENALDNWR+ LP+   FQ+ VNGT+N++D+    R   +++T
Sbjct: 659 FKRGMMDERVTSEVALVHENALDNWRNQLPEMYYFQITVNGTVNLDDI----RANNSRNT 714

Query: 750 ALKLNNA--------IFMALYFLAKIMIHLPVVATKP----------------------I 779
             K +          + +  YFLAK MIHLPV+ATKP                      I
Sbjct: 715 EAKFDRKDIICFEKNVLLLFYFLAKSMIHLPVIATKPLPKTVDNSTKKKHSMFNNDTKSI 774

Query: 780 IDKPQPVVDTNIPGSQIDRSSSSYVLLQQATNTFXXXXXXXXXXXXXXXXXITRTKTRFG 839
            ++   VVD ++    I R+SSSY++LQQATN                   ++RT  RF 
Sbjct: 775 NNQDHSVVDVDMTSPAI-RTSSSYIILQQATNATLTLFQSINSVYLPLPLNVSRTLIRFS 833

Query: 840 LVSARGSLEYTKGGALFQXXXXXXXXXXXXXXXXXXXXMPGTISWHSLKLLDMAVNLILQ 899
           L+ ARGSLEYTKGGALF                     +PG  SWH+LKL DM +NL+L+
Sbjct: 834 LLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGVASWHTLKLFDMTINLLLK 893

Query: 900 PPNTKPXXXXXXXXXXINYYNKLIDSHLGPTASLPT-PGQTAPRKPEPAHA 949
            PN K           +NYYN+L+   L PT +  + P  ++  K  PA+ 
Sbjct: 894 APNVKVERLDKFLEKKLNYYNRLMG--LPPTTTTSSEPLFSSQSKNTPANG 942

>Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] {ON}
            YMR280C (REAL)
          Length = 1433

 Score =  558 bits (1438), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 408/1149 (35%), Positives = 544/1149 (47%), Gaps = 188/1149 (16%)

Query: 72   YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXX 131
            YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISDKL R+A+P+GY           
Sbjct: 64   YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVREL 123

Query: 132  XXXXXXXXXXCDLKEEQLRLVSKYGCXXXXXXXXXXXNKKGDSDHTTLEDEQILQQLSNS 191
                      CD+KE+Q+ LVS+              N    S    L+D          
Sbjct: 124  EAENKRLLALCDIKEQQISLVSQ------SRPPTSMDNTANGSFKQELKD---------- 167

Query: 192  DGGALRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLRS-------NPYTRATLSPSHVA 244
                L +SSTN+YLLN         Q V + L   ++ S       N    A L P    
Sbjct: 168  --APLNLSSTNIYLLN---------QTVNKQLQNGKMDSDNSNTVMNSLAAAPLPP---- 212

Query: 245  EADHVTDLRKGLPANPVAISSSVGQVPPYPFTNLNDPTSISFEQDQAPGLPAVKXXXXXX 304
            + DHV D         ++ ++ +   P    T+LNDPT+ISFEQD+APGLPAVK      
Sbjct: 213  QKDHVCD--------GISCTNHLHVKPTS--TSLNDPTAISFEQDEAPGLPAVKALKLMT 262

Query: 305  XXXXXXXXXXXVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKEITPR 364
                       V++SIPR+TEEILF+PQLL RI Q+ GF SKQCLYT S+L+SLK   P 
Sbjct: 263  THQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPA 322

Query: 365  ----------------------KTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSSG 402
                                    S+  ++ +  NL E  ++  FL+  L+ DI   S  
Sbjct: 323  PRLLPPSTSTKLKEKGEDKILDDDSAFFKKFQTTNLSEFVDLKGFLV-SLKFDIDSFSKQ 381

Query: 403  DFNLENPNGYKLENEYHQTKDAHPELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSEF 462
              NL N              D   EL  LT     EI+EL+ LFF  W + +PI +   F
Sbjct: 382  SENLPN--------------DHDNELLSLT-----EIKELLHLFFKFWSNQVPILNNDHF 422

Query: 463  ESYWVKFKDNVSTPGFFTSGDTLFDRRHKSISYKIFACLLLTVCQMGLMSKVKRERHER- 521
              Y+  F + V           + +    + ++++FA  L  +  MGL+ K+K E+ +  
Sbjct: 423  LLYFNNFVEVVKDLSSANLKTNVTNTSIVTTNHELFALKLSMMLLMGLLVKIKMEKIKYT 482

Query: 522  -----GDRLNNLMTYYDRAISHVIMNPX-XXXXXXXXXXXXXXXXXXXXXXNVGDVSNVY 575
                   +   LM YY +    +  NP                        NVGD+S +Y
Sbjct: 483  VPKNPNSKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLASFYYLNVGDISAIY 542

Query: 576  ELRGKVVSLTQQLRLHRCPSAVLGSDGSTV-GKIQQGERRVLFWGVYYLDVFSSLQLGVP 634
             +RG++VS+ QQLRLHRCPSAVL    + V  K +Q ERR+LFW +YY+DVF+SLQLGVP
Sbjct: 543  GVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYVDVFASLQLGVP 602

Query: 635  RLMKDHEIECALPVSSDDDNHVNLAGQM-------------IALEGKMSPFSLSIIRFSK 681
            RL+KD +IECALP+S      V    Q+             I L+G++S FSL IIRF+K
Sbjct: 603  RLLKDFDIECALPISD-----VEYKDQLFMENKKTNKKAKKIQLQGQVSSFSLQIIRFAK 657

Query: 682  VLGNVLDSIFKRGMT-ESMTKQVALVHENALDNWRHALPDNLRFQLDVNGTINMEDL--- 737
            +LGN+LDSIFKRGM  E +T +VALVHENALDNWR  LP    FQ+ VNGT+N++++   
Sbjct: 658  ILGNILDSIFKRGMMDERITSEVALVHENALDNWRSQLPKMYYFQITVNGTVNLDEIRVN 717

Query: 738  --NQLKRDYLNKDTALKLNNAIFMALYFLAKIMIHLPVVATKPI---ID----KPQPVVD 788
                ++  +  KD  L     I +  YFLAK MIHLPV+ATKP+   ID    K Q V  
Sbjct: 718  DSKNIETRFEKKDIIL-FEKKILLLFYFLAKSMIHLPVIATKPLPKNIDNGTKKKQSVFS 776

Query: 789  TNIPGSQ------ID--------RSSSSYVLLQQATNTFXXXXXXXXXXXXXXXXXITRT 834
             +  GS       +D        R+SSSY++LQQATN                   ++RT
Sbjct: 777  NDSKGSNDQDHMIVDVDMTSPAIRTSSSYIILQQATNATLMIFQTINWMYIPLPLNVSRT 836

Query: 835  KTRFGLVSARGSLEYTKGGALFQXXXXXXXXXXXXXXXXXXXXMPGTISWHSLKLLDMAV 894
              RF L+ ARGSLEYTKGGALF                     +PGT SWH+LKL DM +
Sbjct: 837  LIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGTASWHTLKLYDMTI 896

Query: 895  NLILQPPNTKPXXXXXXXXXXINYYNKLIDSHLGPTASL-PTPGQTAPRKPEPAHARPIX 953
            NL+L+ PN K           +NYYN+L+   L  T S+ P  G  +   PE    + I 
Sbjct: 897  NLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPLATTTSIKPILGSQSKDSPETRPRKSIV 956

Query: 954  XXXXXXXXXRHRGDDNAAASMPPLLEKKVKLEAPASNMPTPPAPISALHEDVPRVLDGHL 1013
                      +  DDN   +  P        ++P  N       +     D  R +D   
Sbjct: 957  KRENPEYEYLYGKDDNKKNNSGP-------DQSPIENTSNGSKRL-KYETDTKRGVDT-- 1006

Query: 1014 GANSSLAVLAAKHEPEGSLHSSAGNAITEAFQLDPILQPTPFSNTDLPSFFG-------- 1065
                    +      E   H++     T        L P  FSNTDL + F         
Sbjct: 1007 ------GSIFKSQNAENFQHNNKKTMSTSN------LFPFSFSNTDLTALFTHPEGANGA 1054

Query: 1066 ---------VDQY---AAPPELQPFPAGYAAPDKVPQAAAQGPSATAGPPLSSKDSLFKV 1113
                      D++   AA   ++      AAP      +   P+ T   P+   D+LF +
Sbjct: 1055 NNNNSNFNGCDRFSTDAADANIENLGFLNAAPFLQAGNSKTDPNMTNNKPM-HMDALFSL 1113

Query: 1114 PSNGDFLKD 1122
            PSN D +KD
Sbjct: 1114 PSNLDLMKD 1122

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
           CAT8Zinc cluster transcriptional activator necessary for
           derepression of a variety of genes under
           non-fermentative growth conditions, active after diauxic
           shift, binds carbon source responsive elements
          Length = 1433

 Score =  549 bits (1414), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 359/924 (38%), Positives = 490/924 (53%), Gaps = 134/924 (14%)

Query: 72  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXX 131
           YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISDKL R+A+P+GY           
Sbjct: 64  YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVREL 123

Query: 132 XXXXXXXXXXCDLKEEQLRLVSKYGCXXXXXXXXXXXNKKGDSDHTTLEDEQILQQLSNS 191
                     CD+KE+Q+ LVS+                   S   T  D  I     + 
Sbjct: 124 EAENKRLLALCDIKEQQISLVSQ-------------------SRPQTSTDNTINGNFKHD 164

Query: 192 DGGA-LRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLRSNPYTRATLSP----SHVAEA 246
              A L +SSTN+YLLN         Q V + L   ++  +    A +SP          
Sbjct: 165 LKDAPLNLSSTNIYLLN---------QTVNKQLQNGKMDGDNSGSA-MSPLGAPPPPPHK 214

Query: 247 DHVTDLRKGLPANPVAISSSVGQVPPYPFTNLNDPTSISFEQDQAPGLPAVKXXXXXXXX 306
           DH+ D         V+ ++ +   P    T+LNDPT+ISFEQD+APGLPAVK        
Sbjct: 215 DHLCD--------GVSCTNHLHVKPTS--TSLNDPTAISFEQDEAPGLPAVKALKSMTTH 264

Query: 307 XXXXXXXXXVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKEITP--- 363
                    V++SIPR+TEEILF+PQLL RI Q+ GF SKQCLYT S+L+SLK   P   
Sbjct: 265 QRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPR 324

Query: 364 -------------------RKTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSSGDF 404
                                 S+ +++ ++ NL E  ++  FL+           S  F
Sbjct: 325 LLAPSTSTKLKEKDEDKKLDDDSAFVKRFQSTNLSEFVDLKKFLI-----------SLKF 373

Query: 405 NLENPNGYKLENEYHQTKDAHPELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFES 464
           N+   N +  ++E    K A+ +  EL  LT  EI+EL+ LFF  W + +PI +   F  
Sbjct: 374 NI---NSFSKQSE----KPANDQDDELLSLT--EIKELLHLFFKFWSNQVPILNNDHFLI 424

Query: 465 YWVKFKD---NVSTPGFFTSGDTLFDRRHKSISYKIFACLLLTVCQMGLMSKVKRERHER 521
           Y+  F +   ++ST    T+  T   +   + +++IFA  LL + QMGL+ K+K E+ + 
Sbjct: 425 YFNNFVEVVKHLSTENLETNNTT---KSTVTTNHEIFALKLLMMLQMGLLVKIKMEKIKY 481

Query: 522 ------GDRLNNLMTYYDRAISHVIMNPXXXXXXXXXXXXXXXXXXXX-XXXNVGDVSNV 574
                   +   LM YY +    +  NP                        NVGD+S +
Sbjct: 482 TVPKNPKAKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLASFYYLNVGDISAI 541

Query: 575 YELRGKVVSLTQQLRLHRCPSAVLGSDGSTV-GKIQQGERRVLFWGVYYLDVFSSLQLGV 633
           Y +RG++VS+ QQLRLHRCPSAVL    + V  K +Q ERR+LFW +YY+DVF+SLQLGV
Sbjct: 542 YGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYVDVFASLQLGV 601

Query: 634 PRLMKDHEIECALPVS--------SDDDNHVNLAGQMIALEGKMSPFSLSIIRFSKVLGN 685
           PRL+KD +IECALP+S        S ++   +   + I L+G++S FSL IIRF+K+LGN
Sbjct: 602 PRLLKDFDIECALPISDVEYKDQLSMENEKADKKAKKIQLQGQVSSFSLQIIRFAKILGN 661

Query: 686 VLDSIFKRGMT-ESMTKQVALVHENALDNWRHALPDNLRFQLDVNGTINMEDL---NQLK 741
           +LDSIFKRGM  E +T +VALVHENALDNWR+ LP+   FQ+ VNGT+N++++   NQ  
Sbjct: 662 ILDSIFKRGMMDERITSEVALVHENALDNWRNQLPEMYYFQITVNGTVNLDEIRATNQRN 721

Query: 742 RDY-LNKDTALKLNNAIFMALYFLAKIMIHLPVVATKPI-------IDKPQPVVDTNIPG 793
            +   +K   +     I +  YFLAK MIHLPV+ATKP+         K Q + + +  G
Sbjct: 722 TETKFDKKDIILFEKKILLLFYFLAKSMIHLPVIATKPLPKNVDNATKKKQSMFNNDSKG 781

Query: 794 S--------QID------RSSSSYVLLQQATNTFXXXXXXXXXXXXXXXXXITRTKTRFG 839
           +         +D      R+SSSY++LQQATN                   ++RT  RF 
Sbjct: 782 ATNQDHMILDVDMTSPAIRTSSSYIILQQATNATLTIFQAINSMYLPLPLNVSRTLIRFS 841

Query: 840 LVSARGSLEYTKGGALFQXXXXXXXXXXXXXXXXXXXXMPGTISWHSLKLLDMAVNLILQ 899
           L+ ARGSLEYTKGGALF                     +PG  SWH+LKL DM++NL+L+
Sbjct: 842 LLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGIASWHTLKLFDMSINLLLK 901

Query: 900 PPNTKPXXXXXXXXXXINYYNKLI 923
            PN K           +NYYN+L+
Sbjct: 902 APNVKVERLDKFLEKKLNYYNRLM 925

 Score = 33.5 bits (75), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 1218 STQPPPASAPHAKLGQPAPPDQDDGILTIPPRDQRGPRRLWNSALNQARPAAALD----- 1272
            S+Q    SA   +L  P+   Q     + P    RGPRR   +  N  R  ++       
Sbjct: 1361 SSQENSKSATGNQLDTPSTLFQMRRTSSGPSASHRGPRRPQKNRYNTDRSKSSGGGSSNT 1420

Query: 1273 DSISDLFRWQNS 1284
            D++SDLF+WQN+
Sbjct: 1421 DNVSDLFQWQNA 1432

>Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa]
           {ON} YMR280C (REAL)
          Length = 1432

 Score =  540 bits (1391), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 364/956 (38%), Positives = 498/956 (52%), Gaps = 153/956 (16%)

Query: 72  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXX 131
           YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC+ISDKL R+A+P+GY           
Sbjct: 63  YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVREL 122

Query: 132 XXXXXXXXXXCDLKEEQLRLVSKYGCXXXXXXXXXXXNKKGDSDHTTLEDEQILQQLSNS 191
                     CD+KE+Q+ LVS+                      T+L+        SN 
Sbjct: 123 EAENKRLLALCDIKEQQISLVSQ------------------SRPSTSLD--------SNV 156

Query: 192 DGGA--------LRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLRSNPYTRA----TLS 239
           DG          L +SSTN+YLLN         Q V + L   ++ ++    A      S
Sbjct: 157 DGNCKKELKDAPLNLSSTNIYLLN---------QTVNKQLQSGKMDNDNSDAAIDSLAAS 207

Query: 240 PSHVAEADHVTDLRKGLPANPVAISSSVGQVPPYPFTNLNDPTSISFEQDQAPGLPAVKX 299
           PS   + DHV D         V+ ++ +   P    T+L+DPT+ISFEQ++APGLPAVK 
Sbjct: 208 PSPPPK-DHVCD--------GVSCTNRLHVKPTS--TSLSDPTAISFEQNEAPGLPAVKA 256

Query: 300 XXXXXXXXXXXXXXXXVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLK 359
                           V++SIPR+TEEILF+PQLL RI Q+ GF SKQCLYT S+L+SLK
Sbjct: 257 LKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGFNSKQCLYTVSLLSSLK 316

Query: 360 ----------------------EITPRKTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIR 397
                                 + TP   S+ L+  ++ +L E  ++  FL+  L+ DI 
Sbjct: 317 NRLPAPSILLPSTSTNSKEKNEDKTPNDDSAFLKTFQSTSLSEFVDLKKFLI-SLKFDID 375

Query: 398 RGSSGDFNLENPNGYKLENEYHQTKDAHPELQELTPLTFQEIEELIQLFFDDWYSLIPIF 457
             S                     K A+    +L  LT  EI+EL+ LFF  W + +PI 
Sbjct: 376 SFSK-----------------QPEKQANGHDSDLLSLT--EIKELLHLFFKFWSNQVPIL 416

Query: 458 DRSEFESYWVKFKDNVSTPGFFTSGDTLFDRRHKSISYKIFACLLLTVCQMGLMSK---- 513
           +   F  Y+  F + +      ++      + + + +++IF   LL + QMGL+ K    
Sbjct: 417 NNDHFLLYFNNFVEIIKDFSLISTKANSTTKNNVTTNHEIFTLKLLMMLQMGLLIKIKKD 476

Query: 514 -----VKRERHERGDRLNNLMTYYDRAISHVI-MNPX-XXXXXXXXXXXXXXXXXXXXXX 566
                V R  + +  R   LM+YY + IS +I  NP                        
Sbjct: 477 KIKDTVPRNSNAKYIR---LMSYYHQ-ISLIIPKNPYFLNMSTTSLPSLQLLSLASFYYL 532

Query: 567 NVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTV-GKIQQGERRVLFWGVYYLDV 625
           NVGD+S +Y +RG++VS+ QQLRLHRCPSAVL    + V  K +Q ERR+LFW +YY+DV
Sbjct: 533 NVGDISAIYGIRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYVDV 592

Query: 626 FSSLQLGVPRLMKDHEIECALPVS--------SDDDNHVNLAGQMIALEGKMSPFSLSII 677
           F+SLQLGVPRL+KD +IECALP+S        S ++  +    + I L+G++S FSL II
Sbjct: 593 FASLQLGVPRLLKDFDIECALPISDVEYKDQLSMENEKMKNKAKKIQLQGQVSSFSLQII 652

Query: 678 RFSKVLGNVLDSIFKRGMT-ESMTKQVALVHENALDNWRHALPDNLRFQLDVNGTINMED 736
           RF+K+LGN+LDSIFKRGM  E ++ +VALVHENALDNWR+ LP+   F++ VNGT+N+++
Sbjct: 653 RFAKILGNILDSIFKRGMMDERISSEVALVHENALDNWRNQLPEMYYFKITVNGTVNLDE 712

Query: 737 L-----NQLKRDYLNKDTALKLNNAIFMALYFLAKIMIHLPVVATKP-------IIDKPQ 784
           +       ++  +  KD  L     I +  YFLAK MIHLPV+ATKP       ++ K Q
Sbjct: 713 IRANNSRDIETPFETKDIIL-FEKKILLLFYFLAKSMIHLPVIATKPLSKNVDNVMKKKQ 771

Query: 785 PVVDTNIPGSQ------ID--------RSSSSYVLLQQATNTFXXXXXXXXXXXXXXXXX 830
            + + +  G+       +D        R+SSSY++LQQATN                   
Sbjct: 772 SMFNNDSKGTNNHDHMAVDVDMTSPAIRTSSSYIILQQATNATLTIFQSINWMYLPLPLN 831

Query: 831 ITRTKTRFGLVSARGSLEYTKGGALFQXXXXXXXXXXXXXXXXXXXXMPGTISWHSLKLL 890
           ++RT  RF L+ ARGSLEYTKGGALF                     +PG  SWH+LKL 
Sbjct: 832 VSRTLVRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLELPGIASWHTLKLF 891

Query: 891 DMAVNLILQPPNTKPXXXXXXXXXXINYYNKLIDSHLGPTASL-PTPGQTAPRKPE 945
           DM +NL+L+ PN K           +NYYN+L+   L  T SL P  G  +   PE
Sbjct: 892 DMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPLATTTSLKPLFGFQSKNSPE 947

>NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845
          Length = 1495

 Score =  530 bits (1364), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 325/891 (36%), Positives = 463/891 (51%), Gaps = 78/891 (8%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXXX 132
           R++QACDRCRSKKTRCDGKRPQCSQCA VGFECK+SDKL R+++PRGY            
Sbjct: 103 RISQACDRCRSKKTRCDGKRPQCSQCAIVGFECKVSDKLQRKSYPRGYTETLEEKIRELQ 162

Query: 133 XXXXXXXXXCDLKEEQLRLVSKYGCXXXXXXXXXXXNKKGDSDHTTLEDEQILQQLSN-- 190
                     +LK+ QL + S               NKKG+ +   ++         N  
Sbjct: 163 TENKRLLAIYNLKQNQLSVSSSSS--------STSPNKKGNGNDCAVQSNSTSTSAINDT 214

Query: 191 SDGGALRVSSTNLYLLNKKTAAFPLVQ------PVQQNLSPTQLRSNPYTRATLSPSHVA 244
           ++ G+   +   +     ++   PL        P+Q N   T      +T  T++P +  
Sbjct: 215 NENGSNETAMKEII----QSQLIPLTNINSVHDPIQNNDDNTHTDCCNHTIKTINPDNNN 270

Query: 245 E-ADHVTDLRKGLPANPVAISSSVGQVPPYPF-TNLNDPTSISFEQDQAPGLPAVKXXXX 302
             + H T+ +     N          + P P  TN N   SISFEQ++APGL  VK    
Sbjct: 271 NYSTHTTNGKLHRDTND-------HHLHPKPVSTNSNGLNSISFEQNEAPGLSTVKALKS 323

Query: 303 XXXXXXXXXXXXXVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKEIT 362
                        V+++IPR+TEEILF+PQ+LA++ Q  GFTSK CLYT S+L+SLK   
Sbjct: 324 MVNDEKNTQLATLVSLAIPRSTEEILFIPQILAKVRQNFGFTSKHCLYTVSLLSSLKSFL 383

Query: 363 PRKTSSI---------LEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSSGDFNLENPNGYK 413
               +SI         LE LK  NLW+ + +  F    L++D       D +LE  N  K
Sbjct: 384 SNSNNSISAASADNKNLETLKNTNLWKFNALFQFFTAFLKLDFL-----DSSLEKQNKGK 438

Query: 414 LENEYHQTKDAHPELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFKDNV 473
              + +   +       ++PL+  EI+EL++LFF +W   + + +  EF  Y+  FK ++
Sbjct: 439 KNGKVNNNNNNSANQDGISPLSSSEIDELLKLFFQNWSDFVLMINEKEFYQYYSVFKSDL 498

Query: 474 STPGFF-TSGDTLFDRRHKSISYKIFACLLLTVCQMGLMSKVKRERHERGDR-------L 525
                   S  TL       ++YKIF  ++L  CQMGL+SK+K   +    +       L
Sbjct: 499 QNNNISKMSLSTL-------MNYKIFGLIILLFCQMGLLSKIKLSSNNTKSKNFKQQYHL 551

Query: 526 NNLMTYYDRAISHVIMNPXXXXXXXXXXXXXXXXXXXXXXXNVGDVSNVYELRGKVVSLT 585
             +M YY   I+ ++ N                        ++G++SN+YELR KV+S++
Sbjct: 552 KKVMNYYHNLINKLMWNEFFKISNVTLQSLKLLSLILFYNLHMGNISNIYELRSKVISMS 611

Query: 586 QQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECA 645
           QQLRLHRCPSAVL      + K++Q  RR+LFW +YYLD+F+SLQLGVPRL+KDHEIECA
Sbjct: 612 QQLRLHRCPSAVLCGSTLKIHKLEQSNRRLLFWNIYYLDIFASLQLGVPRLLKDHEIECA 671

Query: 646 LPVSSDDDNHVNLAGQ------------MIALEGKMSPFSLSIIRFSKVLGNVLDSIFKR 693
           LP+  D D+  +   Q             I LEG +S  SL IIR+S+++GN+LD IFKR
Sbjct: 672 LPIPMDTDSKSDNQSQRSAATNAENDDNKIKLEGCVSHLSLVIIRYSQIVGNILDMIFKR 731

Query: 694 GMTESMTKQVALVHENALDNWRHALPDNLRFQLDVNGTINMEDLNQLKRDYLNKDTA-LK 752
            MTESMTK +AL+H +ALD+WR+ LP NL+F L+VNG+I++     + +  LN++    +
Sbjct: 732 NMTESMTKSIALIHIHALDDWRNTLPSNLKFDLNVNGSIDLSSF--IDQQNLNEEEQRTQ 789

Query: 753 LNNAIFMALYFLAKIMIHLPVVATKPIIDKPQPVVDTNIPGSQIDRSSSSYVLLQQATNT 812
               + + LYF    MIH+PVVA++P+     P+V+ +      DRSSSSY+ LQ ATNT
Sbjct: 790 QQKLLVIFLYFFGVNMIHMPVVASRPL-----PLVENDSLNQIPDRSSSSYIALQHATNT 844

Query: 813 FXXXXXXXXXXXXXXXXXITRTKTRFGLVSARGSLEYTKGGALFQXXXXXXXXXXXXXXX 872
                             ++RT  RF ++SA G L++ KGG+LF                
Sbjct: 845 MLNVLDLLSPTYVPLPINMSRTMVRFSMISACGMLDFIKGGSLFLENKALLAQVVKNIET 904

Query: 873 XXXXXMPGTISWHSLKLLDMAVNLILQPPNTKPXXXXXXXXXXINYYNKLI 923
                +PG ISWHSLKL D+ + L  Q  N K            NYYN+L+
Sbjct: 905 DRFLDLPGVISWHSLKLFDLTLTLFFQNTNIKLEKLDKLLEKKSNYYNRLM 955

 Score = 36.2 bits (82), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 47/131 (35%), Gaps = 18/131 (13%)

Query: 1163 PGYGFVVDASLGLAPLLAWSPR---------PXXXXXXXXXXXXXXXXRSFTHVNKLSSI 1213
            P Y + VDASLGLAPLL    R         P                 +  + N + SI
Sbjct: 1373 PDYNYFVDASLGLAPLLETQRRHNSFPETSQPLVNTSNAMNLGNASLSSTANNNNTMPSI 1432

Query: 1214 PTLMSTQPPPASAPHAKLGQPAPPDQDDGILTIPPRDQRGPRRLWNSALNQARPAAALDD 1273
               +    PP  +   +  +  P +    IL        G      S LN  R      +
Sbjct: 1433 ANNVGYNNPPLLSSSKQKPRHLPTNDTGDILNF-----NGDL----SNLNFRRDVRRKRE 1483

Query: 1274 SISDLFRWQNS 1284
            ++ DLF WQNS
Sbjct: 1484 NLEDLFSWQNS 1494

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 42/106 (39%), Gaps = 11/106 (10%)

Query: 1029 EGSLHSSAGNAITEAFQLDPILQPTPF--SNTDLPSFFG-VDQYAAPPELQPFP------ 1079
            + S +++  N   +A Q DPIL    F  SN DL S F  VD+ +        P      
Sbjct: 1085 QNSNYANIQNQFADALQFDPILNSNSFNFSNLDLSSLFKTVDKDSQKTNNLQVPTQNSDQ 1144

Query: 1080 --AGYAAPDKVPQAAAQGPSATAGPPLSSKDSLFKVPSNGDFLKDY 1123
              A       VP  + Q          + +  L K+PS  DF KDY
Sbjct: 1145 PVAANGISTTVPTTSIQSFPTPKSLIQNDQILLSKIPSFNDFFKDY 1190

>KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.845
            YMR280C
          Length = 1237

 Score =  469 bits (1206), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 327/948 (34%), Positives = 452/948 (47%), Gaps = 141/948 (14%)

Query: 277  NLNDPTSISFEQDQAPGLPAVKXXXXXXXXXXXXXXXXXVAVSIPRTTEEILFVPQLLAR 336
            NLNDPTS+SFEQ++APGL A +                 V++SIPR+TEEILF+PQLLA+
Sbjct: 299  NLNDPTSVSFEQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAK 358

Query: 337  IGQMHGFTSKQCLYTASVLASLKEITP-----------RKTSSILEQLKAKNLWEIDNVD 385
            I Q+ GFTSKQCLYT S+L+SLK+  P            + SS  + L + NLW ++N+ 
Sbjct: 359  IRQVFGFTSKQCLYTVSLLSSLKDDLPPPNLLKNSKMILQNSSNFDILTSVNLWHLENLS 418

Query: 386  TFLLEGLQIDIRRGSSGDFNLENPNGYKLENEYHQTKDAHPELQELTPLTFQEIEELIQL 445
             F    L+++I            P+    ++++ +  D H        L   EI+EL+ L
Sbjct: 419  NFFQNVLKLNIL-----------PD----DDDHLKKNDDH--------LALSEIDELVAL 455

Query: 446  FFDDWYSLIPIFDRSEFESYWVKFKDNVSTPGFFTSGDTLFDRRHKSISYKIFACLLLTV 505
            +F  W   IPIF+  EF S +  FK ++       +G +  +     ++ KIF CLL  +
Sbjct: 456  YFKYWSDSIPIFNEKEFNSNYRVFKADLMK--LSKNGPSSLEN---ILNIKIFGCLLTVI 510

Query: 506  CQMGLMSKVKRERHERGDRLNNLMTYYDRAISHVIMNPXXXXXXXXXXXXXXXXXXXXXX 565
            CQMG++ K K  ++ +  +   L++YY   +  +  N                       
Sbjct: 511  CQMGILIKYKNFKN-KSPKFEKLLSYYHHLMYVLPKNSYFGVITTSIKTVQILSLILFYH 569

Query: 566  XNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDV 625
             N GD+  +Y+LRG ++S+ QQLRLHRCPSAVL   GS + +++QG RR LFW +YYLDV
Sbjct: 570  LNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDV 629

Query: 626  FSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQMIALEGKMSPFSLSIIRFSKVLGN 685
            F SLQLGVPRL+KDHEIECALP+SS+  N   + G  + LEG MS FSLS++R +KVLGN
Sbjct: 630  FCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDG--VQLEGTMSEFSLSVVRCAKVLGN 687

Query: 686  VLDSIFKRGMTESMTKQVALVHENALDNWRHALPDNLRFQLDVNGTINMEDLNQLKRDYL 745
            +LDSIFKR M+ES+T+QV  +HENALD+WR  LP   +F+L+ NG +++E LN       
Sbjct: 688  ILDSIFKRNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNANGMVDLEHLNH------ 741

Query: 746  NKDTALKLNNAIFMALYFLAKIMIHLPV-VATKPIIDKPQPVVDTNIPGSQIDRSSSSYV 804
                     N I + L+FL K MI++P+  A   + + P+   D  +          S+ 
Sbjct: 742  --------ENLILVLLFFLVKSMIYMPLSSAITELANNPKVKNDYYM------NHKVSHT 787

Query: 805  LLQQATNTFXXXXXXXXXXXXXXXXXITRTKTRFGLVSARGSLEYTKGGALFQXXXXXXX 864
             LQQ+ N                    +RT TRF LVSA+GSLEY KGG LF+       
Sbjct: 788  SLQQSINALLSVFKNINNQYLPLPLNSSRTMTRFALVSAKGSLEYKKGGLLFEDNKVLLL 847

Query: 865  XXXXXXXXXXXXXMPGTISWHSLKLLDMAVNLILQPPNTKPXXXXXXXXXXINYYNKLID 924
                         +PG I WHSLKLLD+AVNL L  P              INYYNK++ 
Sbjct: 848  SVIQEIEKDRKLELPGIIPWHSLKLLDLAVNLFLLGPTINSDKLEKFLQKKINYYNKIMG 907

Query: 925  SHLGPTASLPTPGQTAPRKPEPAHARPIXXXXXXXXXXRHRGDDNAAASMPPLLEKKVKL 984
              L    SLP+      +  E                 + R             +++VK 
Sbjct: 908  KPL--ITSLPSSKTKRKQSKEDLFT-----------ANKKR-------------KQQVKT 941

Query: 985  EAPASNMPTPPAPISALHEDVPRVLDGHLGANSSLAVLAAKHEPEGSLHSSAGNAITEAF 1044
            E     +   P  +  L                       K E +G+   S  +A  EA 
Sbjct: 942  ELSTLEVKREPQQVQLL-----------------------KREGQGNTTESTQSAFVEAL 978

Query: 1045 QLDPILQPT--PFSNTDLPSFFGVDQYA-------APPELQPFPAGYAAP---------- 1085
            QLDPIL      FS TDL +FF  +Q          P   QP P   + P          
Sbjct: 979  QLDPILNANIYNFSGTDLSNFFISNQNGDVPRESREPAVQQPIPDRTSLPATNTSVVTGF 1038

Query: 1086 -------DKVPQAAAQGPSATAGPP--LSSKDSLFKVPSNGDFLKDYYSGMSSAQLNSLF 1136
                   +  P   A GPS   G P  + +K     V +   FL + Y   SS  LN+L+
Sbjct: 1039 DSLPKPENSKPAKDAIGPSLKKGYPSFIGTKSHNNSVSTMMMFLNNDYP-FSSMNLNALY 1097

Query: 1137 TXXXXXXXXXXXXXXXXXXSDGLQQQPGYGFVVDASLGLAPLLAWSPR 1184
                               +        +G +VDASLGLAPLL  +P 
Sbjct: 1098 APDGYKESSAQPGKQFTLNTGEPHSTYDFGMIVDASLGLAPLLNEAPE 1145

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 42/77 (54%), Positives = 49/77 (63%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYXXXXXXXXXXXX 132
           R +QACDRCR KK +CD KRPQCS CA+VGFECK+SDKL+R +FPRGY            
Sbjct: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTESLEERIRELE 230

Query: 133 XXXXXXXXXCDLKEEQL 149
                     DLKE+QL
Sbjct: 231 SENRRLLAMNDLKEQQL 247

>NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845
          Length = 1164

 Score =  462 bits (1188), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 259/656 (39%), Positives = 360/656 (54%), Gaps = 71/656 (10%)

Query: 284 ISFEQDQAPGLPAVKXXXXXXXXXXXXXXXXXVAVSIPRTTEEILFVPQLLARIGQMHGF 343
           ISFEQ++APGL AVK                 VA++IPR+T+EILF+PQLL++I Q  GF
Sbjct: 216 ISFEQNEAPGLSAVKALKSMANHEQSTQLATLVALAIPRSTDEILFIPQLLSKIRQNFGF 275

Query: 344 TSKQCLYTASVLASLKEITP---------RKTSSILEQLKAKNLWEIDNVDTFLLEGLQI 394
           TSK CLYT S+L+SLK   P           T  +L QLK  NLW+ D++  F+ + L++
Sbjct: 276 TSKHCLYTVSLLSSLKPNLPPPKMIANNLEMTKKLLNQLKITNLWKFDDLSQFINQYLKL 335

Query: 395 D-IRRGSSGDFNLENPNGYKLENEYHQTKDAHPELQELTPLTFQEIEELIQLFFDDWYSL 453
           D + + +S D                              L   E++ELI  FF DW  +
Sbjct: 336 DPLNQKNSNDL-----------------------------LNQIEMDELINFFFQDWNDI 366

Query: 454 IPIFDRSEFESYWVKFKDNVSTPGFFTSGDTLFDRRHKSISYKIFACLLLTVCQMGLMSK 513
           IPI ++ EF S +  FK ++      +  D L    +  ++YKIF C+L+ +CQMGL++K
Sbjct: 367 IPIINKEEFLSNYNAFKLDLKN----SERDKL--SSNLKMNYKIFGCILVLMCQMGLLTK 420

Query: 514 VKRERHER--GDRLNNLMTYYDRAISHVIMNPXXXXXXXXXXXXXXXXXXXXXXXNVGDV 571
           +K    +      L ++M YY + I+++ +N                        NVGD+
Sbjct: 421 IKATNGKSSPNIHLKSIMAYYHQLIANLPINNFFQIATISIPQLKLYVLILFYNLNVGDI 480

Query: 572 SNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSSLQL 631
           S +YELRG+++S++QQLRLHRCPSAVL     T+ K+ Q  RR+LFW +Y LD  SSLQL
Sbjct: 481 SAIYELRGRIISMSQQLRLHRCPSAVLSGSSLTMNKLDQSNRRILFWTIYSLDALSSLQL 540

Query: 632 GVPRLMKDHEIECALPVSSDDDNHVNLAGQMIALEGKMSPFSLSIIRFSKVLGNVLDSIF 691
           GVPRL+KD+EIECALP++ +D          I LEG +SPFSL+I RFSK+LGN+LD IF
Sbjct: 541 GVPRLLKDYEIECALPITMEDKER---DKTKIKLEGTVSPFSLAIFRFSKILGNILDMIF 597

Query: 692 KRGMTESMTKQVALVHENALDNWRHALPDNLRFQLDVNGTINMEDLNQLKRDYLNKDTAL 751
           KR MTESMTK V+L+HENALD WR+ LP++L F+L++ G+I++  ++Q        ++  
Sbjct: 598 KRNMTESMTKSVSLIHENALDQWRYDLPEDLTFKLNIQGSIDLNVMHQ-------GNSTP 650

Query: 752 KLNNAIFMALYFLAKIMIHLPVVATKPIIDKPQPVVDTNIPGSQIDRSSSSYVLLQQATN 811
              N I M  YF A  MIHLPVVA +P+          ++  +  DRSSSSY+ LQ A N
Sbjct: 651 GKKNLILMFFYFFAVSMIHLPVVAARPL----------DVKNAMPDRSSSSYIALQHAIN 700

Query: 812 TFXXXXXXXXXXXXXXX----XXITRTKTRFGLVSARGSLEYTKGGALFQXXXXXXXXXX 867
           T                      ++R + R  L+S+RG L+Y KGGALF           
Sbjct: 701 TMLNVLELLNNQPKNYYLPVPINMSRLQIRSALISSRGMLDYIKGGALFLDNKTLLLQVI 760

Query: 868 XXXXXXXXXXMPGTISWHSLKLLDMAVNLILQPPNTKPXXXXXXXXXXINYYNKLI 923
                     +PG +SWHSLKL D+ + L +Q  N K            NYYNKL+
Sbjct: 761 KNLERDRTLDLPGVVSWHSLKLFDLTITLFIQNSNIKLEKLDKILEKKSNYYNKLM 816

 Score =  111 bits (277), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%)

Query: 71  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           N R+AQACDRCRSKKTRCDGKRPQCSQCA VGFECKISDKL R++FPRGY
Sbjct: 74  NLRIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFPRGY 123

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]
           {ON} similar to uniprot|P39113 Saccharomyces cerevisiae
           YMR280c CAT8 transcription factor involved in
           gluconeogenesis
          Length = 1254

 Score =  405 bits (1042), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 257/660 (38%), Positives = 366/660 (55%), Gaps = 48/660 (7%)

Query: 282 TSISFEQDQAPGLPAVKXXXXXXXXXXXXXXXXXVAVSIPRTTEEILFVPQLLARIGQMH 341
           T +SFEQ+ APGLPAVK                 V++++PR+TEEILF+PQL+A I +  
Sbjct: 199 TDVSFEQNVAPGLPAVKALNSMAEREESAQLAMLVSLALPRSTEEILFIPQLMANIQKTF 258

Query: 342 GFTSKQCLYTASVLASLKEITPRKTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSS 401
           GF+SKQ LYT S+L+SLK+  P   S+  ++  + N +  ++   F  E L+ DI     
Sbjct: 259 GFSSKQSLYTVSLLSSLKKNLPTPNSNSSDENLSPNYYVSEDFRPFFYEVLKFDIL---- 314

Query: 402 GDFNLENPNGYKLENEYHQTKDAHPELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSE 461
           G+   EN +     N         P  +    L++ EI+ L+ ++F+ W + IPIF R  
Sbjct: 315 GETETENGS-----NRNESPDSTIPNSRSDDLLSWMEIQRLVDVYFECWSNTIPIFSRKL 369

Query: 462 FESYWVKFKDNVSTPGFFTSGDTLFD---RRHKSISY-KIFACLLLTVCQMGLMSKVKR- 516
           F      FK  V        GD LF+        I++ KIFA +L  +CQM L+S++K+ 
Sbjct: 370 FIKQMKAFKTEVDK-----FGDRLFEVYKTEQIKINFLKIFATVLAVMCQMALLSRLKQL 424

Query: 517 ---ERHERGDRLNNLMTYYDRAISHVIMNPXXXXXXXXXXXXXXXXXXXXXX-XNVGDVS 572
               +     R  NL+ +Y++ I  + ++                         NVGD+ 
Sbjct: 425 EATTQELECKRTQNLIAHYNQLIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIP 484

Query: 573 NVYELRGKVVSLTQQLRLHRCPSAVL-GSDGSTVGKIQQGERRVLFWGVYYLDVFSSLQL 631
            +Y+LRG V+S+ QQLRLHRCPSAVL  + GST+ K +QGERR+LFW +YYLDVF SLQL
Sbjct: 485 RLYQLRGTVISMAQQLRLHRCPSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQL 544

Query: 632 GVPRLMKDHEIECALPVSSDDDNHVNLAGQMIALEGKMSPFSLSIIRFSKVLGNVLDSIF 691
           GVPRL+KDHEIECALPVS ++D+          LEG++S FSL++IR++KVLGN+LDSIF
Sbjct: 545 GVPRLIKDHEIECALPVSEEEDSQ---------LEGRVSDFSLAVIRYAKVLGNILDSIF 595

Query: 692 KRG-MTESMTKQVALVHENALDNWRHALPDNLRFQLDVNGTINMEDLNQLKRDYLNKDTA 750
           KR  M+E+ T+ +A VHE ALD W++ LP+   F+L+ NG  N ++L  +K    N +  
Sbjct: 596 KRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANGLFNFDELTVVK----NSEKD 651

Query: 751 LKLNNAIFMALYFLAKIMIHLPVVATKPIIDKPQPVVDTNIPGSQIDRSSS--------- 801
           L   ++I +  YFLAK MIHLPV+AT+    + Q    T+   S+  + S          
Sbjct: 652 LIEKSSILL-FYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTSETPKESQNKTPTRVCP 710

Query: 802 SYVLLQQATNTFXXXXXXXXXXXXXXXXXITRTKTRFGLVSARGSLEYTKGGALFQXXXX 861
           SY+L+Q+A +T                  I+RTK RF L++A  ++EY KGG+L+     
Sbjct: 711 SYILMQKAASTMLQVMHYTSEYYLPSPINISRTKARFALLTACSAVEYLKGGSLYVETKN 770

Query: 862 XXXXXXXXXXXXXXXXMPGTISWHSLKLLDMAVNLILQPPNTKPXXXXXXXXXXINYYNK 921
                           +PG ISWHSLKLLDMA+ L+LQ P TK           IN+YN+
Sbjct: 771 LLENLIIKLELERKLDLPGIISWHSLKLLDMALMLLLQSPTTKMEKLDKLVQKKINHYNR 830

 Score =  103 bits (257), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 41/49 (83%), Positives = 46/49 (93%)

Query: 72  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           YRVAQACDRCR KKT+CDGK PQCSQCA VGFECKISD+L+R++FPRGY
Sbjct: 54  YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY 102

>Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON}
           (51828..55088) [3261 nt, 1087 aa]
          Length = 1086

 Score = 89.0 bits (219), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 33/48 (68%), Positives = 38/48 (79%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R++QACDRCR KK +CDG +P CSQC  V F CK SDKL+RR FPRGY
Sbjct: 93  RLSQACDRCRLKKIKCDGLKPNCSQCLKVNFICKTSDKLTRRGFPRGY 140

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 85.1 bits (209), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 38/48 (79%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R +QACDRCR KK +CDG RP C+ C  +G++CK SDKL+RR FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSDKLTRRGFPRGY 71

>KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.277
           YJL089W
          Length = 725

 Score = 84.7 bits (208), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (77%)

Query: 72  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           +RV+QACDRCR KK +CDG++P+CS C  + F C IS KLSRR  P+GY
Sbjct: 10  FRVSQACDRCRLKKIKCDGQKPRCSNCKKINFNCAISTKLSRRGLPKGY 58

>TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {ON}
           Anc_1.277 YJL089W
          Length = 1044

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%)

Query: 71  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           N R++QACDRCR KK +CDG +P C+ C+ + F CK SD+L+RR FP+GY
Sbjct: 77  NIRLSQACDRCRLKKIKCDGLKPSCTHCSKIKFACKTSDRLTRRGFPKGY 126

>ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa]
           {ON} weakly similar to uniprot|P46954 Saccharomyces
           cerevisiae YJL089W SIP4 Possibly involved in Snf1p
           regulated transcriptional activation shows homology to
           DNA binding domain of Gal4p has a leucine zipper motif
           and acidic region lexA-Sip4p activates transcription
          Length = 1027

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 37/48 (77%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R +QACDRCR KK +CDG +P CSQC  V F C+ SD+L+RR FPRGY
Sbjct: 33  RQSQACDRCRLKKIKCDGMKPTCSQCTKVNFTCRTSDRLTRRGFPRGY 80

>KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON}
           uniprot|Q7Z8R2 Kluyveromyces lactis Sip4 protein
          Length = 717

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 36/48 (75%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R +QACDRCR KK +CDG +P CS C  +G+ C  SDKL+RR FPRGY
Sbjct: 58  RFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSDKLTRRGFPRGY 105

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
           similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 38/48 (79%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R +QACDRCR KK +CDG RP C+ C  +G++C+ SDKL+RR FPRGY
Sbjct: 25  RSSQACDRCRLKKIKCDGVRPSCTSCKKIGYQCRTSDKLTRRGFPRGY 72

>SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 919

 Score = 82.8 bits (203), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 37/48 (77%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R +QACDRCR KK +CDG +P C+ C  VGF C+ SDKL+RR FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSDKLTRRGFPRGY 71

>KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 862

 Score = 82.4 bits (202), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 38/48 (79%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R++QACDRCR KK +CDG +P C+ C  +GF C+ SDKLSRR FPRGY
Sbjct: 24  RMSQACDRCRLKKIKCDGIKPTCTPCTKIGFHCQTSDKLSRRGFPRGY 71

>Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089W
           (REAL)
          Length = 829

 Score = 82.0 bits (201), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 34/48 (70%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R A ACDRCR KK RCDG +P CS C  + F CK SDKLSRR  P+GY
Sbjct: 41  RKAHACDRCRLKKIRCDGLKPNCSNCTKINFPCKTSDKLSRRGLPKGY 88

>YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zinc
           cluster transcriptional activator that binds to the
           carbon source-responsive element (CSRE) of gluconeogenic
           genes; involved in the positive regulation of
           gluconeogenesis; regulated by Snf1p protein kinase;
           localized to the nucleus
          Length = 829

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 35/48 (72%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R A ACDRCR KK +CDG +P CS CA + F CK SDKLSRR  P+GY
Sbjct: 41  RKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPCKTSDKLSRRGLPKGY 88

>Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089W
           (REAL)
          Length = 833

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 35/48 (72%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R A ACDRCR KK +CDG +P CS C+ + F CK SDKLSRR  P+GY
Sbjct: 41  RKAHACDRCRLKKIKCDGLKPNCSNCSKIDFPCKTSDKLSRRGLPKGY 88

>Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OFF}
           YJL089W (SIP4) - shows homology to DNA binding domain of
           Gal4p, has a leucine zipper motif and acidic region;
           lexA-Sip4p activates transcription [contig 304] PARTIAL
          Length = 201

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 37/48 (77%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R++QACDRCR KK +CDG +P C  C+ + F C+ SDKLSRR FPRGY
Sbjct: 24  RMSQACDRCRLKKIKCDGVKPTCGPCSKIKFHCQTSDKLSRRGFPRGY 71

>Suva_6.161 Chr6
           complement(283370..284500,284547..284764,284948..285781,
           285812..286127) [2499 bp, 832 aa] {ON} YJL089W (REAL)
          Length = 832

 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 34/48 (70%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R A ACDRCR KK +CDG +P CS C  + F CK SDKLSRR  P+GY
Sbjct: 41  RKAHACDRCRLKKIKCDGLKPNCSNCGKIDFPCKTSDKLSRRGLPKGY 88

>TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.277
           YJL089W
          Length = 945

 Score = 79.3 bits (194), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 35/48 (72%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R + ACDRCR KK RCDG +P CSQC+   F C  SDKL+RR FP+GY
Sbjct: 54  RHSHACDRCRLKKVRCDGLKPSCSQCSRANFRCTTSDKLTRRGFPKGY 101

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
           {ON} some similarities with uniprot|P46954 Saccharomyces
           cerevisiae YJL089w SIP4 interacts with SNF1 protein
           kinase
          Length = 1209

 Score = 78.6 bits (192), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 37/48 (77%), Gaps = 1/48 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R +QACDRCRSKK +CDG +P CS CA +G+ C  SDKLSRR  P+GY
Sbjct: 24  RHSQACDRCRSKKIKCDGLQP-CSNCAKIGYNCVTSDKLSRRGLPKGY 70

>NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON} 
          Length = 1186

 Score = 77.8 bits (190), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 34/48 (70%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R  QACDRCR KK +CD  +P CSQC    F+CK +DKL+RR F RGY
Sbjct: 117 RKIQACDRCRLKKIKCDDLKPSCSQCLKADFQCKTTDKLARRGFSRGY 164

>KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1.277
           YJL089W
          Length = 1072

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%)

Query: 72  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           +R  QACDRCR KK +CDG +P C+ CA + F CK S KLSRR  P+GY
Sbjct: 22  FRKNQACDRCRLKKIKCDGLKPTCTNCAKINFLCKTSHKLSRRGLPKGY 70

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (68%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R +QACDRCR KK +CDG  P C+ C  + F C+ + KLSRR  P+GY
Sbjct: 96  RHSQACDRCRLKKIKCDGLIPHCTNCRKINFNCQTTHKLSRRGLPKGY 143

>NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa]
           {ON} Anc_1.277
          Length = 932

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 30/45 (66%)

Query: 76  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           QACDRCR KK +CD + P C+ C   G  C+ +++L RR F +GY
Sbjct: 43  QACDRCRLKKIKCDDRTPDCTPCMKAGIPCRTTERLKRRGFAKGY 87

>KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]
           {ON} some similarities with uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 678

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           AC  C+ ++ RCDG  PQC  C   G +C   DK++ R  PR Y
Sbjct: 66  ACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVDKITGRELPRDY 109

 Score = 32.7 bits (73), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 34/80 (42%)

Query: 570 DVSNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSSL 629
           D + ++ L G  V     L LHR P +           + Q  R  +FW  Y ++    +
Sbjct: 279 DYNQLWLLAGVAVRTAVSLDLHRKPGSPRSMTHGLEQHVLQNLRSRVFWCAYSIERLIGM 338

Query: 630 QLGVPRLMKDHEIECALPVS 649
            +G P  + D +I+  LP S
Sbjct: 339 TVGRPFCISDVDIDAPLPES 358

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 114
           RV +ACD CR KK +CDG++P C  C    +EC  +   +RR
Sbjct: 61  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPSTRR 101

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 47/88 (53%), Gaps = 6/88 (6%)

Query: 571 VSNVYELRGKVVSLTQQLR--LHRC-PSAVLGS-DGSTVGKIQQGERRVLFWGVYYLDVF 626
           +S  Y   G  V+L   LR  LHR  P+  +G+   S    I+   R+ LF+ +Y LD++
Sbjct: 394 LSTCYSYIG--VALRSALREGLHRVIPTNKIGTGTDSRFNCIEIEMRKRLFYTIYKLDIY 451

Query: 627 SSLQLGVPRLMKDHEIECALPVSSDDDN 654
            +  LG+PR +  ++ + +LP    D+N
Sbjct: 452 VNAMLGLPRSISPNDFDQSLPFDLSDEN 479

>KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {ON}
           weakly similar to uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 775

 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 26/49 (53%)

Query: 72  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           YR   AC RCR +K +CD K P C++C      C   D  +RR  PR Y
Sbjct: 14  YRSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTRREIPRSY 62

>NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {ON}
           Anc_6.279
          Length = 960

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           +  QACD CR KK +C  ++P+C++C   G+EC  S K  R    R +
Sbjct: 7   KSEQACDICRIKKLKCSREKPKCAKCMKNGWECCYSPKAKRSPLTRAH 54

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           RV +ACD CR KK +CDGK+P C  C    +EC
Sbjct: 9   RVTRACDECRKKKVKCDGKQP-CIHCTVYNYEC 40

 Score = 36.2 bits (82), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 26/41 (63%)

Query: 613 RRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDD 653
           R+ LF+ +Y +D++ +  LG+PR +   + +  LP+  +DD
Sbjct: 461 RKRLFYTIYKMDIYINTMLGLPRTISPRDFDQELPLELNDD 501

>SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {ON}
           similar to uniprot|P07272 Saccharomyces cerevisiae
           YLR014C PPR1 Zinc finger transcription factor containing
           a Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 898

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R   AC+RCR+KKT+CD   P C++CA++G  C   D  + R   R Y
Sbjct: 48  RSIVACERCRTKKTKCDQNFPSCARCASLGEPCISVDPATGRVVSRSY 95

>NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]
           {ON} Anc_7.17
          Length = 1059

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 72  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           YR++  C  CR  KT+CD ++P CS+C  +G  C
Sbjct: 47  YRLSFVCQECRKSKTKCDKEKPSCSRCLKIGITC 80

>YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}
           GAL4DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose;
           repressed by Gal80p and activated by Gal3p
          Length = 881

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 74  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           + QACD CR KK +C  ++P+C++C    +EC+ S K  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C
           (REAL)
          Length = 878

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 74  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           + QACD CR KK +C  ++P+C++C    +EC+ S K  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {ON}
           Anc_2.231 YIL130W
          Length = 848

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 13  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 44

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 57/123 (46%), Gaps = 5/123 (4%)

Query: 605 VGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQMIA 664
           +  I+   ++ LF+ VY +D++ +  LG+PR ++  + +  LP+   D+N +   G    
Sbjct: 364 INPIELEMKKRLFYNVYKMDIYINAMLGLPRSLRVEDFDQTLPIELSDEN-ITAEGYFYE 422

Query: 665 LE-GKMSPFSLSI--IRFSKVLGNVLDSIFKRGMTESMTKQVALVH-ENALDNWRHALPD 720
            + G++S  ++S    +   V   ++  ++    T +M     +   E  L  W   LP 
Sbjct: 423 RQKGELSSIAISNQHTKLIMVFDTIVSELYPLKKTNNMISHETVTRLEAKLTEWVDNLPV 482

Query: 721 NLR 723
            LR
Sbjct: 483 ELR 485

>KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.279
           YPL248C
          Length = 875

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%)

Query: 71  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           N    QACD CR KK +C   +P C +CA  G+ C  S K  R    R +
Sbjct: 14  NSSTDQACDLCRIKKLKCSKDKPACRKCAKNGWNCTYSPKAKRSPLTRAH 63

>NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279
          Length = 890

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%)

Query: 74  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 118
           + QACD CR KK +C  + P+CS+C   G +C  S K+ R    R
Sbjct: 16  IEQACDNCRLKKLKCSKETPKCSKCLKNGMKCLYSPKVKRSPLTR 60

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
           Putative protein of unknown function; similar to
           transcriptional regulators from the Zn[2]-Cys[6]
           binuclear cluster protein family; mRNA is weakly cell
           cycle regulated, peaking in S phase; induced rapidly
           upon MMS treatment
          Length = 758

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 79/175 (45%), Gaps = 20/175 (11%)

Query: 567 NVGDVSNVYELRGKVVSLTQQLRLHRCPSAV-----------LGSDGSTVGK--IQQGER 613
           N+ D+ ++  +    + L     L  C S +           L    S VG   IQ   +
Sbjct: 282 NITDIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKEGLHRRSSIVGPTPIQDETK 341

Query: 614 RVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQM-----IALEGK 668
           + LFW VY LD++ +  LG P  + + +I+   P+  DD+N   +  +      I+  G 
Sbjct: 342 KRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPLDVDDENISTIGIKFQDWRTISSCGM 401

Query: 669 MSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDNLR 723
            +  +  I+  S++   ++ S+ ++ + E    Q+  +++  LDNW   LPD L+
Sbjct: 402 NNKHTKLILIMSRIY-KLMYSLRRKPLEEDSRTQIVSLNDQ-LDNWYAQLPDILK 454

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 106
           R  +AC  CR +K RC G  P C  C    +ECK
Sbjct: 42  RAHRACIACRKRKVRCSGNIP-CRLCQTNSYECK 74

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
           {ON} Anc_2.231
          Length = 906

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 32  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 26/42 (61%)

Query: 613 RRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDN 654
           R+ LF+ +Y LD++ +  LG+PR +   + +  LP+   D+N
Sbjct: 408 RKRLFYTIYKLDIYVNAMLGLPRSISPDDFDQTLPIELSDEN 449

>SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 906

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 26/48 (54%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R   AC RCR KK +CD K P CS+CA+    C   D  + R  PR Y
Sbjct: 38  RSIAACKRCRLKKVKCDQKFPSCSKCASANEPCVSLDPATGRDVPRSY 85

>ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} similar
           to uniprot|P04386 Saccharomyces cerevisiae YPL248C GAL4
           DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose
           repressed by Gal80p and activated by Gal3p
          Length = 794

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 74  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           +  ACD CR KK RC  + P+C++C   G+EC  S K +R    R +
Sbjct: 7   IDHACDSCRQKKLRCSKEEPKCAKCIQNGWECCYSPKANRTPLTRAH 53

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
           (REAL)
          Length = 1012

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 57/129 (44%), Gaps = 9/129 (6%)

Query: 600 SDGSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLA 659
           S  S    I+   R+ LF+ +Y LDV+ +  LG+PR +   + +  LP+   D+N   +A
Sbjct: 389 SSSSGFSPIEIEMRKRLFYTIYKLDVYINAMLGLPRSISPDDFDQTLPLDLSDENITEVA 448

Query: 660 GQMIALEGKMSPFSLSII-----RFSKVLGNVLDSIFKRGMTESMTKQVALVH-ENALDN 713
                 E + S  S + I     +   +L  ++  ++    T ++     +   E  L N
Sbjct: 449 ---YLPENQHSVLSSTGISNEHTKLFLILNEIISELYPIKKTSNIISHETVTSLELKLRN 505

Query: 714 WRHALPDNL 722
           W  +LP  L
Sbjct: 506 WLDSLPKEL 514

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {ON}
           Anc_2.231 YIL130W
          Length = 930

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 34  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 65

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 56/127 (44%), Gaps = 9/127 (7%)

Query: 602 GSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQ 661
            S    I+   R+ LF+ +Y LD++ +  LG+PR +  ++ +  LP+   D+N       
Sbjct: 420 NSGFNPIEIEMRKRLFYTIYKLDIYVNAMLGLPRSISANDFDQTLPLELSDENITEQGYF 479

Query: 662 MIALEGKMSPFSLSIIRFSKVLGNVLDSI------FKRGMTESMTKQVALVHENALDNWR 715
                G +S  S  I      L  +LD+I       K+  T    + +A + E  L NW 
Sbjct: 480 PENQNGVLS--STGIANEHTKLLMILDAIVGELYPIKKTNTFISHETIATL-EQKLRNWL 536

Query: 716 HALPDNL 722
             LP+ L
Sbjct: 537 DDLPNEL 543

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
           cluster protein proposed to function as a
           transcriptional regulator involved in the stress
           response; null mutants have a respiratory deficiency,
           calcofluor white sensitivity and slightly increased
           cycloheximide resistance
          Length = 964

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 57/129 (44%), Gaps = 9/129 (6%)

Query: 600 SDGSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLA 659
           S  S    I+   R+ LF+ +Y LDV+ +  LG+PR +   + +  LP+   D+N   +A
Sbjct: 386 SPNSGFSPIEIEMRKRLFYTIYKLDVYINAMLGLPRSISPDDFDQTLPLDLSDENITEVA 445

Query: 660 GQMIALEGKMSPFSLSII-----RFSKVLGNVLDSIFKRGMTESMTKQVALVH-ENALDN 713
                 E + S  S + I     +   +L  ++  ++    T ++     +   E  L N
Sbjct: 446 ---YLPENQHSVLSSTGISNEHTKLFLILNEIISELYPIKKTSNIISHETVTSLELKLRN 502

Query: 714 WRHALPDNL 722
           W  +LP  L
Sbjct: 503 WLDSLPKEL 511

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
           similar to Ashbya gossypii AER183C
          Length = 898

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 114
           RV++ACD CR+KK +C+G+ P CS C     EC  +  + RR
Sbjct: 22  RVSKACDTCRAKKIKCNGEEP-CSNCGKHDLECAYTHVIKRR 62

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)
          Length = 954

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 37.7 bits (86), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 57/128 (44%), Gaps = 4/128 (3%)

Query: 598 LGSDGSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVN 657
           LG++ S    I+   R+ LF+ +Y LDV+ +  LG+PR +   + +  LP+   D+N   
Sbjct: 386 LGTN-SGFSPIEIEMRKRLFYTIYKLDVYINAMLGLPRSISPDDFDQTLPLDLSDENITE 444

Query: 658 LAGQMIALEGKMSPFSLSI--IRFSKVLGNVLDSIFKRGMTESMTKQVALVH-ENALDNW 714
            A         +S   +S    +   +L  ++  ++    T ++     +   E  L NW
Sbjct: 445 TAYLPENQNAVLSSTGISNEHTKLFLILNEIISELYPIKKTSNIISHETVTSLELKLRNW 504

Query: 715 RHALPDNL 722
             +LP  L
Sbjct: 505 LDSLPKEL 512

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 63/128 (49%), Gaps = 7/128 (5%)

Query: 601 DGSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAG 660
           + +T+  I+   R+ +F+ +Y LDV+ +  +G+PR + + + +  LP+   D+  +   G
Sbjct: 461 NNTTLNPIEIEMRKRIFYTIYKLDVYVNSMMGLPRSLSEDDFDQELPIEISDE-CITENG 519

Query: 661 QMIALEGKMSPFSLSIIRFSKVLGNVLDSIFKR-----GMTESMTKQVALVHENALDNWR 715
            +   EG+    S+SI  +   L  +L  I +R         S+T+   +  EN L  W 
Sbjct: 520 YLSEQEGQQLS-SISIANYHTKLYLILADIVQRLYSIKKKNRSITENTVISLENKLRKWA 578

Query: 716 HALPDNLR 723
            +LP  L+
Sbjct: 579 DSLPHELK 586

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           RV +ACD CR KK +CDG+ P C  C    ++C
Sbjct: 67  RVTRACDECRKKKVKCDGQNP-CIHCTVYSYKC 98

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
           (REAL)
          Length = 926

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 39.3 bits (90), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 67/157 (42%), Gaps = 12/157 (7%)

Query: 571 VSNVYELRGKVVSLTQQLR--LHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSS 628
           +S  Y   G  V++   LR   HR  SA      S    I+   R+ LF+ +Y LDV+ +
Sbjct: 362 LSTCYTYIG--VAMRSALRAGFHRKLSA-----NSGFTPIEIEMRKRLFYTIYKLDVYIN 414

Query: 629 LQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQMIALEGKMSPFSLS--IIRFSKVLGNV 686
             LG+PR +   + +  LP+   D+N   +A         +S   +S    +   +L  +
Sbjct: 415 AMLGLPRSISPEDFDQTLPLDLSDENITEVAYLPENQNAVLSSTGISNEHTKLFLILNEI 474

Query: 687 LDSIFKRGMTESMTKQVALVH-ENALDNWRHALPDNL 722
           +  ++    T ++     +   E  L NW  +LP  L
Sbjct: 475 ISELYPIKKTNNIISHETVTSLELKLRNWLDSLPKEL 511

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
           (REAL)
          Length = 786

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 79/175 (45%), Gaps = 20/175 (11%)

Query: 567 NVGDVSNVYELRGKVVSLTQQLRLHRCPSAV-----------LGSDGSTVG--KIQQGER 613
           N+ D+ ++  +    + L     L  C S +           L    S  G   IQ   +
Sbjct: 303 NITDIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKEGLHRKSSITGPTAIQDETK 362

Query: 614 RVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLA-----GQMIALEGK 668
           + LFW VY LD++ +  LG P  + + +I+   P+  DD+N   +       +MI+  G 
Sbjct: 363 KRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPLDVDDENISTMGIKFQDWRMISSCGM 422

Query: 669 MSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDNLR 723
            +  +  I+  S++   ++ S+ ++ + E    Q+  +++  L+NW   LPD L+
Sbjct: 423 NNEHTKLILIMSRIY-KLMYSLRRKPLEEDSRLQIVSLNDQ-LENWYAQLPDILK 475

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.231
           YIL130W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 852

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 15  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 46

 Score = 40.0 bits (92), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 69/157 (43%), Gaps = 12/157 (7%)

Query: 571 VSNVYELRGKVVSLTQQLR--LHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSS 628
           +S  Y   G  V++   LR  LHR  S       S    I+   R+ LF+ +Y LDV+ +
Sbjct: 348 LSTCYAYIG--VAMRSALREGLHRSVSP-----DSGFSPIEIEMRKRLFYTIYKLDVYVN 400

Query: 629 LQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQMIALEGKMSPFSLS--IIRFSKVLGNV 686
             LG+PR +  ++ +  LP+   D+N           +GK+S   ++    +   +L  +
Sbjct: 401 AMLGLPRSISSNDFDQTLPIELSDENITEEGYFPENQKGKLSSAEIANQHTKLIMILNVI 460

Query: 687 LDSIFKRGMTESMTK-QVALVHENALDNWRHALPDNL 722
           +  ++    T ++ + +V    E  L  W   LP  L
Sbjct: 461 VGELYPIRKTNNLIRHEVVTELELKLRQWLDGLPREL 497

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {ON}
           Anc_6.279
          Length = 935

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query: 76  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           QACD CR KK +C  ++P+C++C    +EC  S K  R    R +
Sbjct: 11  QACDLCRVKKLKCSKEKPKCAKCLKNNWECCYSPKTRRSPLTRAH 55

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 71/161 (44%), Gaps = 19/161 (11%)

Query: 571 VSNVYELRGKVVSLTQQLR--LHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSS 628
           +S  Y   G  V++   LR  +HR     L +D  +   I+   R+ LF+ +Y +DV+ +
Sbjct: 310 LSTCYTYIG--VAMRNALREGMHRN----LNADTHSYNPIEIEMRKRLFYTIYKMDVYVN 363

Query: 629 LQLGVPRLMKDHEIECALPVS------SDDDNHVNLAGQMIALEGKMSPFSLSIIRFSKV 682
             LG+PR +   + + ALP        + D  H    G +++  G  +  +  I+    +
Sbjct: 364 TMLGLPRSVSQRDFDQALPAELTDEFITKDGLHFEKQGNVLSSAGIANQHTKLIM----I 419

Query: 683 LGNVLDSIFKRGMTESM-TKQVALVHENALDNWRHALPDNL 722
           L N++  ++    T ++ +  V    E  L  W   LP  L
Sbjct: 420 LDNIVAELYPVKKTNNLISHDVVTQLELKLRQWLDNLPPEL 460

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 40.0 bits (92), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 78/158 (49%), Gaps = 13/158 (8%)

Query: 571 VSNVYELRGKVVSLTQQLR--LHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSS 628
           +S  Y   G  V++   LR  LHR  +  +G+ G T  +I+   R+ LF+ +Y +D++ +
Sbjct: 296 LSTCYAYIG--VAMRSALREGLHR--NLTMGAPGFTPIEIEM--RKRLFFTIYKMDIYLN 349

Query: 629 LQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQMIALEG-KMSPFSLS--IIRFSKVLGN 685
             LG+PR +   + + + P+  DD+ ++   G     +G ++S   ++    +   +L N
Sbjct: 350 TMLGLPRAISQRDFDQSFPLEIDDE-YITEDGIYPERQGDELSSAGIANQHTKLIMILDN 408

Query: 686 VLDSIFKRGMTESM-TKQVALVHENALDNWRHALPDNL 722
           ++  ++    T ++ + +V    E  L  W + LP  L
Sbjct: 409 IVSELYPIKKTNNLISHEVVTNLELKLRQWLNQLPPEL 446

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
           (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 39.3 bits (90), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 71/161 (44%), Gaps = 19/161 (11%)

Query: 571 VSNVYELRGKVVSLTQQLR--LHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSS 628
           +S  Y   G  V++   LR  +HR     L +D      I+   R+ LF+ +Y +DV+ +
Sbjct: 341 LSTCYTYIG--VAMRNALREGMHRN----LNTDTHGYSPIEIEMRKRLFYTIYKMDVYVN 394

Query: 629 LQLGVPRLMKDHEIECALPVS------SDDDNHVNLAGQMIALEGKMSPFSLSIIRFSKV 682
             LG+PR +   + + ALP        ++D  H    G +++  G  +  +  I+    +
Sbjct: 395 TMLGLPRSVSQRDFDQALPAELTDEYITEDGLHPEKQGDVLSSAGIANQHTKLIM----I 450

Query: 683 LGNVLDSIFKRGMTESM-TKQVALVHENALDNWRHALPDNL 722
           L N++  ++    T ++ +  V    E  L  W   LP  L
Sbjct: 451 LDNIVAELYPVKKTNNLISHDVVTQLEFKLRQWLDNLPPEL 491

>Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 bp,
           881 aa] {ON} complement(81534..83840,83842..84180) [2646
           nt, 882 aa]
          Length = 881

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%)

Query: 71  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           N    Q CD CR KK +C  ++P+C +C    +EC  S K+ R    R +
Sbjct: 3   NIITNQVCDSCRLKKLKCSKEKPKCFKCLKHNWECNYSPKIKRSPLTRAH 52

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130w
          Length = 847

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSR 113
           +V +ACD CR KK +CDG +P C  C    +EC  +  L R
Sbjct: 15  KVTRACDDCRKKKVKCDGNQP-CIHCTVYSYECTYNHPLKR 54

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
           (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           RV +ACD CR KK +CDG++P C  C    + C
Sbjct: 31  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYNC 62

 Score = 38.9 bits (89), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 33/158 (20%), Positives = 70/158 (44%), Gaps = 11/158 (6%)

Query: 571 VSNVYELRGKVVSLTQQLR--LHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSS 628
           +SN Y   G  ++L   LR  LHR     +    S +  +    R+ +F+ +Y  D++ +
Sbjct: 486 LSNCYSYIG--IALRNALREGLHR----FVNPKSSNLNPLDIEMRKRVFYTIYKCDLYLN 539

Query: 629 LQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQMIALEGKMSPFSLSI--IRFSKVLGNV 686
             LG+P+ +   + +  LPV   D+N            G++S  +++    +   +L ++
Sbjct: 540 SMLGLPKSLSSADFDQVLPVELSDENITEEGYFPDKQNGEVSSAAIANYHTKLMLILADI 599

Query: 687 LDSIFKRGMTESMTKQVALVH-ENALDNWRHALPDNLR 723
              ++    + ++     +   E  L+NW  +LP  L+
Sbjct: 600 TKELYPNKKSNNIVSHETVTQLEMRLENWIQSLPQQLK 637

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.231
           YIL130W
          Length = 902

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 32  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 53/116 (45%), Gaps = 7/116 (6%)

Query: 613 RRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQMIALEGKMSPF 672
           R+ LF+ +Y LDV+ +  LG+PR +   + +  LP+   D+N    A      +G +S  
Sbjct: 431 RKRLFYTIYKLDVYVNAMLGLPRSISPEDFDQVLPLELSDENITEQAYYPEREDGSLS-- 488

Query: 673 SLSIIRFSKVLGNVLDSIFKRGM-----TESMTKQVALVHENALDNWRHALPDNLR 723
           S  I      L  +LD+I ++          ++ +     E  L +W + LP  L+
Sbjct: 489 STGIANCHTRLIMILDTIMRKLYPIKRPNNVISHETVTNLEKLLRDWTNTLPAELK 544

>NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {ON}
           Anc_5.235
          Length = 890

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 25/44 (56%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           AC RCRSKK +CD K P C +CA +   C   D  + +  PR Y
Sbjct: 40  ACKRCRSKKIKCDQKFPSCDRCAHLKVPCVSVDPATGQDVPRSY 83

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {ON}
           some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 979

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 73  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           + ++ACD+CR KKTRCD   +RP CS C  +G  C       +R   +GY
Sbjct: 30  KTSRACDQCREKKTRCDFSDERPICSACQRMGKTCTFERVPMKRGPTKGY 79

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {ON}
           similar to uniprot|P04386 Saccharomyces cerevisiae
           YPL248C GAL4 DNA-binding transcription factor required
           for the activation of the GAL genes in response to
           galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 25/45 (55%)

Query: 74  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 118
           V QACD CR +K RC  + P+CS+C    +EC  S K  R    R
Sbjct: 5   VQQACDSCRKRKLRCSKELPKCSKCLKHNWECCYSPKAVRSPLTR 49

>KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON} 
          Length = 888

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           AC RCRSKKT+CD K P C +C  +   C   D  +    PR Y
Sbjct: 45  ACKRCRSKKTKCDQKLPSCGKCTKLNTPCISVDPATGEDVPRSY 88

>Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}
           YPL248C (REAL)
          Length = 895

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%)

Query: 74  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 118
           + QACD CR KK +C  ++P+CS+C    +EC  S K  R    R
Sbjct: 7   MEQACDICRLKKLKCSKEKPKCSKCLKNNWECCYSPKTKRSPLTR 51

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 81/176 (46%), Gaps = 22/176 (12%)

Query: 567 NVGDVSNVYELRGKVVSLTQQLRLHRCPSAV-----------LGSDGSTVGK--IQQGER 613
           N+ D+ ++  +    + L     L  C S +           L    S VG   I+   +
Sbjct: 294 NITDIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKDGLHRKSSIVGPTPIEDETK 353

Query: 614 RVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAG------QMIALEG 667
           + LFW VY LD++ +  LG P  + + +I+   P+  DD+N ++  G      + I+  G
Sbjct: 354 KRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPLDVDDEN-ISTTGIKFQDWRTISSCG 412

Query: 668 KMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDNLR 723
             +  +  I+  S++   ++ S+ ++ + E    Q+  +++  LD+W   LPD L+
Sbjct: 413 MNNKHTKLILIMSRIY-KLMYSLRRKPLEEDSRLQIVSLNDQ-LDDWYTQLPDTLK 466

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 106
           R  +AC  CR +K RC G+ P C  C    FECK
Sbjct: 53  RAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 85

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger; overexpression increases salt
           tolerance through increased expression of the
           ENA1(Na+/Li+ extrusion pump) gene while gene disruption
           decreases both salt tolerance and ENA1 expression
          Length = 902

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFP 117
           RV++ACD CR+KK +CDG  P CS C  V  EC  +  + +R  P
Sbjct: 9   RVSKACDACRAKKIKCDGCDP-CSNCKKVSQECGYTYVVKKRQKP 52

>NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235
          Length = 889

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           AC RCR KK +CD   P CS+CA +   C   D  +    PR Y
Sbjct: 21  ACKRCRLKKIKCDNNVPSCSRCAKLRVPCVAVDSATGEDVPRSY 64

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 4/37 (10%)

Query: 73  RVAQACDRCRSKKTRCDG----KRPQCSQCAAVGFEC 105
           RVA+ACDRCR +K +CD     K  +CS C   G EC
Sbjct: 118 RVARACDRCRKRKIKCDEIKNLKVNKCSNCVKYGAEC 154

>TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.279
           YPL248C
          Length = 993

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 74  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           V QACD CR KK RC  + P+C++C    +EC  S +  R    R +
Sbjct: 8   VDQACDSCRIKKLRCSKENPKCAKCLKNKWECCYSPRKRRSPLTRAH 54

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
           YJL206C (REAL)
          Length = 833

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 62/121 (51%), Gaps = 7/121 (5%)

Query: 608 IQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLA-----GQM 662
           IQ   ++ LFW VY LD++ +  LG P  + + +I+   P+  DD+N   +       + 
Sbjct: 324 IQDETKKRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPLDVDDENISTMGIKFQDWRT 383

Query: 663 IALEGKMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDNL 722
           I+  G  +  +  I+  S++   ++ S+ ++ + E    Q+  +++  L+NW   LPD L
Sbjct: 384 ISSCGMNNKHTKLILIMSRIY-KLMYSLRRKPLEEDSRSQIVSLNDQ-LENWYTQLPDIL 441

Query: 723 R 723
           +
Sbjct: 442 K 442

 Score = 39.7 bits (91), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 106
           R  +AC  CR +K RC G+ P C  C    FECK
Sbjct: 29  RAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 61

>TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1154

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 76  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           QACD CR KK +C  ++P+C++C    +EC  S +  R    R +
Sbjct: 16  QACDSCRLKKLKCSKEKPKCAKCLKNIWECCYSPRAKRSPLTRNH 60

>KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5.235
           YLR014C
          Length = 864

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           AC RCR+KK +CD + P C +CA V   C   D  +    PR Y
Sbjct: 33  ACKRCRAKKIKCDQEFPSCGKCAKVNEPCVSIDPATGEDIPRSY 76

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 35/82 (42%), Gaps = 6/82 (7%)

Query: 571 VSNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSSLQ 630
           V  V+ L G V+ LT  L LH   S +L S+        +  RR LFW VY LD      
Sbjct: 434 VPGVWYLMGSVLRLTVDLGLH---SEILNSN---YDPFTREIRRRLFWSVYALDRQVCSY 487

Query: 631 LGVPRLMKDHEIECALPVSSDD 652
            G P  + +  I    P   DD
Sbjct: 488 FGRPFGIPEENITTRYPSILDD 509

>KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly
           similar to uniprot|P52960 Saccharomyces cerevisiae
           YOR363C PIP2 peroxisome induction pathway 2 (PIP2)
           transcriptional activator of peroxisome proliferation
           may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 847

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 30/47 (63%), Gaps = 2/47 (4%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK--ISDKLSRRAFP 117
           R++  C  CR +K +CD  +P+C +CA +G EC   +S+++S +  P
Sbjct: 27  RLSFVCRNCRKRKIKCDKAQPKCGRCAKLGLECNYDLSEQISLKKTP 73

>KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17
           YOR363C
          Length = 948

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R++  C  CR+ K +CD ++PQC +C  +G EC
Sbjct: 24  RLSYVCKACRTAKAKCDKEKPQCGRCYKLGVEC 56

>TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%)

Query: 72  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 118
           + + +ACD CR KK +C   RP+C +C   G++C  S ++ R    R
Sbjct: 2   FEMDRACDSCRHKKLKCSKTRPKCKKCLKNGWDCCYSPRIKRSPLTR 48

>Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C
           (PPR1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 246]
           FULL
          Length = 881

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R   AC RCR +K +CD K P CS+C +    C   D  + R  PR Y
Sbjct: 44  RSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCVSIDPATGRDVPRSY 91

>KAFR0A00220 Chr1 complement(42494..45250) [2757 bp, 918 aa] {ON}
           Anc_2.651 YIR023W
          Length = 918

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 96/232 (41%), Gaps = 54/232 (23%)

Query: 569 GDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSS 628
           G+ +N + L   +V+L ++L L       +  D   + K ++  R+ L W V+  D ++S
Sbjct: 432 GERTNNWLLSSNLVALAEELGLG------INCDDWKLPKWEKDLRKRLAWAVFSQDKWTS 485

Query: 629 LQLG-----------VPRLMKDHEIECALPVSSDDDNHVNLAGQM-IALEGKMSPFSLSI 676
           L  G           +  L+K  E   + P  S  DN    AG M I +      +  + 
Sbjct: 486 LIEGRISYLILGRNWLISLLKQDEFPVSSPAISSTDN---TAGNMLIDMNLNNEDYHNAT 542

Query: 677 IRF------SKVLGNVLDSIFKRG------MTESMTKQVALVHENALDNWRHALPDNLRF 724
           + F      S ++G ++D+ + +G        E++ KQ   + +  L  W H+LP  L  
Sbjct: 543 LLFQQKVSLSIIIGEIMDTFYTQGAMHVNNTIENVLKQAKPL-QLKLREWYHSLPKQL-- 599

Query: 725 QLDVNGTINMEDLNQLKRDYLNKDTALKLNNAIFMALYFLAKIMIHLPVVAT 776
                       +N  K    N + AL L+       YF A+I +H  +++T
Sbjct: 600 -----------SMNNFKSKKFNSNAALNLS-------YFAAEIALHRKIIST 633

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {ON}
           Anc_1.128 YJL206C
          Length = 658

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 109
           RV +AC  CR KK RCDGK P CS CA     C+ ++
Sbjct: 27  RVFKACIACRKKKRRCDGKSP-CSHCARTSIICEYTN 62

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 72/164 (43%), Gaps = 21/164 (12%)

Query: 569 GDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSS 628
           GD+   Y   G  + +  +  LHR PS      G T   I+   ++ LFW +Y +D++ +
Sbjct: 257 GDLKACYYYIGIALRIAIRENLHRKPSLT----GPTA--IEDETKKRLFWSIYKVDIYMN 310

Query: 629 LQLGVPRLMKDHEIECALPVSSDDDNHV------NLAGQMIA---LEGKMSPFSLSIIRF 679
             LG+P  + +  I+  LP   DD+  V      N    +I+   +  + +   L +++ 
Sbjct: 311 CTLGLPASLNESFIDQELPYDVDDEKIVSDGVIFNENSNIISSCGMNNEHTKLILIMLKI 370

Query: 680 SKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDNLR 723
            + L ++   I K      +   V L  E+ L  W + LP  L+
Sbjct: 371 YRTLYSIDVEILK------IDANVVLHLEDILFTWYNNLPLQLK 408

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
           YOR363C
          Length = 1232

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R++  C  CR  KT+CD K+P C++C   G +C
Sbjct: 47  RISFVCQHCRKSKTKCDKKQPHCARCIKHGIQC 79

>TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa]
           {ON} Anc_1.128 YJL206C
          Length = 691

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 80/171 (46%), Gaps = 21/171 (12%)

Query: 608 IQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQMIALEG 667
           I+   ++ LFW VY +D++ +  LG+PR + +  I   LP   DD+  +   G +    G
Sbjct: 340 IEDETKKRLFWSVYKVDLYMNCILGLPRTLSESAINQELPRDVDDEK-ITTKGILAQDWG 398

Query: 668 KMSPFSLS--IIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPDNLR-- 723
           K+S   ++    +   V+  + +S++     +  T    +  ++ L+ W   LP  L+  
Sbjct: 399 KISSCGMNNQHTKLMLVMARIHESLYPVLKWDQATYVNIINLQDKLNEWFIELPMQLKPD 458

Query: 724 FQLDVNGTINMEDLNQLKRDYLNKDTALKLNNAIFMALYFLAKIMIHLPVV 774
           +Q            N+ +R+Y      LK N  +++  Y LAKI+++ P +
Sbjct: 459 YQF----------FNEEERNYY-----LKPNKLLYLD-YLLAKIILYKPFI 493

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 23/30 (76%), Gaps = 1/30 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 102
           RV++AC+ CRSKK +CDG++P C  C  VG
Sbjct: 125 RVSRACEFCRSKKKKCDGQQP-CDLCKLVG 153

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 912

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 118
           RV +AC+ C+ +K +CDG +P C+ C   G ECK      RR + R
Sbjct: 12  RVRKACEICKRRKVKCDGSQP-CANCVKHGQECKYISGTVRRRYRR 56

>KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 866

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 24/48 (50%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           R   AC RCR +K +CD K P CS+C      C   D  + R  PR Y
Sbjct: 33  RSIAACKRCRVRKVKCDQKFPSCSRCVTANEPCVSVDPATGRDVPRSY 80

>Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {ON}
           YLR014C (REAL)
          Length = 906

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRQKKIKCDQEFPSCKRCAKLKVPCVSLDPATGKDVPRSY 76

>TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.235
           YLR014C
          Length = 862

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           AC RCR KK +CD + P C +CA V   C   D  + R  PR Y
Sbjct: 29  ACKRCRLKKIKCDQEFPSCLKCARVKVPCVSLDPATGRDVPRSY 72

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {ON}
           weakly similar to uniprot|P40467 Saccharomyces
           cerevisiae YIL130W ASG1 Proposed transcriptional
           activator member of the Gal4p family of zinc cluster
           proteins and to YJL206C uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 780

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           RV++ACD CR +K RCDG++P C  C    + C
Sbjct: 27  RVSRACDVCRQRKVRCDGRQP-CIHCTVYSYNC 58

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 81/185 (43%), Gaps = 24/185 (12%)

Query: 598 LGSDGSTVGK--IQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNH 655
           L +  ST GK  ++    + LFW +Y +DV+ +  LG+PR + + +++  LP   DDD  
Sbjct: 376 LHTKVSTAGKSPVEAETCKRLFWTIYKMDVYMNCILGLPRSISEEDVDQDLPQDLDDDRI 435

Query: 656 VNLAGQMIALEGKMSPFSLS-----IIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENA 710
            +L G      GK+S   ++     +I     +   L  +       ++  +     EN 
Sbjct: 436 TDL-GIEPQPAGKISSCGMNNQHTKLIVIMNHIHCKLSPLKNDAPPATLLLESVHELENE 494

Query: 711 LDNWRHALPDNLRFQLDVNGTINMEDLNQLKRD-YLNKDTALKLNNAIFMALYFLAKIMI 769
           L NW   LP  LR         N   L+Q + D YL  +  L L+       +  AKIM+
Sbjct: 495 LQNWTLQLPLQLR--------PNYTFLDQAEADLYLKPNKLLLLD-------FLHAKIML 539

Query: 770 HLPVV 774
           + P +
Sbjct: 540 YRPFI 544

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 855

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           AC RCR+KK +CD + P C +CA     C   D  + R  PR Y
Sbjct: 32  ACKRCRTKKIKCDHEFPSCKKCARANKPCVSLDPATGRDVPRSY 75

>SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {ON}
           some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 878

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 114
           RV++ACD CRSKK +C+G++  CS C   G  C  +  + +R
Sbjct: 11  RVSKACDSCRSKKIKCNGEQ-TCSNCLKYGCPCTYTHTIKKR 51

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
           {ON} some similarities with uniprot|P52960 Saccharomyces
           cerevisiae YOR363C PIP2 peroxisome induction pathway 2
           (PIP2) transcriptional activator of peroxisome
           proliferation may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 619

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R    CD CR +K +CD  +P CS+CA  G EC
Sbjct: 10  RRLHVCDACRIRKLKCDKAKPNCSRCAKHGLEC 42

>KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {ON}
           Anc_4.113 YGL013C
          Length = 995

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 109
           +V QACD CR +K +C GK+P CS C A   +C  S+
Sbjct: 18  KVRQACDNCRKRKLKCTGKQP-CSTCEAYSCDCIYSE 53

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1033

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 74  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 118
           + QACD CR KK +C    P+C QC    + C  S K+ R    R
Sbjct: 7   IEQACDNCRLKKLKCSKHFPKCGQCLKNNWPCIYSPKVKRSPLTR 51

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {ON}
           conserved hypothetical protein
          Length = 370

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 109
           RV++ACD CR  KT+CDG+RP CS+C      C  S+
Sbjct: 17  RVSKACDACRKSKTKCDGERP-CSRCLKENKLCTYSN 52

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
           (REAL)
          Length = 1046

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R++  C  CR  KT+CD ++P+CS+C   G +C
Sbjct: 61  RISFVCQACRKSKTKCDREKPECSRCIKHGLKC 93

>KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.17
           YOR363C
          Length = 951

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSR 113
           R++  C  CR  KT+CD ++P CS+C     EC    +L R
Sbjct: 60  RISFVCQACRKAKTKCDKEKPMCSRCRKQDLECVYDIELQR 100

>CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 994

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 30/46 (65%), Gaps = 2/46 (4%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 118
           R++  C  CR  KTRCD ++P C++C  +  EC + D +++++ PR
Sbjct: 22  RISFVCQACRRSKTRCDKEKPICTRCKKLKLEC-VYD-MAKQSAPR 65

>SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]
           {ON} conserved hypothetical protein
          Length = 971

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 63/127 (49%), Gaps = 22/127 (17%)

Query: 584 LTQQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIE 643
           L Q++ L R P++  G    T+ +     RR+LFW ++ LD  +SL   +P L+K  E +
Sbjct: 388 LAQRVMLTRDPTSYHGITDPTLVQ----SRRILFWQIFQLDTLTSLHNNLPPLIKLDEFD 443

Query: 644 CALPVSSDDDNHVNLAGQMIALEGKMSP---FSLSIIRFSKVLGNVLDSIFKRGMTESMT 700
            ALPV                ++G+++P   F  +  RF  +L N L S  K+G  + + 
Sbjct: 444 TALPVE--------------VVQGQLNPSLCFLNAKYRFVLLL-NELCSQSKKGTFQGLK 488

Query: 701 KQVALVH 707
           +++  +H
Sbjct: 489 ERIVDLH 495

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
           (REAL)
          Length = 469

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 74  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 115
           V  ACD CR ++ +CDGK+P CS+C    FEC     L +R 
Sbjct: 4   VKYACDFCRVRRVKCDGKKP-CSRCIQHDFECTYQQPLRKRG 44

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           RV +ACD CR KK +CD + P C  C    +EC
Sbjct: 13  RVTRACDECRKKKVKCDSRHP-CIHCTVYSYEC 44

>KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {ON}
           Anc_6.279 YPL248C
          Length = 834

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 74  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           + QACD CR KK RC  ++P C +C      C  S +  R    R +
Sbjct: 1   MEQACDICRVKKLRCSKEKPSCFKCLKNNLTCTYSPRAKRSPLTRAH 47

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
           MAL33MAL-activator protein, part of complex locus MAL3;
           nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 74  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 115
           V  ACD CR ++ +CDGK+P CS+C    F+C     L +R 
Sbjct: 4   VKYACDYCRVRRVKCDGKKP-CSRCIEHNFDCTYQQPLKKRG 44

>AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YOL089C
           (HAL9)
          Length = 879

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 114
           RV++ACD CR+KK RC+G+ P C  C      C  +  + RR
Sbjct: 76  RVSKACDICRAKKIRCNGEEP-CVNCEKFNLGCTYTHVIKRR 116

>Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W
           (REAL)
          Length = 775

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 9/38 (23%)

Query: 76  QACDRCRSKKTRCDGKRPQCSQCA---------AVGFE 104
           ++C+ CR +K RCDGKRP+CS C          A+GFE
Sbjct: 10  RSCELCRKRKLRCDGKRPRCSTCVRKKSSECTYAIGFE 47

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
           {ON} some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1020

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 73  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           +V++ACD+CR KK +CD     P CS C  VG  C       +R   +GY
Sbjct: 31  KVSRACDQCRKKKIKCDVSEDNPVCSGCFKVGDRCTFERVPLKRGPSKGY 80

>TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1.380
           YLR256W
          Length = 1422

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 102
           R+  +C  CR +K +CD KRP C+QC   G
Sbjct: 113 RIPLSCTICRKRKVKCDKKRPHCNQCTKTG 142

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
           Ashbya gossypii AER370W
          Length = 826

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R+ +ACD CR KK +CD + P C  C    +EC
Sbjct: 17  RITRACDECRKKKVKCDNRHP-CIHCTVYSYEC 48

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1207

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS 108
           +V++ACD CR +K +C G+RP C+ C     EC  S
Sbjct: 12  KVSKACDNCRRRKIKCSGERP-CAGCKTYNCECIFS 46

>Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {ON}
           YLR014C (REAL)
          Length = 903

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 32  ACKRCRLKKIKCDQEFPSCKRCAKLQVPCVSLDPATGKDVPRSY 75

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R +  C  C+++K RCD +RP CS+C  +G +C
Sbjct: 26  RRSHVCITCKNQKLRCDRERPSCSRCRRIGRDC 58

>KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17
           YOR363C
          Length = 1045

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R++  C  CR  KT+CD ++P+CS+CA     C
Sbjct: 24  RISLVCQACRKSKTKCDREKPRCSRCAKNNLRC 56

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {ON}
           conserved hypothetical protein
          Length = 362

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 109
           RV++ACD CR  KT+CDG+RP C +C +    C  S+
Sbjct: 6   RVSKACDTCRKSKTKCDGERP-CQRCLSENKICTYSN 41

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
           similarities with uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 571

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 110
           RV+ ACD CR KK +CDG++P C  C     EC  SD+
Sbjct: 23  RVSHACDNCRLKKKKCDGQQP-CKLCKNSENECIYSDR 59

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 6/89 (6%)

Query: 569 GDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSS 628
           G++   Y   G  +       LHR  S+++G        I+   ++ LFW VY +D++ +
Sbjct: 203 GNLKRCYSYMGIALRAAIAEGLHR-KSSLMGP-----TPIEDESKKRLFWTVYKVDIYMN 256

Query: 629 LQLGVPRLMKDHEIECALPVSSDDDNHVN 657
             +G+P+ +    +   LP   DD+N  N
Sbjct: 257 CIMGLPQSISQKTVNMELPKDLDDENITN 285

>Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 aa]
           {ON} YKL015W (REAL)
          Length = 976

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 63/138 (45%), Gaps = 4/138 (2%)

Query: 586 QQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECA 645
           Q LR        + S   T+ K +    R L+W VY  +   S + G+P    D+ I  A
Sbjct: 483 QALRTCLILGLHVDSQSDTLTKYEIEHHRRLWWTVYMFERMLSSKAGLPLSFTDYTISTA 542

Query: 646 LPVSSDDDNHVNLAGQMIALEGKMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVAL 705
           LP   DD+       Q +  + ++    ++I+   K+   +L  +++R    ++   + +
Sbjct: 543 LPADIDDETIEGKNNQYVFRKAELISNCVTIV---KINAQILSKLYQRQPETNIIITLKV 599

Query: 706 VHENALDNWRHALPDNLR 723
           V +  L+ WR+ L D+L+
Sbjct: 600 VIKQLLE-WRNNLSDSLQ 616

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
           weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 934

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 21/39 (53%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 115
            C  CR +K +CD KRP+CS+C   G  C      SR A
Sbjct: 18  VCQECRRRKIKCDKKRPRCSRCVDTGLPCTYLASGSRSA 56

>SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 983

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R++  C  CR  KT+CD ++P C++C   G EC
Sbjct: 23  RISFVCKACRKSKTKCDREKPSCTRCIKNGIEC 55

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 4/37 (10%)

Query: 73  RVAQACDRCRSKKTRCDGKRP----QCSQCAAVGFEC 105
           RV++ACD CR +K +CD KR     +CS C     EC
Sbjct: 248 RVSRACDHCRKRKIKCDEKRDPNTNKCSNCIKYNSEC 284

>Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W
           (REAL)
          Length = 1045

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R++  C  CR  KT+CD ++P+C +C   G +C
Sbjct: 61  RISFVCQACRKSKTKCDREKPECGRCTKHGLKC 93

>YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON}
           PPR1Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain, positively
           regulates transcription of URA1, URA3, URA4, and URA10,
           which are involved in de novo pyrimidine biosynthesis,
           in response to pyrimidine starvation; activity may be
           modulated by interaction with Tup1p
          Length = 904

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSY 76

>Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON}
           complement(89752..93018) [3267 nt, 1089 aa]
          Length = 1088

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 114
           R++  C +CR  KTRCD ++P C++C      C    +L ++
Sbjct: 34  RISFVCQQCRKAKTRCDKEQPNCTRCIKNNLNCIYDIELQKK 75

>ACL093C Chr3 complement(178239..181271) [3033 bp, 1010 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIR023W
           (DAL81)
          Length = 1010

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 82/206 (39%), Gaps = 64/206 (31%)

Query: 609 QQGERRVLFWGVYYLDV--------FSSLQLG---VPRLMKDHEIECALPV--SSDDDNH 655
           ++G RR L W V+Y D         +S L LG   + +++ D +     PV  +S + ++
Sbjct: 479 ERGLRRRLAWAVWYQDKWISMLEARYSHLILGRNWLVKMLSDQDFSANSPVISNSQEKSN 538

Query: 656 VNLAGQMIALEGKMSPFSLSI--------------------IRFSKVLGNVLDSIFKRGM 695
            N+        GK +P ++S+                    +  S +LG +LD+ +  G 
Sbjct: 539 ANIG------TGKTAPSNISVLDLSPTDEDFNNGKLLFRQMVSLSIILGEILDTFYTLGA 592

Query: 696 TESMTK-----QVALVHENALDNWRHALPDNLRFQLDVNGTINMEDLNQLKRDYLNKDTA 750
             + TK     ++A   +  L  W H+LP  L              +N  +    N + +
Sbjct: 593 ISTTTKIEQVLKLAKPLQLKLREWYHSLPSKL-------------SMNNFQPRKFNSNAS 639

Query: 751 LKLNNAIFMALYFLAKIMIHLPVVAT 776
           L L        YF A+I +H  ++ T
Sbjct: 640 LTL-------AYFAAEITLHRKIITT 658

>CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar to
           uniprot|P12383 Saccharomyces cerevisiae YGL013c PDR1
           transcription factor
          Length = 1107

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 114
           +V +ACD CR +K +C+G +P C  C   G EC  +D  S +
Sbjct: 26  KVGKACDSCRRRKIKCNGLKP-CPSCTIYGCECTYTDAKSTK 66

>KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {ON}
           weakly similar to uniprot|P04386 Saccharomyces
           cerevisiae YPL248C GAL4 DNA-binding transcription factor
           required for the activation of the GAL genes in response
           to galactose repressed by Gal80p and activated by Gal3p
          Length = 749

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 76  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           QACD CR KK +C  + P CS C    ++C  S K  R    R +
Sbjct: 9   QACDWCRRKKLKCSREHPICSNCFKHNWDCHYSPKKVRSPLTRAH 53

>Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to
           Ashbya gossypii ADR403C
          Length = 978

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R++  C  CR  KT+CD ++P+CS+CA    +C
Sbjct: 27  RISFVCQACRKSKTKCDREKPRCSRCAKNNIKC 59

>Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W
           (REAL)
          Length = 1040

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R++  C  CR  KT+CD ++P+C +C   G +C
Sbjct: 61  RISFVCQACRKSKTKCDREKPECGRCIKHGLKC 93

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
           PDR1Zinc cluster protein that is a master regulator
           involved in recruiting other zinc cluster proteins to
           pleiotropic drug response elements (PDREs) to fine tune
           the regulation of multidrug resistance genes
          Length = 1068

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 110
           +V++ACD CR +K +C+GK P C+ C     EC  S +
Sbjct: 41  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFSTR 77

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 3/36 (8%)

Query: 73  RVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 105
           R A+AC+ CR +KT+CD   P   +CS C+  G +C
Sbjct: 173 RAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDC 208

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R    C  CR++K +CD +RP+C +C  +G EC
Sbjct: 15  RSYSGCWTCRARKVKCDTQRPKCCRCKQLGIEC 47

>ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL051W
           (OAF1) and YOR363C (PIP2); Tandem gene triplication in
           this genome
          Length = 970

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 118
           R++  C  CR  KT+CD ++P+CS+CA    +C + D   +RA PR
Sbjct: 27  RISFVCQACRKSKTKCDREKPRCSRCAKNNVKC-VYDIEKQRA-PR 70

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
           Anc_7.17 YAL051W
          Length = 944

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 72  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           YR++  C  CR  K +CD ++P CS+C+    EC
Sbjct: 34  YRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLEC 67

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
           similar to uniprot|P35995 Saccharomyces cerevisiae
           YKL222C Hypothetical ORF and similar to uniprot|Q12340
           Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKISDKLSRRAFP 117
           +V ++C  CR +K +CD K+P+CS CAA    EC   +K +    P
Sbjct: 14  KVIKSCLFCRKRKLKCDHKKPKCSTCAARNLPECVYVEKFTHEIDP 59

>CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 1022

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 115
           R++  C  CR  KT+CD ++P CS+C   G  C + D  S++A
Sbjct: 18  RLSFVCQGCRKAKTKCDKEKPACSRCLKHGIRC-VYDLTSQKA 59

>KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]
           {ON} uniprot|P08657 Kluyveromyces lactis LAC9 Lactose
           regulatory protein LAC9
          Length = 865

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%)

Query: 76  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           QACD CR KK +C    P C+ C     +C  S ++ R    R +
Sbjct: 93  QACDACRKKKWKCSKTVPTCTNCLKYNLDCVYSPQVVRTPLTRAH 137

>Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {ON}
           YLR014C (REAL)
          Length = 899

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRLKKIKCDQEFPSCKRCANLEVPCVSLDPATGKDVPRSY 76

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
           similar to uniprot|P05085 Saccharomyces cerevisiae
           YML099C ARG81 Zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type involved in
           the regulation of arginine-responsive genes acts with
           Arg80p and Arg82p
          Length = 848

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
            C  CRS+K +CD  RP C +C   GFEC
Sbjct: 19  GCWTCRSRKVKCDLGRPSCKRCERSGFEC 47

>ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar to
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate-activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1035

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRG 119
           R++  C  CR  KT+CD ++P+C +C   G  C + D + ++A PR 
Sbjct: 55  RISFVCKACRRSKTKCDREKPKCGRCVQHGIAC-VYD-VEKQAAPRN 99

>YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}
           OAF1Oleate-activated transcription factor, acts alone
           and as a heterodimer with Pip2p; activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1047

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R+   C  CR  KT+CD ++P+C +C   G +C
Sbjct: 61  RILFVCQACRKSKTKCDREKPECGRCVKHGLKC 93

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
           (REAL)
          Length = 542

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 118
           RV +AC  CR +K +C+GK P C  C A G+ C  +D       PR
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59

>ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; No
           homolog in Saccharomyces cerevisiae
          Length = 817

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 4/79 (5%)

Query: 579 GKVVSLTQQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMK 638
            ++  L Q+L+L   P  V GS    +  +Q   RR++FW ++ LD  +SLQ  +P L++
Sbjct: 274 AQLARLAQRLQLTADPEYVPGS--REMADVQ--FRRIIFWQIFQLDTLTSLQNRLPPLLR 329

Query: 639 DHEIECALPVSSDDDNHVN 657
            +E E +LP   D+   +N
Sbjct: 330 YNECETSLPSEFDEGGKLN 348

>TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {ON}
           Anc_7.17 YOR363C
          Length = 1274

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R++  C  CR  KT+C+  +P CS+C  +G  C
Sbjct: 69  RISFVCQSCRKSKTKCNKDKPSCSRCKKLGIFC 101

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {ON}
           YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 73  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           + ++ACD+CR KKTRCD   + P C+ C  +   C       +R   +GY
Sbjct: 34  KTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTCTFERVPMKRGPTKGY 83

>TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa]
           {ON} 
          Length = 847

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R+   C  CR+KK +CD K+P C +C   G  C
Sbjct: 9   RLNNGCWTCRTKKVKCDSKKPFCDKCKDSGLHC 41

>Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}
           YER184C (REAL)
          Length = 170

 Score = 41.6 bits (96), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 110
           RV++AC+RCR KK +CD K+P C  C     +C+  ++
Sbjct: 13  RVSKACERCRRKKVKCDSKKP-CFGCIGSQSKCRYKNQ 49

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {ON}
           YGL013C (REAL)
          Length = 1069

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 110
           +V++ACD CR +K +C+GK P C+ C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFTTR 74

>SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON}
           weakly similar to uniprot|P33200 Saccharomyces
           cerevisiae YBL005W PDR3 Transcriptional activator of the
           pleiotropic drug resistance network regulates expression
           of ATP-binding cassette (ABC) transporters through
           binding to cis-acting sites known as PDREs (PDR
           responsive elements)
          Length = 940

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS 108
           +V++ACD CR +K +C GK+P CS C A    C+ S
Sbjct: 23  KVSRACDNCRRRKIKCTGKQP-CSNCQAYQCHCEYS 57

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {ON}
           
          Length = 1113

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 109
           +V++AC  CR +K +C G  P CS CAA   EC   D
Sbjct: 32  KVSKACANCRRRKIKCTGTYP-CSNCAAYQCECIFDD 67

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {ON}
           YGL013C (REAL)
          Length = 1080

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 110
           +V++ACD CR +K +C+GK P C+ C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFTSR 74

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6.60
           YLR266C
          Length = 795

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           ++ +AC  CR +K +CD  +P+C QC++    C
Sbjct: 9   KIIKACVFCRKRKLKCDLTKPKCKQCSSRNLNC 41

>SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]
           {ON} similar to gnl|GLV|KLLA0A03421g Kluyveromyces
           lactis KLLA0A03421g and weakly similar to YAL051W
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate- activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta- oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 946

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           +++  C  CR  KT+CD ++P CS+C  +G +C
Sbjct: 24  KLSFVCQSCRKSKTKCDKQKPSCSRCLRLGHQC 56

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC--KISDKLSRR 114
           RV++ACD CR +K RCD   PQ   CS C      C  K  D++ R+
Sbjct: 128 RVSKACDHCRKRKIRCDEVDPQTNKCSNCVKFQSACTFKHRDEILRK 174

>TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {ON}
           Anc_7.17 YOR363C
          Length = 989

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R++  C  CR  KT+CD ++P+C +C   G +C
Sbjct: 40  RISFVCQACRRSKTKCDREKPRCGRCQQHGLQC 72

>Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380W
           (REAL)
          Length = 546

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK--LSRRAFP 117
           RV +AC  CR +K +C+GK P C  C + G+ C   DK   S  +FP
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFP 60

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
           weakly similar to uniprot|P39720 Saccharomyces
           cerevisiae YAL051W OAF1 Oleate-activated transcription
           factor acts alone and as a heterodimer with Pip2p
           activates genes involved in beta-oxidation of fatty
           acids and peroxisome organization and biogenesis
          Length = 922

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R++  C  CR +K +CD +RP C QCA  G  C
Sbjct: 20  RLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTC 52

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8.879
           YML099C
          Length = 1132

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 106
           R    C  CRS+K +CD ++PQC +C     +C+
Sbjct: 11  RTYSGCWTCRSRKIKCDQQKPQCKRCLKANLKCE 44

>NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {ON}
           Anc_7.17
          Length = 1161

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R++  C  CR  KT+CD ++P C++C     +C
Sbjct: 64  RISFVCQECRKAKTKCDKEKPYCTRCVKQNIKC 96

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
           (REAL)
          Length = 545

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 110
           RV +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51

>KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.654
           YKL015W
          Length = 818

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 63/144 (43%), Gaps = 4/144 (2%)

Query: 586 QQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECA 645
           Q LR        + S   ++ + +    R L+W VY  +   S + G+P    D+ I   
Sbjct: 386 QALRTCLILGLHVDSQSDSIDRFKLEHHRRLWWTVYMFERMLSSKAGLPLSFTDNTISTE 445

Query: 646 LPVSSDDDNHVNLAGQMIALEGKMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVAL 705
           LP   D  N  N     I  + +     + I+R   V  N+L  +++R    ++   +  
Sbjct: 446 LPNDFDMSNPPNECEHYIFPKAEYISSCVKIVR---VNANILSQLYQRQPKHNILPVLQK 502

Query: 706 VHENALDNWRHALPDNLRFQLDVN 729
           + +N L +WR+ L DNL+   ++N
Sbjct: 503 IMKN-LSSWRNELSDNLQVDFNLN 525

>KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON}
           uniprot|Q6DR96 Kluyveromyces lactis HAP1
          Length = 1253

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 102
           RV  +C  CR +K +CD  RPQC QC   G
Sbjct: 20  RVPLSCTICRKRKVKCDKGRPQCQQCVKTG 49

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
           {ON} weakly similar to uniprot|P12383 Saccharomyces
           cerevisiae YGL013C PDR1 Zinc cluster protein that is a
           master regulator involved in recruiting other zinc
           cluster proteins to pleiotropic drug response elements
           (PDREs) to fine tune the regulation of multidrug
           resistance genes
          Length = 1082

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS 108
           +V++ACD CR KK +C G  P C  C   G EC  S
Sbjct: 50  KVSRACDSCRKKKIKCSGTLP-CKSCETYGCECVYS 84

>KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa]
           {ON} weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 1040

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS 108
           RV+  C  CR +KTRCD   P CS+C A+  EC  S
Sbjct: 70  RVSYVCYACRRRKTRCDRGNP-CSKCVALSTECVYS 104

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC--KISDKLSRR 114
           RVA+ACD CR +K +CD   PQ   CS C      C  ++ D + +R
Sbjct: 113 RVARACDHCRRRKIKCDPVNPQTNKCSNCTKYDANCTFRVRDDVEKR 159

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {ON}
           
          Length = 1136

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R++  C  CR  K +CD ++P+C++C   G +C
Sbjct: 45  RISFVCQNCRKSKMKCDREKPECTRCLKQGIKC 77

>Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W
           (REAL)
          Length = 468

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 115
           ACD CR ++ +CDGK+P C +C    FEC     L +R 
Sbjct: 7   ACDYCRVRRVKCDGKKP-CRRCLQHNFECTHQQPLKKRG 44

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
           YKL222C (REAL)
          Length = 688

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           +  +AC  CR KK +CD  RPQC QC     EC
Sbjct: 11  KAIKACLNCRRKKQKCDQARPQCYQCRIRKTEC 43

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
           PUT3Transcriptional activator of proline utilization
           genes, constitutively binds PUT1 and PUT2 promoter
           sequences as a dimer and undergoes a conformational
           change to form the active state; differentially
           phosphorylated in the presence of different nitrogen
           sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 62/138 (44%), Gaps = 4/138 (2%)

Query: 586 QQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECA 645
           Q LR        + S   T+ + +    R L+W VY  +   S + G+P    D+ I  A
Sbjct: 486 QALRTCLILGLHVDSQSDTLSRYEIEHHRRLWWTVYMFERMLSSKAGLPLSFTDYTISTA 545

Query: 646 LPVSSDDDNHVNLAGQMIALEGKMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVAL 705
           LP   DD+         +  + ++    ++I+   K+   +L  +++R    ++   + +
Sbjct: 546 LPADIDDETIEEKNSHYVFRKAELISNCVTIV---KINAQILSKLYQRQPETNIIITLKV 602

Query: 706 VHENALDNWRHALPDNLR 723
           V +  L+ WR+ L D+L+
Sbjct: 603 VIKQLLE-WRNNLSDSLQ 619

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
           RDR1Transcriptional repressor involved in the control of
           multidrug resistance; negatively regulates expression of
           the PDR5 gene; member of the Gal4p family of zinc
           cluster proteins
          Length = 546

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 109
           RV +AC  CR +K +C+GK P C  C A G+ C   D
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYID 50

>SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa]
           {ON} weakly similar to uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1061

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 3/36 (8%)

Query: 73  RVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 105
           RV++ACD CR +K +CD  +P   +CS C     EC
Sbjct: 134 RVSKACDHCRKRKIKCDDVKPRTGKCSNCTKFNAEC 169

>TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {ON}
           Anc_7.389 YBL066C
          Length = 1077

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%), Gaps = 3/40 (7%)

Query: 71  NYRVAQACDRCRSKKTRCDG--KRPQ-CSQCAAVGFECKI 107
           N+R   +C  CR +K RC+   K+PQ C++CA +  +C I
Sbjct: 24  NHRPVTSCTHCRQQKIRCNALQKQPQPCTRCAKLNLKCNI 63

>KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {ON}
           some similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222c
          Length = 658

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKISD 109
           +V ++C  CR +K +CD KRP C+ C   G  EC  +D
Sbjct: 85  KVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSECVYTD 122

>Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii AGL233C
          Length = 926

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-EC 105
           +V+++C  CR ++ +CD  RP+CS C + G  EC
Sbjct: 14  KVSKSCVFCRKRRVKCDKARPKCSTCVSKGLPEC 47

>Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 73  RVAQACDRCRSKKTRCDGK--RPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           + ++ACD+CR KK +CD K  R  CS C   G  C       +R   +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDERGVCSNCQRNGDRCSFERVPLKRGPSKGY 91

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 aa]
           {ON} YMR019W (REAL)
          Length = 911

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 118
           RV +AC+ C+ +K +CDG RP C  C+    EC+   K + R   R
Sbjct: 41  RVQKACEICKRRKVKCDGNRP-CLNCSKHKKECRYDFKATNRRKKR 85

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
           similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
           cerevisiae YBR150c TBS1
          Length = 1049

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 73  RVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 105
           R  +ACD CR +K RCD   P   +CS C     EC
Sbjct: 36  RSTKACDHCRKRKIRCDEVNPVTNKCSNCVKFKVEC 71

>YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON}
           PIP2Autoregulatory oleate-specific transcriptional
           activator of peroxisome proliferation, contains
           Zn(2)-Cys(6) cluster domain, forms heterodimer with
           Oaf1p, binds oleate response elements (OREs), activates
           beta-oxidation genes
          Length = 996

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRG 119
           R++  C  CR  KT+CD ++P+C +C      C I D ++R+A PR 
Sbjct: 20  RLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQAAPRN 64

>Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa]
           {ON} YAL051W (REAL)
          Length = 1000

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRG 119
           R++  C  CR  KT+CD ++P+C +C      C I D ++R+A PR 
Sbjct: 20  RLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQAAPRN 64

>CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} similar
           to uniprot|P12351 Saccharomyces cerevisiae YLR256w HAP1
           transcription factor
          Length = 1372

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 102
           RV  +C  CR +K +CD  RP C+QC   G
Sbjct: 66  RVPLSCTICRRRKVKCDKSRPNCTQCVKTG 95

>KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conserved
           hypothetical protein
          Length = 639

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKL 111
           R    C +C+S K +CD  +P C  C   GF+C  S  L
Sbjct: 12  RSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQCDYSRTL 50

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
            C  CRS+K +CD +RP C +C   G EC
Sbjct: 20  GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48

>NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]
           {ON} Anc_7.17
          Length = 1022

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R++  C  CR  KT+CD ++P C++C      C
Sbjct: 41  RISFVCQECRKAKTKCDKEKPACTRCVKQNLAC 73

>NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON} 
          Length = 656

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R    C  CR++K RC+ +RP CS+C  +G  C
Sbjct: 10  RPTHVCAACRTQKLRCNRERPSCSRCQRIGRTC 42

>AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL248C
           (GAL4)
          Length = 648

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 74  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           V QACD CR +K +C    P+C++C      C  S K+ R    R +
Sbjct: 5   VIQACDSCRRRKMKCSKTFPKCAKCREDNRVCLYSPKIRRSPLTRAH 51

>TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON} 
          Length = 810

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 21/46 (45%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPR 118
           R  Q CDRCR  K +C G   QC+ C      C     L RR  P+
Sbjct: 38  RRDQVCDRCRKLKKKCYGLGRQCNNCQLSNNPCTTMATLKRRRKPK 83

>CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256w HAP1 transcription factor
          Length = 1355

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 102
           R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 18  RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 47

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2.547
           YKL038W
          Length = 1088

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 73  RVAQACDRCRSKKTRCDG--KRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           + ++ACD+CR KK +CD    R  C+ C   G +C       +R   +GY
Sbjct: 58  KASRACDQCRKKKVKCDNGDDRSVCTNCQRNGEKCTFERVPLKRGPSKGY 107

>KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1233

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 102
           R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 33  RIPLSCTICRKRKVKCDKIRPHCNQCTKTG 62

>TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]
           {ON} Anc_6.75 YLR278C
          Length = 1530

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%)

Query: 75  AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFP 117
           +++C  CR +K RCD K P C+ C   G +C    + S  A P
Sbjct: 38  SKSCLLCRRRKQRCDHKLPSCTACLKAGVKCVQPARYSNNAAP 80

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
           YGR288W (REAL)
          Length = 143

 Score = 39.7 bits (91), Expect = 0.010,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query: 74  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 115
           V QACD CR ++ +CDGK P C +C      C     L +R 
Sbjct: 37  VKQACDCCRVRRVKCDGKGP-CGRCLQRDLNCTYLQPLRKRG 77

>KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON} 
          Length = 1476

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 102
           R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 47  RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 76

>KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]
           {ON} Anc_2.547 YKL038W
          Length = 1286

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 73  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           + ++ACD+CR KK +CD    R  C+ C  +G  C       +R   +GY
Sbjct: 50  KASRACDQCRRKKIKCDYNDMRNICTNCQRIGERCSFERVPLKRGPTKGY 99

>Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340)
           [3870 nt, 1290 aa]
          Length = 1289

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 102
           R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 22  RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 51

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 73  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           + ++ACD+CR KK +CD   ++  CS C   G +C       +R   +GY
Sbjct: 70  KASRACDQCRKKKIKCDFSEEKTLCSNCQRNGEKCTFERVPLKRGPSKGY 119

>KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conserved
           hypothetical protein
          Length = 946

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 94/206 (45%), Gaps = 45/206 (21%)

Query: 584 LTQQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIE 643
           L Q+  L R P++      + +G IQ   RR+LFW ++ LD  +SL   +P L+K  + +
Sbjct: 331 LAQRAMLSRDPASY--HQITDLGLIQC--RRILFWQIFQLDTMTSLYDNLPPLIKVDDFD 386

Query: 644 CALPVSSDDDNHVNLAGQMIALEGKMSPFSLSII----RFSKVLGNVLDSIFKRGMTESM 699
            ALP                 + G++ P SL ++    RF  +L N L S+  RG  + +
Sbjct: 387 TALPAE--------------VVRGELDP-SLCLLNAKYRFVLLL-NELCSLTNRGTFQGL 430

Query: 700 TKQVALVHENALDNWRHALPDNLRFQLDVNGTINMEDLNQLKRDYLNKDTALKLNNAIFM 759
            +++  +H   + +   AL  +LR     NG +   D             A  ++ A+FM
Sbjct: 431 KERIVDLHVCCMGS---AL--SLRNYNKENGRLTTSD-------------AKFIDWAVFM 472

Query: 760 ALYFL--AKIMIHLPVVATK-PIIDK 782
              F   A +++HL ++ T  PI+ K
Sbjct: 473 LNTFADRACLLLHLNIIKTSLPILMK 498

 Score = 35.8 bits (81), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK--ISDKLSRRAFP 117
           R   +C  C  +K +C  ++P CS+C    ++C   ++D++SR   P
Sbjct: 30  RKILSCVPCHKRKIKCTREQPSCSKCLKRNWDCSYFLNDRVSRGGQP 76

>NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON} 
          Length = 701

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKISDK 110
           RV ++C  CR +K++CD  +P CS C   G  EC+  D+
Sbjct: 21  RVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDDR 59

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {ON}
           Anc_4.113
          Length = 1118

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRR 114
           +V +ACD CR +K +C GK P C+ C A    C  S +  R+
Sbjct: 58  KVTKACDNCRRRKIKCTGKTP-CATCEAYQCLCIYSTQRGRK 98

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC 105
           RV++ACD CR +K RCD   PQ   CS C      C
Sbjct: 131 RVSKACDHCRKRKIRCDEVDPQTDKCSNCVKFQSVC 166

>KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene
           extends into a gap in the genome sequence
          Length = 729

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 76  QACDRCRSKKTRCDGKRPQCSQCAAVGF-EC 105
           + C  CR +K RCD  RP CS C A GF EC
Sbjct: 23  RTCTFCRQRKVRCDQGRPLCSSCKARGFSEC 53

>Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {ON}
           YGL013C (REAL)
          Length = 1000

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 110
           +V++ACD CR +K +C+GK P C+ C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYLCECTFTTR 74

 Score = 34.3 bits (77), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 613 RRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALP 647
           RR L+W  YY +   + +LG P  + D +I C LP
Sbjct: 519 RRSLWWKAYYFEKTLASKLGYPSNIDDSKINCLLP 553

>Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL038W
           (REAL)
          Length = 1169

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 73  RVAQACDRCRSKKTRCDGK--RPQCSQCAAVGFECKISDKLSRRAFPRGY 120
           + ++ACD+CR KK +CD K  R  C+ C   G  C       +R   +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDERGVCTNCQRNGDRCSFERVPLKRGPSKGY 91

>ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]
           {ON} weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184C Hypothetical ORF
          Length = 724

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISD 109
           +V +AC  CR +K RCDG  P CS C ++  EC   D
Sbjct: 8   KVKRACQICRRRKIRCDGYLP-CSSCVSLKKECNYHD 43

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184c
          Length = 835

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           RV +ACD CR +K +CDG +P CS C      C
Sbjct: 16  RVIRACDVCRKRKVKCDGDQP-CSSCMTASTVC 47

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
           {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
           YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
           fungal- type binuclear cluster domain DNA-binding
           transcriptional activator or CHA1 and some similarities
           to YOR337W uniprot|P47988 Saccharomyces cerevisiae
           YOR337W TEA1 Mutants are defective in Ty1
           Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKI--SDKLSRRA 115
           AC  CR K+ +CD +RP CS C   G EC    +DK ++R 
Sbjct: 16  ACQNCRIKRRKCDMERP-CSNCLKYGIECITVNNDKRTKRT 55

>YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}
           MAL13MAL-activator protein, part of complex locus MAL1;
           nonfunctional in genomic reference strain S288C
          Length = 473

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 76  QACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           QACD CR ++ +CDGKRP CS C     +C
Sbjct: 11  QACDCCRIRRVKCDGKRP-CSSCLQNSLDC 39

>Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} similar
           to Ashbya gossypii AFR117C
          Length = 1198

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 102
           R+  +C  CR +K RCD  +P C+QC   G
Sbjct: 14  RIPLSCTICRKRKVRCDKTKPHCTQCVKTG 43

>TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON} 
          Length = 918

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 76  QACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKISDKLS 112
           ++C  CR +K +CD  +P CS C A  F EC  SD ++
Sbjct: 33  KSCSFCRRRKLKCDKSKPLCSTCRARNFTECIYSDAIN 70

>TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.59
           YHR178W
          Length = 877

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 115
           +C RCR  K +C  + P+CS C A  + C+   +L RR+
Sbjct: 97  SCSRCRRLKKKCLRQMPKCSNCVASHYACEYIGRLPRRS 135

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
           274] FULL
          Length = 628

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R++  CD CR +K +C+ ++P CS+C     +C
Sbjct: 10  RISHVCDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON}
           YER184C (REAL)
          Length = 793

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 71  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           N RV++AC+RC  KK +CD K+P C  CA    +C
Sbjct: 11  NSRVSKACERCHRKKIKCDSKKP-CFGCAGSRSKC 44

>Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W
           (REAL)
          Length = 831

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK--LSRRAFPRGY 120
           R+   C +C+  K +CD  RP CS+C     ECK  D   LS +    G+
Sbjct: 10  RLRLVCLQCKRIKRKCDKLRPVCSRCQQHSLECKYEDSADLSSKVIASGF 59

>YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}
           RGT1Glucose-responsive transcription factor that
           regulates expression of several glucose transporter
           (HXT) genes in response to glucose; binds to promoters
           and acts both as a transcriptional activator and
           repressor
          Length = 1170

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQ--CSQCAAVGFECKISDKLSRRAFPRGY 120
           + ++ACD+CR KK +CD K  +  CS C   G  C       +R   +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDEKGVCSNCQRNGDRCSFDRVPLKRGPSKGY 91

>NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1581

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 102
           RV  +C  CR +K +CD  RP C QC   G
Sbjct: 61  RVPLSCTICRKRKVKCDKIRPHCQQCTKTG 90

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
           YML099C
          Length = 835

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
            C  CRS+K +CD +RP C +C   G +C
Sbjct: 27  GCWTCRSRKVKCDLQRPNCGRCEKSGLDC 55

>NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423
          Length = 775

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 21/40 (52%)

Query: 76  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 115
             CD C+ ++ +CD  +P C +C  +  EC  S    R+A
Sbjct: 56  NGCDNCKRRRVKCDELKPTCQKCINMNLECVYSMPKPRKA 95

>NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3.109
           YBR150C
          Length = 1001

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 73  RVAQACDRCRSKKTRCDG---KRPQCSQCAAVGFECKISDKLSRRA 115
           R ++ACD CR +K +CD    +  +CS C     EC  S++  R+ 
Sbjct: 98  RASKACDLCRRRKIKCDAFDDRLKKCSNCIKYHSECTFSNQNKRKG 143

>NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON}
           Anc_1.380
          Length = 1478

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 102
           RV  +C  CR +K +CD  RP C QC   G
Sbjct: 38  RVPLSCTICRKRKVKCDKIRPHCQQCTKTG 67

>NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {ON} 
          Length = 909

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 3/38 (7%)

Query: 71  NYRVAQ---ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           NYR A+    C  CRSKK +CD  RP C +C      C
Sbjct: 5   NYRKARPSFVCLVCRSKKVKCDKARPSCGRCRKTNKLC 42

>Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQ--CSQCAAVGFECKISDKLSRRAFPRGY 120
           + ++ACD+CR KK +CD K  +  CS C   G  C       +R   +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDEKGLCSNCQRNGDRCSFERVPLKRGPSKGY 91

>CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {ON}
           similar to uniprot|Q12151 Saccharomyces cerevisiae
           YDR213w UPC2
          Length = 844

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 18/33 (54%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           +    CD C+ ++ +CD  +P C +C  +  EC
Sbjct: 49  KSKNGCDHCKRRRVKCDEGKPMCDKCVKMKLEC 81

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {ON}
           
          Length = 1108

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           +V +AC  CR +K +C G  P CS CAA   EC
Sbjct: 12  KVVKACLNCRRRKIKCTGTFP-CSNCAAYQCEC 43

>TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.60
           YLR266C
          Length = 935

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 74  VAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKISD 109
           + + C  CR KK +CD +RP CS C A  F EC   D
Sbjct: 78  IIKTCLFCREKKLKCDKRRPLCSSCIARNFTECVYVD 114

>KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly
           similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 880

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 72  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           Y+++  C  CR  KT+CD K+P C++C  +   C
Sbjct: 15  YKLSFVCQLCRKSKTKCDRKKPSCARCQRLNKPC 48

>CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} similar
           to uniprot|P32862 Saccharomyces cerevisiae YKL038w RGT1
          Length = 1287

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 74  VAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKI 107
           V++ACD+CR KK +CD   +R  C+ C   G  CK 
Sbjct: 12  VSRACDQCRRKKIKCDRNQERNICTSCQRNGERCKF 47

>Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 bp,
           1240 aa] {ON} ANNOTATED BY YGOB -
          Length = 1240

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 102
           RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 11  RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1.380
           YLR256W
          Length = 1429

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFE 104
           R+  +C  CR +K +CD   P C+QC   G +
Sbjct: 40  RIPLSCTICRKRKVKCDKTHPHCNQCVKTGVQ 71

>SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256W HAP1
          Length = 1244

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 102
           RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 11  RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON} 
          Length = 791

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query: 71  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           ++RV++AC+ CR +K +C+G +P CS+C      C
Sbjct: 17  SHRVSRACNSCRKRKVKCNGVQP-CSKCITSNLRC 50

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
           similar to uniprot|P36023 Saccharomyces cerevisiae
           YKR064W
          Length = 657

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%)

Query: 72  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 115
           +R    C  CR +KT+CD  +P CS C  +G  C  S+     A
Sbjct: 15  HRPTLVCLNCRRRKTKCDRGKPSCSNCLKLGETCVYSEDTDENA 58

>KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {ON}
           Anc_8.423 YLR228C
          Length = 730

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 12/54 (22%)

Query: 76  QACDRCRSKKTRCDGKRPQCSQCAAVGFEC------------KISDKLSRRAFP 117
             CD C+ ++ +CD  +P C +CA +  EC            K+S+ L R   P
Sbjct: 32  NGCDNCKRRRVKCDEGKPFCQKCANMRLECVFTPPQPRRKKSKVSNTLKRDCEP 85

>KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} similar
           to uniprot|Q758X5 Ashbya gossypii ADR403C ADR403Cp and
           weakly similar to YAL051W uniprot|P39720 Saccharomyces
           cerevisiae YAL051W OAF1 Oleate-activated transcription
           factor acts alone and as a heterodimer with Pip2p
           activates genes involved in beta-oxidation of fatty
           acids and peroxisome organization and biogenesis
          Length = 975

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R++  C  CR  KT+CD ++P+C +C     +C
Sbjct: 30  RISFVCQACRKNKTKCDREKPRCGRCVKYHLKC 62

>AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR256W
           (HAP1)
          Length = 1152

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 102
           RV  +C  CR +K +CD  RP C+QC   G
Sbjct: 14  RVPLSCTICRKRKVKCDKTRPHCNQCTKTG 43

>KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa]
           {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
           YLR256W HAP1
          Length = 1237

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 102
           RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 11  RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON}
           Anc_8.879 YML099C
          Length = 953

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
            C  CRS+K +CD +RP CS+C     +C
Sbjct: 11  GCWTCRSRKVKCDLRRPNCSRCERSELQC 39

>ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]
           {ON} similar to uniprot|Q754A1 Ashbya gossypii AFR171W
           AFR171Wp and some similarites with YDR034C
           uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 653

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 21/29 (72%)

Query: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
            C+ C+ +K +CD ++P+C QC+ +G +C
Sbjct: 20  GCNECKKRKVKCDEQKPECWQCSHLGKKC 48

>Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON}
           complement(3488..5758) [2271 nt, 757 aa]
          Length = 756

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query: 75  AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRA 115
           A +C RCR  K +C  +RP C+ C   G  C    +  RR+
Sbjct: 40  AYSCSRCRKLKRKCQKQRPSCANCMNAGATCNYPGRAPRRS 80

>Klac_YGOB_3960 Chr3 (291786..293297,293300..294220) [2433 bp, 810
           aa] {ON} ANNOTATED BY YGOB - Artificial frameshift
           joining KLLA0C03223g and KLLA0C03234g
          Length = 810

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 18/37 (48%)

Query: 75  AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKL 111
           AQ CDRCR  K +C G  P C  C      C ++  L
Sbjct: 49  AQVCDRCRKLKKKCYGTGPSCVNCVVTNNPCTVTTTL 85

>ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]
           {ON} similar to gnl|GLV|KLLA0D10153g Kluyveromyces
           lactis KLLA0D10153g and weakly similar to uniprot|P35995
           Saccharomyces cerevisiae YKL222C Hypothetical ORF
          Length = 648

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 75  AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKL 111
           ++ C  C+ KK RCD K P C+ C+  G+ C  + K+
Sbjct: 8   SKTCTNCQRKKVRCDRKVPACTACSERGYNCIYNVKI 44

>TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON} 
          Length = 722

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKISDKLSRRA 115
           +  ++C  CR +K RCD K+P+CS C A    EC  S  L   A
Sbjct: 8   KAIKSCAFCRRRKLRCDQKKPRCSTCVARNLAECVYSQGLQHNA 51

>KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1148

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 73  RVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 105
           RV++ACDRCR +K +CD   P   +CS C      C
Sbjct: 29  RVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPC 64

>Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W
           (OAF1) - transcription factor [contig 44] FULL
          Length = 944

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105
           R++  C  CR  KT+CD  +P CS+C   G  C
Sbjct: 24  RLSFVCQSCRKGKTKCDRAKPSCSRCLKHGIRC 56

>YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc
           finger transcription factor involved in the complex
           regulation of gene expression in response to levels of
           heme and oxygen; the S288C sequence differs from other
           strain backgrounds due to a Ty1 insertion in the carboxy
           terminus
          Length = 1502

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 102
           R+  +C  CR +K +CD  RP C QC   G
Sbjct: 59  RIPLSCTICRKRKVKCDKLRPHCQQCTKTG 88

>TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1192

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 9/49 (18%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKIS--------DKLSR 113
           +V++AC  CR +K +C+G  P CS C     EC  S        DKL R
Sbjct: 23  KVSKACQSCRRRKIKCNGINP-CSNCTTYECECIYSIPDSNSQTDKLGR 70

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
           (REAL)
          Length = 894

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLS 112
           RV +AC+ C+ +K +CDG +P C  C+    EC+   K++
Sbjct: 27  RVQKACELCKKRKVKCDGNKP-CLNCSKHQKECRYDFKVT 65

>AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL222C
           and YOR172W (YRM1)
          Length = 872

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-EC 105
           +V+++C  CR ++ +C+  RP+CS C   G  EC
Sbjct: 14  KVSKSCVFCRKRRVKCNKARPKCSTCIGKGLPEC 47

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 115,764,341
Number of extensions: 4659519
Number of successful extensions: 15073
Number of sequences better than 10.0: 623
Number of HSP's gapped: 15174
Number of HSP's successfully gapped: 697
Length of query: 1285
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1164
Effective length of database: 39,606,813
Effective search space: 46102330332
Effective search space used: 46102330332
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)