Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ABL120W8.846ON24924911291e-158
Ecym_46178.846ON2492498051e-108
Kwal_27.102278.846ON2542295072e-63
SAKL0D01320g8.846ON2602345073e-63
KLLA0D01430g8.846ON2632334711e-57
KLTH0C03740g8.846ON2542324701e-57
NDAI0K003308.846ON3132784421e-52
TDEL0B005208.846ON2682164143e-49
NCAS0C003808.846ON2762464154e-49
KAFR0B039608.846ON2782454051e-47
Suva_13.4708.846ON3032664071e-47
KNAG0J002408.846ON2862584052e-47
Smik_13.4948.846ON3042654043e-47
Skud_13.4538.846ON3002633964e-46
ZYRO0G14300g8.846ON2802513946e-46
YMR281W (GPI12)8.846ON3042433922e-45
Kpol_1068.48.846ON2912463572e-40
TPHA0I002808.846ON3012763548e-40
CAGL0M03047g8.846ON3042623495e-39
TBLA0B033008.846ON3192693271e-35
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL120W
         (249 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   439   e-158
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   314   e-108
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   199   2e-63
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   199   3e-63
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   186   1e-57
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   185   1e-57
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   174   1e-52
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   164   3e-49
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   164   4e-49
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   160   1e-47
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   161   1e-47
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   160   2e-47
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   160   3e-47
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   157   4e-46
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   156   6e-46
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   155   2e-45
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   142   2e-40
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   140   8e-40
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   139   5e-39
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   130   1e-35

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  439 bits (1129), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 219/249 (87%), Positives = 219/249 (87%)

Query: 1   MFGSFFXXXXXXXXXXXXXCWSRRRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMF 60
           MFGSFF             CWSRRRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMF
Sbjct: 1   MFGSFFAVVKLYLLLLAVYCWSRRRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMF 60

Query: 61  FAPTLLQLDARLPAWMPFRVVCLTDGGAEGLGQLRRAELQKALRLLVLEHDVTLEVADFT 120
           FAPTLLQLDARLPAWMPFRVVCLTDGGAEGLGQLRRAELQKALRLLVLEHDVTLEVADFT
Sbjct: 61  FAPTLLQLDARLPAWMPFRVVCLTDGGAEGLGQLRRAELQKALRLLVLEHDVTLEVADFT 120

Query: 121 DGMKEDWDLAEVRTRLGELVTDAKPLVLTFDERGVSGHRNHIGCALAAARLGHKTLFLRS 180
           DGMKEDWDLAEVRTRLGELVTDAKPLVLTFDERGVSGHRNHIGCALAAARLGHKTLFLRS
Sbjct: 121 DGMKEDWDLAEVRTRLGELVTDAKPLVLTFDERGVSGHRNHIGCALAAARLGHKTLFLRS 180

Query: 181 ERNLLRKYSFFVLDXXXXXXXXXXXXXXXXXLAQYLHALVAMVVAHRSQMVWFRWGWWMA 240
           ERNLLRKYSFFVLD                 LAQYLHALVAMVVAHRSQMVWFRWGWWMA
Sbjct: 181 ERNLLRKYSFFVLDVFRVVFGTPPPTVFVSTLAQYLHALVAMVVAHRSQMVWFRWGWWMA 240

Query: 241 SRYVYANEY 249
           SRYVYANEY
Sbjct: 241 SRYVYANEY 249

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  314 bits (805), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 180/249 (72%)

Query: 1   MFGSFFXXXXXXXXXXXXXCWSRRRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMF 60
           MFGSFF             C S + LE HN++V+E LVG    +TS+TL+IAHPDDEVMF
Sbjct: 1   MFGSFFAVIKLYLVLLAVYCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMF 60

Query: 61  FAPTLLQLDARLPAWMPFRVVCLTDGGAEGLGQLRRAELQKALRLLVLEHDVTLEVADFT 120
           FAPTLLQLDAR+   +PFRVVCLTDG A+GLG++RR EL KALRLLVLE DV +++  F 
Sbjct: 61  FAPTLLQLDARMAQSVPFRVVCLTDGDADGLGEVRRRELHKALRLLVLERDVEIQMGGFK 120

Query: 121 DGMKEDWDLAEVRTRLGELVTDAKPLVLTFDERGVSGHRNHIGCALAAARLGHKTLFLRS 180
           DGM E+W +  VR  L ++VTD +PLVLTFDERGVSGHRNHI CA AAA+LGH TL L S
Sbjct: 121 DGMDEEWKMEVVREELAQVVTDRRPLVLTFDERGVSGHRNHIACAHAAAKLGHHTLHLDS 180

Query: 181 ERNLLRKYSFFVLDXXXXXXXXXXXXXXXXXLAQYLHALVAMVVAHRSQMVWFRWGWWMA 240
             NL+RKYSFF +D                  +QYLH+LV M+VAH+SQMVWFRWGWW A
Sbjct: 181 GHNLIRKYSFFFVDLFRLLFGYPMPTVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTA 240

Query: 241 SRYVYANEY 249
           SRYVYANE+
Sbjct: 241 SRYVYANEF 249

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  199 bits (507), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 111/229 (48%), Positives = 136/229 (59%), Gaps = 7/229 (3%)

Query: 25  RLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPTLLQLDARLPAWMPFRVVCLT 84
           ++ER N +    L  G S  TS+ LVIAHPDDEVMFFAPTLLQ+D  LP  +   V+ LT
Sbjct: 24  QIERSNRRALGSLFRG-SAPTSINLVIAHPDDEVMFFAPTLLQIDEWLPGSIEVNVISLT 82

Query: 85  DGGAEGLGQLRRAELQKALRLLVLEHDVTLEVADFTDGMKEDWDLAEVRTRLGELVTDAK 144
           DGGA+GLG LR  ELQ  +RLL+ +   ++EV DF DGM  +WDL      L E + D  
Sbjct: 83  DGGADGLGDLRTKELQDCVRLLLRKRKASVEVLDFLDGMDVEWDLERAVKALQERILDES 142

Query: 145 PLVLTFDERGVSGHRNHIGCALAAARL----GHKTLF-LRSERNLLRKYSFFVLDXXXXX 199
           PL LTFDE G+SGH NHI C  A  ++       + F L S+R L  KYS F+       
Sbjct: 143 PLFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCFKLVSKRYLFEKYSGFI-PALFHS 201

Query: 200 XXXXXXXXXXXXLAQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYANE 248
                         QYL AL +M+ AH SQMVWFR+GWW+ S YVYANE
Sbjct: 202 FISSSPSTLINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANE 250

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  199 bits (507), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 104/234 (44%), Positives = 138/234 (58%), Gaps = 11/234 (4%)

Query: 24  RRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPTLLQLDARLPAWMPFRVVCL 83
           +R+  HN QVF R V      TS+ L++AHPDDE MFF+PTLLQL    P  +P RV+CL
Sbjct: 26  QRIAAHNRQVF-RNVFPSRTPTSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLRVICL 84

Query: 84  TDGGAEGLGQLRRAELQKALRLLVLEHDVTLEVADFTDGMKEDWDLAEVRTRLGELVTDA 143
           T+G A+GLG +R  EL+ +++LL+   + ++ V  F DGM  +WD  +V   +   V+DA
Sbjct: 85  TNGDADGLGAVREQELRLSMQLLLPARNTSVIVEGFEDGMGVEWDTRQVVATINRHVSDA 144

Query: 144 KPLVLTFDERGVSGHRNHIGCALAAARLGHK---------TLFLRSERNLLRKYSFFVLD 194
            PL+LTFDE GVSGH NH+ C  A + L  +          L+L S+R    KY  F +D
Sbjct: 145 SPLLLTFDEHGVSGHVNHVSCNTAVSALVEQREQREQRFTALYLNSKRYFPPKYGSFAVD 204

Query: 195 XXXXXXXXXXXXXXXXXLAQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYANE 248
                              QYL +L AM  AH SQMVWFRWGWW+ASR+V+ NE
Sbjct: 205 -LARIITGRQPPVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNE 257

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  186 bits (471), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 133/233 (57%), Gaps = 8/233 (3%)

Query: 24  RRLERHNTQVFERLVGGD--SQHTSLTLVIAHPDDEVMFFAPTLLQLDARLPAWMPFRVV 81
           + ++ HN   F  LV     S+ TS+TLV+AHPDDEVMFF+PTL Q +  LP  +P  VV
Sbjct: 26  KTIKEHNRWYFHELVSESMVSKLTSVTLVVAHPDDEVMFFSPTLTQFNELLPISIPINVV 85

Query: 82  CLTDGGAEGLGQLRRAELQKALRLLVLEHDVTLEVADFTDGMKEDWDLAEVRTRLGELVT 141
           C+T G A+GLG +R+ EL  +LR++        +V DF DGM   WD   +  +L   + 
Sbjct: 86  CMTAGDADGLGHIRKQELVDSLRIMFHGRQFGCDVLDFEDGMDAVWDQVLLEKQLRSSIP 145

Query: 142 DAKPLVLTFDERGVSGHRNHIGCALAAARLGHK-TLFLRSERNLLRKYSFFV-----LDX 195
           D+ PLVLTFD+ GVSGH NHI C     +L +   L LRS++ +  KYS F+     L  
Sbjct: 146 DSNPLVLTFDQFGVSGHINHISCGRLVEKLPYSHKLHLRSDQPIYVKYSAFIAGIFQLGI 205

Query: 196 XXXXXXXXXXXXXXXXLAQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYANE 248
                           L QYL A  AM +AH SQMVWFR GWW+ SR+ + NE
Sbjct: 206 STVYPDYGKPRCFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFINE 258

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  185 bits (470), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 105/232 (45%), Positives = 132/232 (56%), Gaps = 7/232 (3%)

Query: 22  SRRRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPTLLQLDARLPAWMPFRVV 81
           S  R++  N Q F  L    +  TS+ LVIAHPDDEVMFFAPTLLQLD      +P  V 
Sbjct: 21  SSARIKASNEQAFTTLFSVLNP-TSINLVIAHPDDEVMFFAPTLLQLDHYFDTDIPVSVF 79

Query: 82  CLTDGGAEGLGQLRRAELQKALRLLVLEHDVTLEVADFTDGMKEDWDLAEVRTRLGELVT 141
            LTDGGA+GLG+LR  EL+ ++ LL       + V +F DGMK +WDL +    L + V 
Sbjct: 80  SLTDGGADGLGKLREEELRDSVHLLFRRRKAEVTVLNFEDGMKVEWDLQKTSEALRKQVV 139

Query: 142 DAKPLVLTFDERGVSGHRNHIGC-----ALAAARLGHKTLFLRSERNLLRKYSFFVLDXX 196
             +PL LTFD+ GVS H NHI C      L AA    ++  L S+R++ +KY+ FV    
Sbjct: 140 GDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSLTSKRSIFQKYTAFV-PSL 198

Query: 197 XXXXXXXXXXXXXXXLAQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYANE 248
                            QYL AL  M+ AH SQMVWFR+GWW  S YV+ANE
Sbjct: 199 ITVLRGSRQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANE 250

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  174 bits (442), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 101/278 (36%), Positives = 147/278 (52%), Gaps = 51/278 (18%)

Query: 22  SRRRLERHNTQVFE-----RLVGGDSQH-------TSLTLVIAHPDDEVMFFAPTLLQLD 69
           S +++  +N + F+     +++  D  H       T L+LVIAHPDDE+MFFAPTLLQL+
Sbjct: 26  STQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQLSLVIAHPDDELMFFAPTLLQLN 85

Query: 70  ARLPAWMPFRVVCLTDGGAEGLGQLRRAELQKALRLLVLEHD---VTLEVADFTDGMKED 126
             LP  +PF ++C +DG AEGLG LRR EL  ++ LL+   +   + + + DF DGM + 
Sbjct: 86  RFLPTSIPFNIICFSDGDAEGLGYLRRKELHDSINLLLSSSNNRKINISILDFIDGMDQV 145

Query: 127 WDLAEVRTRL-GELVTDAKP-----LVLTFDERGVSGHRNHIGCALAAARL----GHKT- 175
           WD  ++ + L  EL+ +  P     ++LTFD  G+S H NHI C  A   L    G K  
Sbjct: 146 WDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHPNHIACNKAVHDLISYDGGKDK 205

Query: 176 ------LFLRSER-------NLLRKYSFFVLDX------------XXXXXXXXXXXXXXX 210
                 L L S+        NLL KY+FFV+D                            
Sbjct: 206 EMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVYWNLATGTFNTIPNSASLELSFIN 265

Query: 211 XLAQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYANE 248
             +QY+ +  +M+  H+SQMVWFR+GWW  SR+V++N+
Sbjct: 266 TYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSND 303

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  164 bits (414), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 94/216 (43%), Positives = 121/216 (56%), Gaps = 13/216 (6%)

Query: 46  SLTLVIAHPDDEVMFFAPTLLQLDARLPAWMPFRVVCLTDGGAEGLGQLRRAELQKALRL 105
           SLTL+IAHPDDEVMFF+P+LLQLD  LP  + F  VCL+ G A+ LG+ R  ELQ++L L
Sbjct: 48  SLTLLIAHPDDEVMFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNL 107

Query: 106 LV--LEHDVTLEVADFTDGMKEDWDLAEVRTRLGE--LVTDAKPLVLTFDERGVSGHRNH 161
           L    +    L   D+ DG  E W++  V + +     +     L+LTFD  GVS H NH
Sbjct: 108 LTSNSQRKTQLYQFDYPDGFDEKWEIESVVSIVESKVFIGSGFNLLLTFDAHGVSNHPNH 167

Query: 162 IGCALAAARL---GHKTLFLRS-ERNLLRKYSFFVLDXXXXXXXXXXX-----XXXXXXL 212
           + C  A ARL   GHK L+L S  RNL  KYS F+ +                       
Sbjct: 168 VACHNAVARLIEKGHKALYLNSHSRNLPLKYSGFIWELIRMLSDSVMKLERTGLTFMNSF 227

Query: 213 AQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYANE 248
            QY+ A  AM  AH SQ+VWFR+GWW  SR+V+ N+
Sbjct: 228 PQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVND 263

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  164 bits (415), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 94/246 (38%), Positives = 134/246 (54%), Gaps = 22/246 (8%)

Query: 22  SRRRLERHNTQVFERLVGGD-SQHTSLTLVIAHPDDEVMFFAPTLLQLDARLPAWMPFRV 80
           S  R+E+ NT  + +L      + T+L LVIAHPDDEVMFFAPTLLQLD  +P  +P  V
Sbjct: 29  SSNRIEQFNTLNYSQLNTKIFHEGTTLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINV 88

Query: 81  VCLTDGGAEGLGQLRRAELQKALRLLVL-EHDVTLEVADFTDGMKEDWDLAEVRTRLGEL 139
           +C ++G A+GLG+ R+ ELQ ++  L+  +    + V  F DG  + WD+ ++   L + 
Sbjct: 89  ICFSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQ- 147

Query: 140 VTDAKPLVLTFDERGVSGHRNHIGCALAAARLGHKT-----LFLRS-ERNLLRKYSFFVL 193
             +     LTFD  GVSGH+NHI C  A   L +       L L S   +LL KY+FF++
Sbjct: 148 --NDHQAFLTFDSHGVSGHKNHIACHNAVWNLKNTNNNVTILTLDSIHHSLLAKYTFFII 205

Query: 194 -----------DXXXXXXXXXXXXXXXXXLAQYLHALVAMVVAHRSQMVWFRWGWWMASR 242
                      D                  +QY+ A   M+ AH+SQ+VWFR+GWW  SR
Sbjct: 206 DLVKLYWNLWKDQQQPQWESHDKITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSR 265

Query: 243 YVYANE 248
           +V++N 
Sbjct: 266 FVFSNH 271

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  160 bits (405), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 90/245 (36%), Positives = 130/245 (53%), Gaps = 21/245 (8%)

Query: 25  RLERHNTQVFE----RLVGGDSQHTSLTLVIAHPDDEVMFFAPTLLQLDARLPAWMPFRV 80
           +++  N Q+       L+   S   SLTLV+AHPDDEVMFF+PTLLQLD+ LP    F +
Sbjct: 28  KIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDEVMFFSPTLLQLDSHLPPNCKFNI 87

Query: 81  VCLTDGGAEGLGQLRRAELQKALRLLVLEHDVTLEVADFTDGMKEDWDLAEVRTRLGELV 140
           +  +DG AEGLG LR  EL  ++ +L+   +  + + + TDGM E WD   +  +L  ++
Sbjct: 88  ISYSDGDAEGLGSLRSNELAHSIDMLIPRRNKEIFIFNHTDGMNEVWDNKLMLHQLESIL 147

Query: 141 TDAKP-LVLTFDERGVSGHRNHIGC-------ALAAARLGHKTLFLRSERNLLRKYSFFV 192
           +D++  ++LTFD+ GVS H NH  C         + A+     L      NLL+KY+ F 
Sbjct: 148 SDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQSHAKNNFALLLDSYSSNLLKKYTGFA 207

Query: 193 LDXXXXXXXXXXXXXXXXXL---------AQYLHALVAMVVAHRSQMVWFRWGWWMASRY 243
                              L         + Y+ A   M+ AH+SQMVWFR+GWW  SR+
Sbjct: 208 WQLVFLAKNYWIHGKTLPNLDHLALFNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRF 267

Query: 244 VYANE 248
           VY N+
Sbjct: 268 VYVND 272

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  161 bits (407), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 91/266 (34%), Positives = 137/266 (51%), Gaps = 41/266 (15%)

Query: 25  RLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPTLLQLDARLPAWMPFRVVCLT 84
           ++   NT   + +     +++ + LVIAHPDDEVMFF+P + QL A  P  +PF ++CL+
Sbjct: 33  KILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVMFFSPVISQLHAYFPDTVPFNILCLS 92

Query: 85  DGGAEGLGQLRRAELQ-KALRLLVLEHDVTLEVADFTDGMKEDWDLAEVRTRLGELV--- 140
            G AEGLG+ R  EL   A+ LL  E  V+++V DF DGM E WD+  + + L + +   
Sbjct: 93  KGDAEGLGETRAKELNDSAVLLLRNERPVSVQVMDFEDGMDEVWDIDSITSTLSQTIDVN 152

Query: 141 -TDAKPLVLTFDERGVSGHRNHIGCALAAAR-----LGHKT-----------LFLRS-ER 182
                 +++TFD  GVS H NH  C +A  +     +G KT           L+LRS + 
Sbjct: 153 NEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFIDDYVGSKTKEKAENAHITALYLRSYKN 212

Query: 183 NLLRKYSFFVLD-------------------XXXXXXXXXXXXXXXXXLAQYLHALVAMV 223
           N+  KY+ F+ +                                     +QY+ A  AM+
Sbjct: 213 NIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAAPSTTTEKNGLLLMNTHSQYILAFAAML 272

Query: 224 VAHRSQMVWFRWGWWMASRYVYANEY 249
            AH+SQ+VWFR+GWW+ SR+V+ NE+
Sbjct: 273 NAHKSQVVWFRYGWWILSRFVFVNEF 298

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  160 bits (405), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 91/258 (35%), Positives = 140/258 (54%), Gaps = 36/258 (13%)

Query: 22  SRRRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPTLLQLDARL--PAWMPFR 79
           S  ++   N    E L  G+    S+ LVIAHPDDEVMFFAP+L+ L+ ++  P+ + F 
Sbjct: 28  STSKIGSFNYTNLETL--GEHDINSVNLVIAHPDDEVMFFAPSLINLNEQIRDPSTV-FN 84

Query: 80  VVCLTDGGAEGLGQLRRAELQKALRLLVLEHDVTLEVADFTDGMKEDWDLAEVRTRLGEL 139
           ++C ++GGA+GLG +R  EL  ++ +L+   + ++ V DF DGMKE WD+ E+  +L  +
Sbjct: 85  IICFSNGGADGLGNVREQELSDSIAMLLPTRNTSIVVLDFKDGMKEKWDVKEMIAKLRNI 144

Query: 140 VTD-AKPLVLTFDERGVSGHRNHIGCALAAARLGHKTLFLRSE-----------RNLLRK 187
           V      ++LTFD +GVSGH NHI C  AA  LG+   F   +           +N+++K
Sbjct: 145 VPKLGHNVLLTFDGKGVSGHLNHIACYRAA--LGYYNEFKSKQKLTVLSLQSYSKNIVKK 202

Query: 188 YSFFVLDXXXXXXXXXXXXXXXXXL-----------------AQYLHALVAMVVAHRSQM 230
           YS ++ +                 L                  QY+ +L AM+ AH++Q+
Sbjct: 203 YSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARKITIFSTYPQYVLSLAAMLNAHKTQV 262

Query: 231 VWFRWGWWMASRYVYANE 248
           VWFR+GWW  SR V+ N+
Sbjct: 263 VWFRYGWWFFSRLVFVND 280

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  160 bits (404), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 90/265 (33%), Positives = 135/265 (50%), Gaps = 40/265 (15%)

Query: 25  RLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPTLLQLDARLPAWMPFRVVCLT 84
           ++   N +  + +         + L+IAHPDDEVMFF+P + QL +  P  +PF ++CL+
Sbjct: 35  KIISRNNESLQHVFPNKYSDYQINLIIAHPDDEVMFFSPMISQLHSYFPNTVPFNIICLS 94

Query: 85  DGGAEGLGQLRRAELQKALRLLV-LEHDVTLEVADFTDGMKEDWDLAEVRTRLGELV--- 140
            G AEGLGQ R  EL  +  LL+  E  V+++V DF DGM E WD+  + + L + +   
Sbjct: 95  KGNAEGLGQTRVRELNDSAALLLHNERAVSVQVMDFQDGMNEVWDIDSITSTLSQTIGIN 154

Query: 141 -TDAKPLVLTFDERGVSGHRNHIGCALAAARLGH-----------KT-----LFLRS-ER 182
             +   +++TFD  GVSGH NH  C  A  +L             KT     L+LRS + 
Sbjct: 155 NNELNQIIVTFDSYGVSGHINHKSCHTAVRKLIADYTRSNVRKEVKTPLITALYLRSYKN 214

Query: 183 NLLRKYSFFVLDXX------------------XXXXXXXXXXXXXXXLAQYLHALVAMVV 224
           N++ KY+ F+ +                                    AQY+ A  AM+ 
Sbjct: 215 NIVLKYNSFIWEILRMLYGLISPFRKTTQALPSDVVAEKNSLLLMNTHAQYILAFAAMLN 274

Query: 225 AHRSQMVWFRWGWWMASRYVYANEY 249
           AH+SQ+VWFR+GWW+ SR+V+ NE+
Sbjct: 275 AHKSQVVWFRYGWWILSRFVFVNEF 299

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  157 bits (396), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 88/263 (33%), Positives = 136/263 (51%), Gaps = 38/263 (14%)

Query: 25  RLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPTLLQLDARLPAWMPFRVVCLT 84
           ++   N ++ + +    ++ + + LVIAHPDDEVMFF+P + QL +  P  +PF ++CL+
Sbjct: 33  KIISRNDELLQHVFPHKNRDSQINLVIAHPDDEVMFFSPVISQLHSYFPITVPFNIICLS 92

Query: 85  DGGAEGLGQLRRAELQ-KALRLLVLEHDVTLEVADFTDGMKEDWDLAEVRTRLGELV--- 140
            G A+GLG+ R  EL   A  LL  E  V+++V DF DGM E WD+  + + + + +   
Sbjct: 93  KGNADGLGESRVKELNGSAALLLQNERPVSVQVMDFEDGMDEVWDINSIVSTISQTIDLS 152

Query: 141 -TDAKPLVLTFDERGVSGHRNHIGCALAAARL---------------GHKT-LFLRS-ER 182
                 +++TFD  GVS H NH  C  A  RL                H T L+L+S + 
Sbjct: 153 NEQLNQIIVTFDSYGVSDHINHKSCHTAVKRLIDRYAESKAETNEETPHITALYLKSYKN 212

Query: 183 NLLRKYSFFVLDXXXXXXXXXXXXXXXXXL----------------AQYLHALVAMVVAH 226
           N++ KY+ F+ +                                  AQY+ A  AM+ AH
Sbjct: 213 NIVLKYNSFIWEILKILYSVIVPFPKTIQPPTTTTQRSKLLLMNTHAQYVLAYAAMLNAH 272

Query: 227 RSQMVWFRWGWWMASRYVYANEY 249
           +SQ+VWFR+GWW+ SR+V+ NE+
Sbjct: 273 KSQVVWFRYGWWILSRFVFVNEF 295

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  156 bits (394), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 90/251 (35%), Positives = 136/251 (54%), Gaps = 27/251 (10%)

Query: 25  RLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPTLLQLDARLPAWMPFRVVCLT 84
           R++  N  VF   +    +  SL+LV+AHPDDEVMFFAPT+L+LD+RLP  + F VVCL+
Sbjct: 24  RIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPTILELDSRLPPNVEFNVVCLS 83

Query: 85  DGGAEGLGQLRRAELQKALRLLVL--EHDVTLEVADFTDGMKEDWDLAEVRTRLGELVTD 142
            GGA+ LG  R  EL++++ LL+   +    L+  D+ DG +E WD   V++ + + V  
Sbjct: 84  KGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDGHEETWDQESVQSTIKDSVLQ 143

Query: 143 AK--PLVLTFDERGVSGHRNHIGCALAAARLGHK------TLFLRSE-RNLLRKYSFFVL 193
            +   ++LTFD++GVS H NHI C  A + L          L+L S   N++ KYS F  
Sbjct: 144 GRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVKAALYLDSYGDNIVLKYSAFFW 203

Query: 194 D----------------XXXXXXXXXXXXXXXXXLAQYLHALVAMVVAHRSQMVWFRWGW 237
           +                                  + Y+ +  +M+ +H+SQMVWFR+GW
Sbjct: 204 EIWKLTRDWFLHRVLPTSSYNENKPATEITLMSDYSSYILSFASMLHSHKSQMVWFRYGW 263

Query: 238 WMASRYVYANE 248
           W  SR+V+ N+
Sbjct: 264 WTFSRFVFVND 274

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  155 bits (392), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 87/243 (35%), Positives = 128/243 (52%), Gaps = 40/243 (16%)

Query: 47  LTLVIAHPDDEVMFFAPTLLQLDARLPAWMPFRVVCLTDGGAEGLGQLRRAELQKALRLL 106
           + LVIAHPDDEVMFF+P + QL++  P  +PF ++CL+ G AEGLG+ R  EL ++  LL
Sbjct: 57  INLVIAHPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALL 116

Query: 107 V-LEHDVTLEVADFTDGMKEDWDLAEVRTRLGELVT----DAKPLVLTFDERGVSGHRNH 161
           +  E  V+++V DF DGM E WD+  + + L + +     +   +++TFD  GVS H NH
Sbjct: 117 LHNERAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINH 176

Query: 162 IGCALAAARL---------------GHKT-LFLRS-ERNLLRKYSFFVLDXXX------- 197
             C  A  +L                H T L+LRS + N++ KY+ F+ +          
Sbjct: 177 KSCYAAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLIS 236

Query: 198 -----------XXXXXXXXXXXXXXLAQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYA 246
                                     AQY+ A   M+ AH SQ+VWFR+GWW+ SR+V+ 
Sbjct: 237 PFRRIIQALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFV 296

Query: 247 NEY 249
           NE+
Sbjct: 297 NEF 299

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  142 bits (357), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 93/246 (37%), Positives = 127/246 (51%), Gaps = 34/246 (13%)

Query: 36  RLVGGDSQHTSLTLVIAHPDDEVMFFAPTLLQLDARLPAWMPFRVVCLTDG-GAEG--LG 92
           R  G  S  +S+ LVIAHPDDEVMFF+PTL+QLD  LP  +   V+C + G   +G   G
Sbjct: 37  RGPGYFSGSSSVNLVIAHPDDEVMFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAG 96

Query: 93  QLRRAELQKALRLLVLEHD--VTLEVADFTDGMKEDWDLAEVRTRLGELVTDA-----KP 145
           + R  EL+K++ +L+ EHD  VT+   D+ DG  + WDL  +   L  L+  +     K 
Sbjct: 97  ESRARELKKSVSMLI-EHDRPVTVHQLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKD 155

Query: 146 LVLTFDERGVSGHRNHIGCALAAARL-GHKTLFLRSE-----RNLLRKYSFFVLDXXXXX 199
           L++TFDE GVS H NHI C  A  RL   + LF+  +      N++ KYSFF  +     
Sbjct: 156 LLITFDEHGVSDHPNHIACHNAVHRLIEEEPLFMAYQLESHSTNVILKYSFFAREIVKYF 215

Query: 200 XXX-----------------XXXXXXXXXLAQYLHALVAMVVAHRSQMVWFRWGWWMASR 242
                                         ++Y+ A   M+ AH SQ+VWFR+GWW  SR
Sbjct: 216 YNYCHQRIKGQTSLNKNMDVPYEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSR 275

Query: 243 YVYANE 248
             YANE
Sbjct: 276 LTYANE 281

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  140 bits (354), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 134/276 (48%), Gaps = 48/276 (17%)

Query: 21  WSRRRLERHNTQVFERLVGGD-SQHT--SLTLVIAHPDDEVMFFAPTLLQLDARLPAWMP 77
           W    +E  N + F   V  + SQ +  S+ L+IAHPDDEVMFF PTLLQLD  LP  +P
Sbjct: 20  WLTPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEVMFFTPTLLQLDDILPTHVP 79

Query: 78  FRVVCLTDG---GAEGLGQLRRAELQKALRLLV------LEHDVTLEVADFTDGMKEDWD 128
           F V+CL+ G       +G LR  E+  +L +L+      L  +V L   ++ DGM + WD
Sbjct: 80  FNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLNREVKLHQFEYEDGMDKQWD 139

Query: 129 LAEVRTRLGELVT------DAKPLVLTFDERGVSGHRNHIGCALAAARLGHKT------- 175
           +++V T +   ++        K  +LTFD +GVS H NHI C  A   L  K+       
Sbjct: 140 ISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIACYDAMMTLKQKSSNPGDYL 199

Query: 176 -LFLRSE-RNLLRKYSFFVLDXXXXXXXXXXXXXXXXXLAQ------------------- 214
            + L S   N++ KYS F+                   L Q                   
Sbjct: 200 LMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELKQVPFLSMHKEHDQIQFINTF 259

Query: 215 --YLHALVAMVVAHRSQMVWFRWGWWMASRYVYANE 248
             Y+ AL +M+ +H SQMVWFR+GWW  SR+V+ N+
Sbjct: 260 PHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVND 295

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  139 bits (349), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 88/262 (33%), Positives = 125/262 (47%), Gaps = 43/262 (16%)

Query: 25  RLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPTLLQLDARLPAWMPFRVVCLT 84
           ++E  N +   +L+        L LVIAHPDDE+MFF+PT+LQL   +       VVCL+
Sbjct: 42  KVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQL---IDHVQELNVVCLS 98

Query: 85  DGGAEGLGQLRRAELQKALRLLVLE---HDVTLEVADFTDGMKEDWDLAEVRTRLGELVT 141
           +G A+GLG+LR  EL+ A+  L +     +V+L + D+TDG  E W  + V T L + + 
Sbjct: 99  NGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVW--SGVATDLKKYIL 156

Query: 142 DAKP------LVLTFDERGVSGHRNHIGCALAAARL-----GHKTLFLR----SERNLLR 186
            ++P      ++LTFD  G+SGHRNHI C             +  +FL     S   ++ 
Sbjct: 157 TSEPGVKQKDIILTFDREGISGHRNHIACNEGVISYLKTIKSNSFVFLELKSLSTWQIIS 216

Query: 187 KYSFFVLDXXXXXXXXXXXXXXX--------------------XXLAQYLHALVAMVVAH 226
           KYS  V                                         QY  +  AM  AH
Sbjct: 217 KYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFISTFDQYALSFAAMCYAH 276

Query: 227 RSQMVWFRWGWWMASRYVYANE 248
           +SQMVWFR+ WW  SRYV+ N+
Sbjct: 277 KSQMVWFRYLWWSFSRYVFVND 298

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  130 bits (327), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 87/269 (32%), Positives = 124/269 (46%), Gaps = 61/269 (22%)

Query: 40  GDSQH---TSLTLVIAHPDDEVMFFAPTLLQLDARLPAWMPFRVVCLTDGGAEGLGQL-- 94
            + QH    SL+L+IAHPDDE+MFF+PTLLQL+  L   + F VVCL+  G +  G    
Sbjct: 47  SNKQHVKINSLSLIIAHPDDEIMFFSPTLLQLNNYLEKDIMFNVVCLSQ-GLDSTGSFKD 105

Query: 95  --RRAELQKALRLLV-----LEHDVTLEVA--DFTDGMKEDWDLAEVRTRLGE---LVTD 142
             R  EL  +L LL       EH+   ++   D+TDGMKE W++  +   L +      +
Sbjct: 106 PQRVHELNDSLNLLFNRGSNNEHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDN 165

Query: 143 AKPLVLTFDERGVSGHRNHIGCALAAARLGHKT--------LFLRS-ERNLLRKYSFFV- 192
              L+LTFD+ GVS H+NH+ C  A  +L   +        +FL S  +N   KYSFFV 
Sbjct: 166 GINLLLTFDKSGVSNHKNHLACNEAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVS 225

Query: 193 ---------------------------------LDXXXXXXXXXXXXXXXXXLAQYLHAL 219
                                            +                   A+Y+ + 
Sbjct: 226 KLFTIIKLKFFRSISLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSY 285

Query: 220 VAMVVAHRSQMVWFRWGWWMASRYVYANE 248
             M+ AH SQMVWFR+ WW+ SR+ + N+
Sbjct: 286 STMLNAHESQMVWFRYLWWIFSRFAFIND 314

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.139    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,563,374
Number of extensions: 694000
Number of successful extensions: 1916
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1907
Number of HSP's successfully gapped: 31
Length of query: 249
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 142
Effective length of database: 41,212,137
Effective search space: 5852123454
Effective search space used: 5852123454
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 64 (29.3 bits)