Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ABL119C8.847ON53751025050.0
Ecym_46188.847ON5273924448e-48
KLLA0D01408g8.847ON5184002818e-26
SAKL0D01298g8.847ON5513982623e-23
TDEL0B005108.847ON5503872241e-18
ZYRO0G14322g8.847ON5503922232e-18
Kwal_27.102248.847ON5463752081e-16
KLTH0C03718g8.847ON5513852062e-16
Kpol_1068.38.847ON5664091732e-12
KNAG0J002308.847ON4744151553e-10
TBLA0B033108.847ON6133601431e-08
TPHA0I002908.847ON5694381322e-07
YMR282C (AEP2)8.847ON5803421279e-07
Skud_13.4548.847ON5803421215e-06
Suva_13.4718.847ON5813401181e-05
CAGL0M03069g8.847ON5483371082e-04
Smik_13.4958.847ON5763401054e-04
NCAS0C003708.847ON4953901036e-04
KAFR0B039708.847ON4743291010.001
NCAS0B021808.547ON610111770.80
Smik_2.127.442ON100992715.5
Skud_2.37.442ON101092715.6
NOTE: 1 genes in the same pillar as ABL119C were not hit in these BLAST results
LIST: NDAI0K00340

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL119C
         (537 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...   969   0.0  
Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...   175   8e-48
KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...   112   8e-26
SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...   105   3e-23
TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...    91   1e-18
ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...    91   2e-18
Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...    85   1e-16
KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...    84   2e-16
Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...    71   2e-12
KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...    64   3e-10
TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...    60   1e-08
TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...    55   2e-07
YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...    54   9e-07
Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...    51   5e-06
Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...    50   1e-05
CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...    46   2e-04
Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...    45   4e-04
NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...    44   6e-04
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...    44   0.001
NCAS0B02180 Chr2 complement(355823..357655) [1833 bp, 610 aa] {O...    34   0.80 
Smik_2.12 Chr2 complement(10644..13673) [3030 bp, 1009 aa] {ON} ...    32   5.5  
Skud_2.3 Chr2 complement(1409..4441) [3033 bp, 1010 aa] {ON} YBL...    32   5.6  

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score =  969 bits (2505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/510 (93%), Positives = 478/510 (93%)

Query: 1   MMVDFSPSRRRMGTQELSLKPQVETPGIKLLAVMFCRYHLIRQLKQVQAASRTRYAHSVP 60
           MMVDFSPSRRRMGTQELSLKPQVETPGIKLLAVMFCRYHLIRQLKQVQAASRTRYAHSVP
Sbjct: 1   MMVDFSPSRRRMGTQELSLKPQVETPGIKLLAVMFCRYHLIRQLKQVQAASRTRYAHSVP 60

Query: 61  QSRPTLKERLAALHEKQQLSLLPPDAVKRVSENNPAVLIDCDARXXXXXXXXXXXXDPQK 120
           QSRPTLKERLAALHEKQQLSLLPPDAVKRVSENNPAVLIDCDAR            DPQK
Sbjct: 61  QSRPTLKERLAALHEKQQLSLLPPDAVKRVSENNPAVLIDCDARTLLQLFLAALQTDPQK 120

Query: 121 TTLSELLSQEEGFSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIG 180
           TTLSELLSQEEGFSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIG
Sbjct: 121 TTLSELLSQEEGFSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIG 180

Query: 181 RPSPGRLHDANSFARWFMAESKLRLARTVFAELVGNPTELAKLPRDTETIITLLQLHLGA 240
           RPSPGRLHDANSFARWFMAESKLRLARTVFAELVGNPTELAKLPRDTETIITLLQLHLGA
Sbjct: 181 RPSPGRLHDANSFARWFMAESKLRLARTVFAELVGNPTELAKLPRDTETIITLLQLHLGA 240

Query: 241 KHIFWRDPGNSVGRGGQLFTPAHMAVVTAYNSLGEETXXXXXXXXQSDPQWKSVCSPDLD 300
           KHIFWRDPGNSVGRGGQLFTPAHMAVVTAYNSLGEET        QSDPQWKSVCSPDLD
Sbjct: 241 KHIFWRDPGNSVGRGGQLFTPAHMAVVTAYNSLGEETLLRLLRLLQSDPQWKSVCSPDLD 300

Query: 301 RNIILALAFHNRLDLVHXXXXXXXXXXXXGHGLPSTPLLPDGALVGAVVTAFAFKHQLAQ 360
           RNIILALAFHNRLDLVH            GHGLPSTPLLPDGALVGAVVTAFAFKHQLAQ
Sbjct: 301 RNIILALAFHNRLDLVHAQAARYYAPAAPGHGLPSTPLLPDGALVGAVVTAFAFKHQLAQ 360

Query: 361 GLAIAYQFLDRFTHLPNEHELWKIIFTWLARRHPTGSQGAALYDEAWSKMRTRYAEHGQP 420
           GLAIAYQFLDRFTHLPNEHELWKIIFTWLARRHPTGSQGAALYDEAWSKMRTRYAEHGQP
Sbjct: 361 GLAIAYQFLDRFTHLPNEHELWKIIFTWLARRHPTGSQGAALYDEAWSKMRTRYAEHGQP 420

Query: 421 TPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAVAPRDRLLLLKCQAHIVGRL 480
           TPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAVAPRDRLLLLKCQAHIVGRL
Sbjct: 421 TPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAVAPRDRLLLLKCQAHIVGRL 480

Query: 481 VRARRNSAAADFVDQWALDSEARSHLLEHI 510
           VRARRNSAAADFVDQWALDSEARSHLLEHI
Sbjct: 481 VRARRNSAAADFVDQWALDSEARSHLLEHI 510

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score =  175 bits (444), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 110/392 (28%), Positives = 181/392 (46%), Gaps = 18/392 (4%)

Query: 127 LSQEEGFSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIGRPSPGR 186
           +S EE FS+F +RLLPT   S  LK  + ++  + L  KLY FY          R +P  
Sbjct: 97  MSSEE-FSIFFNRLLPTSGSSFSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPME 155

Query: 187 LHDANSFARWFMAESKLRLARTVFAELVGNPTELAKLPRDTETIITLLQLHLGAKHIFWR 246
           LHD N F+ WF+ E+KL+LAR V  +++   T   +LPRD +T++T  QL+LG+    W 
Sbjct: 156 LHDLNKFSNWFLNENKLKLARKVLQQIL-RQTGSEQLPRDHQTLVTYFQLYLGSLASLWP 214

Query: 247 DPGNSVGRGGQLFTPAHMAVVTAYNSLGEETXXXXXXXXQSDPQWKSVCSPDLDRNIILA 306
            P        +L   +       YNSL E            +  WK + S +LD  I+ +
Sbjct: 215 TPKVQSACYDKLVRGSRRPKYVVYNSLPEGIMYDVLQKLLENDDWKHLRSSELDAKILYS 274

Query: 307 LAFHNRLDLVHXXXXXXXXXXXXGHGLP-------STPLLPDGALVGAVVTAFAFKHQLA 359
           L  +NR+DL                 +        S+   P   ++ A+VT+F++++ L 
Sbjct: 275 LCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSEVLIAIVTSFSYRNDLE 334

Query: 360 QGLAIAYQFLDRFTHLPNEHELWKIIFTWL-----ARRHPTGSQGAALYDEAWSKMRTRY 414
           + + +   FL+++  +    E W+ +F W       +  P GS   A     W +M + Y
Sbjct: 335 KAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGSLQKA----CWLRMLSWY 390

Query: 415 AEHGQPTPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAVAPRDRLLLLKCQA 474
              G+  PY   +A   Y I+++ S+ +   A+  DYMS +Y + A A  +  ++ K Q 
Sbjct: 391 KSRGESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKSAAAKHNLTVVRKYQK 450

Query: 475 HIVGRLVRARRNSAAADFVDQWALDSEARSHL 506
            ++  L    +  A   F++QW  + E    L
Sbjct: 451 FVIRELSARGKRDACTQFIEQWRFNEENEKEL 482

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score =  112 bits (281), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 93/400 (23%), Positives = 170/400 (42%), Gaps = 42/400 (10%)

Query: 131 EGFSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIGRPSPGRLHDA 190
           E +SVF+++L+  Y  S D++ L        + + LY  YR  F    +   +   L+D 
Sbjct: 100 EDYSVFVNQLMDVY--SKDIELL----NKTEVWKSLYHIYR-VFVVNAVDDGNAMVLYDL 152

Query: 191 NSFARWFMAESKLRLARTVFAELVGNPTELAKLPRDTETIITLLQLHLGAKHIFWRDPGN 250
           N F R F+  + L LAR VF  ++ N     ++P+D +TI   L+L+ GA    W    +
Sbjct: 153 NQFVRMFINLNDLPLARNVFQLILKNSKN-GEIPKDVQTICMYLRLYCGALSELWTTQTS 211

Query: 251 -----------SVGRGGQLFTPAHMAVVTAYNSLGEETXXXXXXXXQSDPQWKSVCSPDL 299
                      S      +  P+H+A    Y ++G             DP++  + + ++
Sbjct: 212 RNFYQDLIGSLSGSNASSIRIPSHIA----YPTIGVPQFQLLLRKLVEDPEYSKLRNTEM 267

Query: 300 DRNIILALAFHNRLDLVHXXXXXXXXXXXXGHGLPSTP----LLPDGALVGAVVTAFAFK 355
           D  II AL  +  +  +                  + P    L PD  L+ +V++A+   
Sbjct: 268 DSLIIQALGHYKEVPFLKQYISIFYGIDENVTITETHPGIKKLTPDSQLLKSVISAYGHN 327

Query: 356 HQLAQGLAIAYQFLDRFTHLPNEHELWKIIFTWLAR-----RHPTGSQGAALYDEAWSKM 410
           + +  G+ +   F++++  +  +   W+    W  R     +   GSQ      +AW+ M
Sbjct: 328 NNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKDSKGSQPK----KAWNLM 383

Query: 411 RTRYAEHGQPTPYDYSIA--RASYRIVRRD--SSLRRVRALLNDYMSPLYQQPAVAPRDR 466
              YA  G+  P+D  I   R S+   R+D  +++R V+ +         +   +   +R
Sbjct: 384 LNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIFIKTEKNTFIV--ER 441

Query: 467 LLLLKCQAHIVGRLVRARRNSAAADFVDQWALDSEARSHL 506
           L+L   Q  I+  LV    N+   DF+++W +D E   +L
Sbjct: 442 LVLYAYQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYL 481

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 91/398 (22%), Positives = 169/398 (42%), Gaps = 19/398 (4%)

Query: 123 LSELLSQEEGFSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIGRP 182
            SE L  +  +SVF+++LL      S+L +L+       +L KLY  YR    D+ +G  
Sbjct: 124 FSEKLITKLEYSVFVNKLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYR----DSVVGNA 179

Query: 183 S--PGRLHDANSFARWFMAESKLRLARTVFAELVGNPTELAKLPRDTETIITLLQLHLGA 240
           +  P +L+D N F + F  +++L  A+ V   ++ N      +PRD +T+I  L+L  GA
Sbjct: 180 TLTPVQLYDLNQFIKRFTGDAQLAKAQQVLGFVLEN---YGSIPRDPQTLINYLELKCGA 236

Query: 241 KHIFWRDPGNSVGRGGQLFTPAHMA-VVTAYNSLGEETXXXXXXXXQSDPQWKSVCSPDL 299
               W  P +    G  L + + M+ +  +Y  L  E           D  W    + DL
Sbjct: 237 MPRNWSIPLSRPELGKTLGSQSFMSNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDL 296

Query: 300 DRNIILALAFHNRLDLV-----HXXXXXXXXXXXXGHGLPSTPLLPDGALVGAVVTAFAF 354
           +  +I +L +  +  L+     H               +P   L P   L+ ++V+ +A 
Sbjct: 297 EAAVIYSLGYMGQFALLERYIKHTWGVSVSSNTSTEVEVPKN-LYPTSNLLISIVSCYAM 355

Query: 355 KHQLAQGLAIAYQFLDRFTHLPNEHELWKIIFTWLAR--RHPTGSQGAALYDEAWSKMRT 412
           K  L Q L I   FL +F  +  E   W+ +F W  R     T  +G  L +  W  M+ 
Sbjct: 356 KGNLHQALQIIDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKG-ELSNGCWQVMKQ 414

Query: 413 RYAEHGQPTPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAVAPRDRLLLLKC 472
            + +  +  P D  I    Y +++R ++      + ++ ++ LY +  +   +  ++ K 
Sbjct: 415 WHNKQKRSLPIDLGILNERYYVLKRTNNFTEALRIHDEALAGLYMKRNLIDPEVDVIKKF 474

Query: 473 QAHIVGRLVRARRNSAAADFVDQWALDSEARSHLLEHI 510
           Q  I+ ++           ++ +W L+      + E+ 
Sbjct: 475 QKLILKKMAGRGYYHKPLKYISEWCLNKRNELEMREYF 512

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score = 90.9 bits (224), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 87/387 (22%), Positives = 154/387 (39%), Gaps = 15/387 (3%)

Query: 133 FSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIGRPSPGRLHDANS 192
           FS FI+RLL        L +++       ++  LY  Y            +P ++HD N 
Sbjct: 131 FSTFINRLLLEKDLDLKLSNIIPDTVHTEIIFNLYQIYCTYVIKDSQNGLTPLQVHDINR 190

Query: 193 FARWFMAESKLRLARTVFAELVGNPTELAKLPR-DTETIITLLQLHLGAKHIFWRDPGNS 251
           F + F+ E++L+ A+     L+        L   D ETI   LQL  GA   FWR   NS
Sbjct: 191 FIKRFIDEAQLKKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCGALQKFWRVDSNS 250

Query: 252 VGRGGQLFTPAHMAVVTAYNSLGEETXXXXXXXXQSDPQWKSVCSPDLDRNIILALAFHN 311
               G+     H     +YN L E+           D  W+   SP +D  I+ +L+   
Sbjct: 251 TKVLGE--DSKHFKSPKSYNLLKEQPFLEIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLG 308

Query: 312 RLDLVHXXXXXXXXXXXXGHGLPSTPLLPDGALVGAVVTAFAFKH-QLAQGLAIAYQFLD 370
           +  L+             GH       +P   ++  +V+A+  K+    +GL I  QF+ 
Sbjct: 309 QTKLIDQYIQLKWGISEDGHVAVKNEAVPGHEVLINIVSAYCLKNGDTGKGLRILDQFMK 368

Query: 371 RFTHLPNEHELWKIIF-----TWLARRHPTGSQGAALYDEAWSKMRTRYAEHGQPTPYDY 425
           ++     E   W+ +       W  ++     + A +    W+ M+  + + G    YD 
Sbjct: 369 KYPQTELEKLFWRRLLQLSFHNWDKQK----DKKALVCHGCWNIMKQWHEQKGVSITYDS 424

Query: 426 SIARASYRIVRRDSSLRRVRALLNDYMSPLY-QQPAVAPRDRL-LLLKCQAHIVGRLVRA 483
              R  Y++ +   + R    ++    S +Y +QP    +D + LLL  Q   +  +   
Sbjct: 425 GTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMDLLLMFQKLALKTMALK 484

Query: 484 RRNSAAADFVDQWALDSEARSHLLEHI 510
            R +     + +W +D   + +LL++ 
Sbjct: 485 GRYNEPLQLIKEWNVDKINQHYLLDYF 511

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score = 90.5 bits (223), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 96/392 (24%), Positives = 159/392 (40%), Gaps = 34/392 (8%)

Query: 133 FSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIGRPSPGRLHDANS 192
           +S+FI++LL        L +++       L+ KLY FY +   D      +P +L+D N 
Sbjct: 132 YSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCDHIVDQ--HNLTPLQLYDLNL 189

Query: 193 FARWFMAESKLRLARTVFAE-LVGNPTELAKLPRDTETIITLLQLHLGAKHIFWR----D 247
           F + F+AE++L  A  V    L+  P        D E +I  L+L  GA   FW+     
Sbjct: 190 FLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDVEILIQFLRLKCGALSKFWKIQPAS 249

Query: 248 PGNSVGRG-GQLFTPAHMAVVTAYNSLGEETXXXXXXXXQSDPQWKSVCSPDLDRNIILA 306
             NS     G+  +  H+A   +Y    E+           +  WK+  SP LD  II +
Sbjct: 250 QRNSTAITLGEKASDCHLA--KSYKFQNEKVLLQIINSVLGEHNWKNRRSPKLDAAIIYS 307

Query: 307 LAFHNRLDLVHXXXXXXXXXXXXGHGLPSTPLLPDGALVGAVVTAFAFKH-QLAQGLAIA 365
           L +  + DL+               G+ + P   +  L+ AV+T++  K   + +GL + 
Sbjct: 308 LGYLGQTDLIEKYVNRTWSPSK-DEGVKTNP---NSDLLVAVLTSYCVKEGNMRKGLEV- 362

Query: 366 YQFLDRFTHLPNEHELWKIIFT---------WLARRHPTGSQGAALYDEAWSKMRTRYAE 416
              LDRF     E EL  + +          W  +R     + A L    W+ M+  +A+
Sbjct: 363 ---LDRFIRDYPEVELDPLFWRRLLQLSSLLWDKKR----DRKATLSHGCWTIMKQWHAQ 415

Query: 417 HGQPTPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQP--AVAPRDRLLLLKCQA 474
             +  PYDY I +  Y I  R  +      ++       + QP   + P +  LL K Q 
Sbjct: 416 RQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTIRPNELSLLCKYQR 475

Query: 475 HIVGRLVRARRNSAAADFVDQWALDSEARSHL 506
            I+  +          +F  +W+  S  +  L
Sbjct: 476 FILKMIALKGNYHKGFEFCQEWSFSSTNKFEL 507

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/375 (19%), Positives = 161/375 (42%), Gaps = 19/375 (5%)

Query: 133 FSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIGRPSPGRLHDANS 192
           FS  ++ LL     S+ L+ ++    ++   + ++G Y+      P G  +P +LHD NS
Sbjct: 129 FSTLLNGLLTERNLSTKLETVLP---SVQSTEMIFGLYQTYLMTIPAGSLNPLQLHDLNS 185

Query: 193 FARWFMAESKLRLARTVFAELVGNPTELAKLPRDTETIITLLQLHLGAKHIFWRDPGNSV 252
           F ++F+  ++L  A+ V   ++ +  +  +LP DT T I  LQL  GA    W+   + V
Sbjct: 186 FVQYFIETAQLGKAQIVLDRILASNND--QLPCDTTTGIHYLQLRCGALPRNWKVFDSRV 243

Query: 253 GRGGQLFTPAHMA--VVTAYNSLGEETXXXXXXXXQ-SDPQWKSVCSPDLDRNIILALAF 309
           G   +L +  + +  V   Y +L + +           + +W    SP L+  +I +L F
Sbjct: 244 GHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDENSEWFHKKSPTLEAAVIYSLGF 303

Query: 310 HNRLDLVHXXXXXXXXXXXXGHGLPS--TPLLPDGALVGAVVTAFAFKHQLAQGLAIAYQ 367
             +L L+             G  L +    + P   ++ A+ T+FA   ++  GL +   
Sbjct: 304 MGQLTLLKEHIAVRWGITELGASLATEVNEVPPSPEVLIAIFTSFASHQEVTLGLRLMDA 363

Query: 368 FLDRFTHLPNEHELWKIIFTWL-----ARRHPTGSQGAALYDEAWSKMRTRYAEHGQPTP 422
           F+ +++ +  +   W+ +F W       +  P G     L    W  M   + +  +   
Sbjct: 364 FITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGD----LSRGCWRVMTEWHEKGSKKLQ 419

Query: 423 YDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAVAPRDRLLLLKCQAHIVGRLVR 482
            D ++    Y ++ + ++ +    +++     LY++P ++ ++  ++ K    ++  +  
Sbjct: 420 PDTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKPTLSSKEMAIVQKYSKLVLKSMAE 479

Query: 483 ARRNSAAADFVDQWA 497
                    F+ +W+
Sbjct: 480 LGYYHKPLTFITEWS 494

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 87/385 (22%), Positives = 157/385 (40%), Gaps = 20/385 (5%)

Query: 133 FSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIGRPSPGRLHDANS 192
           FS FI  LL        L   +       ++  LY  Y +     P+   SP +LHD N 
Sbjct: 134 FSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTVTPGPL---SPLQLHDFNK 190

Query: 193 FARWFMAESKLRLARTVFAELVGNPTELAKLPRDTETIITLLQLHLGAKHIFWRDPGNSV 252
           F R+F+  ++LR A+TV   ++ +     +LP D+ T    LQL  GA    W+    ++
Sbjct: 191 FIRFFIRSAQLRKAQTVLDCILKSNNN--QLPCDSATATHYLQLRCGALPRNWKVLDENL 248

Query: 253 GRGGQLFTPA--HMAVVTAYNSLGEETXXXXXXXXQSDPQ--WKSVCSPDLDRNIILALA 308
           GR  +L      +  V  +Y +L  ++         SDP+  W    S  L+  ++ +L 
Sbjct: 249 GRSTRLGARKNRYQLVSHSYKALDHKSVLTFMSLL-SDPKSVWFHRKSAALESAVVYSLG 307

Query: 309 FHNRLDLVHXXXXXXXXXXXXGHGLPSTPLL--PDGALVGAVVTAFAFKHQLAQGLAIAY 366
           F  +L L+              H   +      P   ++ AV+T++A    ++  L +  
Sbjct: 308 FMGQLKLLEEHVWRNWGISLQEHNQVTDASFTSPSSEVLVAVLTSYASNKNISSALHLID 367

Query: 367 QFLDRFTHLPNEHELWKIIFTWLAR--RHPTGSQGAALYDEAWSKMRTRYAEHGQPTPYD 424
            F+ ++  L  +H  W+ +F W  R     T  +G  L    W  MR  +A   +  P D
Sbjct: 368 GFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRG-ELSRGCWRVMREWHAARNRQLPAD 426

Query: 425 YSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAVAPRDRLLLLKCQAHIVGRLVRAR 484
             +    + ++ R ++ R    ++    S  +Q+  ++  + +L  K    I+  +    
Sbjct: 427 AVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKANLSRHEAVLFQKFAKLILKNMAHLG 486

Query: 485 RNSAAADFVDQWALDSEARSHLLEH 509
                  F+ +W+ +      LLEH
Sbjct: 487 YYHKPLKFIKEWSPNK-----LLEH 506

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 88/409 (21%), Positives = 170/409 (41%), Gaps = 44/409 (10%)

Query: 133 FSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAP----IGRPSPGRLH 188
            S+FI+R+  +     D+K ++    +++  + +Y  +    +  P    I + +   L 
Sbjct: 125 LSIFINRIYKS--NGHDIKRVIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALHLK 182

Query: 189 DANSFARWFMAESKLRLARTVFAELVGNPTELAKLPRDTETIITLLQLHLGAKHIFWRDP 248
           D N F   F+ E++L  A+ V   ++     + K+  D +T++  L+L  G    FW  P
Sbjct: 183 DLNLFITIFIKEAQLSKAQNVLQYIIDAEGSIEKIT-DHDTMVNFLRLRCGGLPKFWLVP 241

Query: 249 GNSVGRGGQLFTPAHMAVVT-------AYNSLGEETXXXXXXXXQSDPQ-WKSVCSPDLD 300
             S     Q    + ++  +       +Y S    T          + + WKS  S  LD
Sbjct: 242 QASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNKKVWKSKHSGILD 301

Query: 301 RNIILALA--FHNRLDLVHXXXXXXXXXXXXGHGLPSTPLL--------PDGALVGAVVT 350
             I+ +LA  F  ++                 HG P    +        P   ++ A+++
Sbjct: 302 STIVYSLAHTFQKQM----MDGFIKEHWGISSHGDPLDLFIKKKKVASAPSNEILIAIMS 357

Query: 351 AFAFKHQLAQGLAIAYQFLDRFTHL-PN---EHELWKIIFTWLARRH--PTGSQGAALYD 404
           ++ +K +   G   A + LD+F  + P+   ++  W+ +  W  R        QG   Y 
Sbjct: 358 SYIYKDRNIDG---AMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYG 414

Query: 405 EAWSKMRT-RYAEHGQPT--PYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAV 461
             W+ M+    A  G+    PYD+ I    YR+ +R ++ +    ++++ + P   +  V
Sbjct: 415 -CWNMMKNWNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNV 473

Query: 462 APR--DRLLLLKCQAHIVGRLVRARRNSAAADFVDQWALDSEARSHLLE 508
           A +  +  LL K Q   +  L+  R+   AA F+++W++D   R  L E
Sbjct: 474 AVKKAELNLLNKYQTLAMNWLIERRQFKKAAFFIEEWSIDRNNRIQLRE 522

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 82/415 (19%), Positives = 162/415 (39%), Gaps = 64/415 (15%)

Query: 118 PQKTTLSELLSQEEG-------------FSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQ 164
           P    LSELL    G             FSV ++R+L     S + +HL SK+     ++
Sbjct: 62  PASNNLSELLDLLAGHNVFNILSPTAMQFSVLLNRVLA----SQNYRHLDSKEN----VE 113

Query: 165 KLYG-FYREQFADA-PIGRPSPGRLHDANSFARWFMAESKLRLARTVFAELVGNPTELAK 222
           K +  F R + A A    + +  +LHD N    +F+A ++L+ A+ +   L+    +   
Sbjct: 114 KFFAIFMRYKGAIALQSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQDVKF-- 171

Query: 223 LPRDTETIITLLQLHLGAKHIFWRDPGNSVGRGGQLFTPAHMAVVTAYNSLGEETXXXXX 282
              D   I    +L  G+              G Q           AY    + T     
Sbjct: 172 ---DVFMIKNYTKLRCGSSF------------GKQTLNNK------AYKVFDQNTVFQLI 210

Query: 283 XXXQSDPQWKSVCSPDLDRNIILALAFHNRLDLVHXXXXXXXXXXXXGHGLPSTP----- 337
              ++D ++        +  I+ +L + N + L+              H   +       
Sbjct: 211 GKVEADRKFAF-----WNNEIVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHLQ 265

Query: 338 ----LLPDGALVGAVVTAFAFKHQ-LAQGLAIAYQFLDRFTHLPNEHELWKIIFTWLARR 392
               + P   ++  +V+++A   Q + + + I  +F   +  L      W  +     + 
Sbjct: 266 QGDAMYPSSKVLATIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNCAIK- 324

Query: 393 HPTGSQGAALYDEAWSKMRTRYAEHGQPTPYDYSIARASYRIVRRDSSLRRVRALLNDYM 452
              GS+  + +   W+ M+  + +  +  P+  ++     R +R+ S+L     +L  ++
Sbjct: 325 -CGGSKDPSQFLACWNLMKKWHTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQYWL 383

Query: 453 SPLYQQPAVAPR-DRLLLLKCQAHIVGRLVRARRNSAAADFVDQWALDSEARSHL 506
            PLY +    P  +R +L+K Q  I+ +LV  R+ +    F+DQW++D+  +  L
Sbjct: 384 GPLYLKRGNIPEFERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDL 438

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 72/360 (20%), Positives = 150/360 (41%), Gaps = 41/360 (11%)

Query: 183 SPGRLHDANSFARWFMAESKLRLARTVFAELVGN-PTELAKLPRDTETIITLLQLHLGAK 241
           +P +L+D N    WF+   +L+ A T    ++     E+ ++P D++TII  L+L+ G  
Sbjct: 222 NPIQLYDLNKVITWFIKAGQLKKATTALMYILKRYNAEIFQIP-DSKTIINFLKLYCGGL 280

Query: 242 HIFWR-DPGNS---VGRGGQLF----TPAHMAVVTAYNSLGEETXXXXXXXXQSDPQ--- 290
              WR +P N      +G + F      ++  + ++Y ++ E+         + +     
Sbjct: 281 PTNWRIEPINHRFIKNQGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNTNDMK 340

Query: 291 -----WKSVCSPDLDRNIILALAFHNRLDLVHXXXXXXXXXXXXGHGLPSTPLLPDGALV 345
                +  + + + D  +I +L    R DL                      L  D  +V
Sbjct: 341 LSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAEQYFKDNWL----SDSCDDVELTSD--IV 394

Query: 346 GAVVTAFAFKH--QLAQGLAIAYQFLDRFTHLPNEHELWKIIFTWLARRHPTGS--QGAA 401
            A+ +++ + +   + +   +  + + R+  L      W  I  W  +   T +   G  
Sbjct: 395 IAIFSSYVYNNSNNIEKANKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEI 454

Query: 402 LYDEAWSKMRTRYAEHGQPT--------PYDYSIARASYRIVRRDSSLRRVRALL-NDYM 452
            YD  ++ M T Y+ +            PY+  +    Y +     SL +   ++ N + 
Sbjct: 455 PYDSFYT-MLTYYSNYCSRNSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFK 513

Query: 453 SPLYQQPA-VAPRDRLLLLKCQAHIVGRLVRARR--NSAAADFVDQWALDSEARSHLLEH 509
             L++ P+ V  +D  +LLK Q  I+  L+  R+  ++   DF+++++LD+  +  LLE+
Sbjct: 514 KSLFKTPSKVTTKDYQILLKYQKMILKYLINDRKLTSNKPLDFIEKYSLDTNNKEQLLEY 573

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 75/438 (17%), Positives = 171/438 (39%), Gaps = 53/438 (12%)

Query: 120 KTTLSELLSQEEGFSVFIHRLLPTYTPSSD-----LKHLVSKDGTI-------------- 160
           KT L +LL   +   +F+  LL +   + +     L  L+ + G I              
Sbjct: 97  KTILEQLLQHNDNSYMFLRELLESKQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKH 156

Query: 161 -ALLQKLYGFYREQFADAPIGRPSPGRLHDANSFARWFMAESKLRLARTVFAELVGNPTE 219
             ++ KL+  Y        +   S   L D N F  +F+ E  L  A  V   ++     
Sbjct: 157 SEMVFKLFQLYGNAIGSDKLSLLS---LRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRS 213

Query: 220 LAKLPRDTETIITLLQLHLGAKHIFW-----------RDP-GNSVGRGGQLFTPAHMAV- 266
           +  L  D +T+   LQL  GA   +W           +D  GN + +        + AV 
Sbjct: 214 ILDLY-DVDTVTHYLQLRCGALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVK 272

Query: 267 -VTAYNSLGEETXXXXXXXXQSDPQWKSVCSPDLDRNIILALAFHNRLDLVHXXXXX--- 322
               Y  L             +D +WKS  S  LD  ++ +L +  +L  +         
Sbjct: 273 LTNRYKILDPLGVLKIANKIITDDKWKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWN 332

Query: 323 XXXXXXXGHGLPSTPLLPDGA------LVGAVVTAFAFKHQ-LAQGLAIAYQFLDRFTHL 375
                  G+    T +  + +      ++ A+++++++  + + + + I  + ++ + +L
Sbjct: 333 VDISMSDGNSDVGTQISNEASKPLPSEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNL 392

Query: 376 PNEHELWKIIFTW--LARRHPTGSQGAALYDEAWSKMRTRYAEHGQPTPYDYSIARASYR 433
               + W+ +  W  L   H    +G+ +Y   +  ++  +        +D  + +  Y 
Sbjct: 393 ELNQQFWRRLMQWSVLCWDHKLDRKGSLVYG-CFKTLKKYHEMRSIRINFDEGLLQELYT 451

Query: 434 IVRRDSSLRRVRALLNDYMSPLYQQPA--VAPRDRLLLLKCQAHIVGRLVRARRNSAAAD 491
           +V    + R    +++++M   + + +  +   +R LL   Q   +  ++  +    A++
Sbjct: 452 LVYYTKNSRIAAEVVSEFMPQFFYKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFTASN 511

Query: 492 FVDQWALDSEARSHLLEH 509
           F+++W++D++ +  L ++
Sbjct: 512 FIEKWSMDNQNKEELFKY 529

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 68/342 (19%), Positives = 132/342 (38%), Gaps = 30/342 (8%)

Query: 187 LHDANSFARWFMAESKLRLARTVFAELVGNPTELAKLPR--DTETIITLLQLHLGAKHIF 244
           + DAN   + F+   +L  A+ + + ++    ++   P+  D  TI+  LQL  GA   +
Sbjct: 200 IFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNADISTIVHFLQLRCGALAPY 259

Query: 245 WRDPGNSVGRGGQLFTPAHMA-------VVTAYNSLGEETXXXXXXXXQSDPQWKSVCSP 297
           W+ P NS  + G L     +        + + Y ++  +T          +   K + S 
Sbjct: 260 WKIPDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQTLLKIADLALQEK--KLLNSE 317

Query: 298 DLDRNIILALAFHNRLDLVHXXXXXXXXXXXXGHGLPSTPLL------PDGALVGAVVTA 351
           DL   +I +     +  ++                 PS  ++      P   ++ +++ +
Sbjct: 318 DLLSTLIQSFGHLGQTQILERCIEHIWQISP--QEFPSHVVIKHRGCYPSSKILVSILVS 375

Query: 352 FAFK-HQLAQGLAIAYQFLDRFTHLPNEHELWKII-----FTWLARRHPTGSQGAALYDE 405
           F F  H L +GL+I   F+  +  +  +   W+ +     F W     P   + A     
Sbjct: 376 FYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWT----PANDKKATSVVR 431

Query: 406 AWSKMRTRYAEHGQPTPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAV-APR 464
            W  M+  YA        DY   R  Y I+++  +      +L  +   + +  A  A +
Sbjct: 432 CWHLMKQWYASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLRSFKPGIERTRAENAGK 491

Query: 465 DRLLLLKCQAHIVGRLVRARRNSAAADFVDQWALDSEARSHL 506
              +++K Q  I+  LV   R SA  +F+D +  D +    L
Sbjct: 492 VNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDL 533

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 67/342 (19%), Positives = 128/342 (37%), Gaps = 30/342 (8%)

Query: 187 LHDANSFARWFMAESKLRLARTVFAELVGNPTELAKLPR--DTETIITLLQLHLGAKHIF 244
           + D N   + F+   +L  A+ + + ++    ++   PR  D  TI+  LQL  GA   +
Sbjct: 200 IFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRNADIGTIVHFLQLRCGALTAY 259

Query: 245 WRDPGNSVGRGGQLFTPAHMA-------VVTAYNSLGEETXXXXXXXXQSDPQWKSVCSP 297
           W+ P NS  +  QL     +        + + Y ++  +T          D ++  + S 
Sbjct: 260 WKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTLLKIADLVLQDKRF--LNSE 317

Query: 298 DLDRNIILALAFHNRLDLVHXXXXXXXXXXXXGHGLPS-TPLLPDGA------LVGAVVT 350
           DL   +I +     +  ++                 PS   + P G       L+  +V+
Sbjct: 318 DLLSTLIQSFGHLGQTQILERCIEHIWQIS--SQEFPSHVAIKPRGCYPSSKILISILVS 375

Query: 351 AFAFKHQLAQGLAIAYQFLDRFTHLPNEHELWKII-----FTWLARRHPTGSQGAALYDE 405
                  L +GL+I   F+  +  +  +   W+ +     F W     P   + AA   +
Sbjct: 376 FHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWT----PVNDKRAASIVK 431

Query: 406 AWSKMRTRYAEHGQPTPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAVAPRD 465
            W  M+  Y         DY   R  Y ++++  +      +L  + S + +     P  
Sbjct: 432 CWHLMKHWYESKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKSFKSGIEKMRTANPEK 491

Query: 466 -RLLLLKCQAHIVGRLVRARRNSAAADFVDQWALDSEARSHL 506
              +L+K Q  I+ +LV   + SAA  F+  +  +  A   L
Sbjct: 492 LEAILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDL 533

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 63/340 (18%), Positives = 134/340 (39%), Gaps = 26/340 (7%)

Query: 187 LHDANSFARWFMAESKLRLARTVFAELVGNPTELAKLPR--DTETIITLLQLHLGAKHIF 244
           + D N   + F+   +L  A+ V + ++   +++   P+  D  TII  LQL  GA   +
Sbjct: 201 IFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKNADIGTIIHFLQLRCGALAAY 260

Query: 245 WRDPGNSVGRGGQLFT-----PAHMAVVTAYNSLGEETXXXXXXXXQSDPQWKSVCSPDL 299
           W+ P NS  +  +           + + ++Y ++  +T              + + S DL
Sbjct: 261 WKMPDNSEQKYSRKMVRLGAKNTSIRITSSYKAMDHQTLLKIADLVLQKE--RLLNSEDL 318

Query: 300 DRNIILALAFHNRLDLV-----HXXXXXXXXXXXXGHGLPST-PLLPDGALVGAVVTAFA 353
              +I +     +  ++     H                P T    P   ++ +++ +F 
Sbjct: 319 LSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTRGCCPSSKILISILVSFH 378

Query: 354 FK-HQLAQGLAIAYQFLDRFTHLPNEHELWKIIF-----TWLARRHPTGSQGAALYDEAW 407
              + L +GL+I   F+  +  +  +   W+ +F      W     PT  + A      W
Sbjct: 379 LNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWT----PTHDKRATSIVRCW 434

Query: 408 SKMRTRYAEHGQPTPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAV-APRDR 466
             M+  +   G     DY   R  Y + ++  +      +L ++   + +  A+   +  
Sbjct: 435 HLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQNFKPGITRTSAMKTEKIN 494

Query: 467 LLLLKCQAHIVGRLVRARRNSAAADFVDQWALDSEARSHL 506
            +++K Q +I+ +LV   + SAA +F++ ++ D  A   L
Sbjct: 495 GIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKEL 534

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/337 (19%), Positives = 122/337 (36%), Gaps = 20/337 (5%)

Query: 189 DANSFARWFMAESKLRLARTVFAELVGNPTE----LAKLPRDTETIITLLQLHLGAKHIF 244
           D N F + F+  S+L+ A+T    L+    E    L     D +TI   L L  GA    
Sbjct: 169 DMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLMLRSGALQDL 228

Query: 245 WR---DPGNSVGRGGQLFTPAHMAVVTAYNSLGE----ETXXXXXXXXQSDPQWKSVCSP 297
           W+     GN+  +       +H  V + YN L      E           D   + V   
Sbjct: 229 WKIDVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILRYNDKDNHSQPVYFD 288

Query: 298 D-LDRNIILALAFHNRLDLVHXXXXXXXXXXXXGHGLPSTPLLPDGALVGAVVTAFAFKH 356
           + + +N+IL L +  +  L+                 P   +     L+ A+V+A++   
Sbjct: 289 EGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVP-PKYNITVTSDLLTAIVSAYSKCG 347

Query: 357 QLAQ-GLAIAYQFLDRFTHLPNEHELWKIIFTWLARRHPTGSQGAALYDEAWSKMRT--R 413
           +  Q GL IA +F  +  ++  + + W  +  W             L    W  M++   
Sbjct: 348 KSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIILPNKWRSTIDLSKRTWELMKSWRN 407

Query: 414 YAEHGQPTPYDYSIARASYRIVRRD----SSLRRVRALLNDYMSPLYQQPAVAPRDRLLL 469
              +G     +       Y+++  D      L  +  +    +  LY + ++   +  LL
Sbjct: 408 STNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTLYSKNSLTVDEIKLL 467

Query: 470 LKCQAHIVGRLVRARRNSAAADFVDQWALDSEARSHL 506
            K Q   + ++V     S    F+ +W+ D+  +  L
Sbjct: 468 KKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQL 504

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 59/340 (17%), Positives = 129/340 (37%), Gaps = 26/340 (7%)

Query: 187 LHDANSFARWFMAESKLRLARTVFAELVGNPTELAKLPR--DTETIITLLQLHLGAKHIF 244
           + D N   R F+   +L  A+ +   ++    ++   P   D  T++  L+L  GA   +
Sbjct: 196 IFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNADIGTMVHFLKLRCGALAAY 255

Query: 245 WRDPGNSVGRGGQLFTPAHMA-------VVTAYNSLGEETXXXXXXXXQSDPQWKSVCSP 297
           W+ P NS     QL     +        + + Y  +  +T          + ++  + S 
Sbjct: 256 WKIPDNSGQDQKQLRKIVRLGAKNTSIRLSSTYKVMDHQTLLKIADLVLHEKRF--LNSE 313

Query: 298 DLDRNIILALAFHNRLDLVHXXXXXXXXXXXXGH----GLPSTPLLPDGALVGAVVTAFA 353
           DL   +I +     +  ++                    +      P   ++ +++ +F 
Sbjct: 314 DLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPRGCYPSSKILISILVSFH 373

Query: 354 FK-HQLAQGLAIAYQFLDRFTHLPNEHELWKIIF-----TWLARRHPTGSQGAALYDEAW 407
           +  + L +GL+I   F+  +  +  +   W+ +F      W     P   + A      W
Sbjct: 374 YNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWT----PAKDKKATSVIRCW 429

Query: 408 SKMRTRYAEHGQPTPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQ-QPAVAPRDR 466
             M+  +   G     DY   R  Y I+++  +      +L  + S + + +   + +  
Sbjct: 430 HLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSFKSGIERLRETNSDKLN 489

Query: 467 LLLLKCQAHIVGRLVRARRNSAAADFVDQWALDSEARSHL 506
           ++L+K Q +I+ +LV   R SA  +F++ +  D     +L
Sbjct: 490 IVLIKYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNL 529

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 71/390 (18%), Positives = 158/390 (40%), Gaps = 53/390 (13%)

Query: 131 EGFSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIGRPSPGRLHDA 190
           E +S+F+ ++L           +   D  + ++ +L+  Y   +     G  +  +++D 
Sbjct: 103 EEYSLFLGKVLS----------MKDSDVNVNVVFQLFEIYARMYCGE--GSLNALQIYDL 150

Query: 191 NSFARWFMAESKLRLARTVFAELVGNPTELAKLP--RDTETIITLLQLHLGAKHIFWRDP 248
           N   ++F+   +L+  + V   ++     +  +   RD  ++   L+L  G+    W+  
Sbjct: 151 NKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGSLVKDWKFE 210

Query: 249 GNSV----GRGGQLFTPAHMAVVTAYNSLGEETXXXXXXXXQSDPQWKSVCSPDLDRNII 304
           G ++     R G+L           Y  L   +         +DP     C   L  +II
Sbjct: 211 GKNLRYLQSRQGRL----------NYKFLDGWSLLKIADLVLNDPM---KCQNVLTNSII 257

Query: 305 LALAFHNRLDLV-HXXXXXXXXXXXXGHGLPSTPLLPDGALVGAVVTAFAFKH-QLAQGL 362
            +L    +++L+ H             +GL    L PD   + A++T++ + +  + +  
Sbjct: 258 YSLGHLRQVELLDHFIDQMWMQETRPRNGL----LYPDTNNIIAIITSYCYNYGNMDKSF 313

Query: 363 AIAYQFLDRFTHLPNEHELWKIIFTWLARRHPTGSQGAALYDEAWSKMRTRYAEHGQPTP 422
            +  + L++++ L  +   W+ +F W     P  ++G  L  + WS M     E  +   
Sbjct: 314 DVLDRILEKYSGLKFDKFFWRRLFQWCILTEPNANKGFIL-GQCWSLM-----EKQEKVE 367

Query: 423 YDYSIAR-ASYRIVR-RDS--SLRRVRALLNDYMSPLYQQPAVAPRDRLLLLKCQAHIVG 478
           +D  +      +IV+ RD   +LR ++ ++      L +   +   D  LLLK Q  +  
Sbjct: 368 FDGVLLELLREKIVKVRDVPLALRVLKMIV----IELKKVNFINELDMELLLKYQKFVFS 423

Query: 479 RLVRARRNSAAADFV--DQWALDSEARSHL 506
           +L    +   A + +  D + ++ E ++ +
Sbjct: 424 KLGEINKTVKAMELLSCDDYTINKENKAFM 453

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/329 (17%), Positives = 118/329 (35%), Gaps = 32/329 (9%)

Query: 186 RLHDANSFARWFMAESKLRLARTVFAELV-GNPTELAKLPRDTETIITLLQLHLGAKHIF 244
           ++ D N F  +F+   +L+ A+ V   L+  +P  L K   D  T    L+L+ GA H  
Sbjct: 137 QVEDMNKFINYFVEFKQLKKAQLVMKYLILKSPRVLEKY--DVSTTRNYLKLNCGACHEL 194

Query: 245 WRDPGNSVGRGGQLFTPAHMAVVTAYNSLGEETXXXXXXXXQSDPQWKSVCSPDLDRNII 304
           W              T   +   +  N +G                W        D  II
Sbjct: 195 WYTNYKIFDFNNT--TLDKLVKYSLDNKIG---------------YW--------DVEII 229

Query: 305 LALAFHNRLDLVHXXXXXXXXXXXXGHG-LPSTPLLPDGALVGAVVTAFAFKHQ-LAQGL 362
            +L +  R+  +                 + +T   P+  ++ A++  F ++ + + + +
Sbjct: 230 HSLGYSGRIRSLEDYILKKWGISLCDRAQVNTTNEAPESEVLEAIINGFFYRDKRMFRAI 289

Query: 363 AIAYQFLDRFTHLPNEHELWKIIFTWLARR-HPTGSQGAALYDEAWSKMRTRYAEHGQPT 421
            I  +F++ +  L  +   WK       +       Q   +  E W  M+  Y  H +  
Sbjct: 290 KILNEFVNVYPDLNLKITFWKTFMNNCIKEWDEKVDQKGVVIVEYWETMKRWYTVHNRRI 349

Query: 422 PYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAVAPRDRLLLLK-CQAHIVGRL 480
           P++ +  +      +++++L     +  +     Y          L ++K  Q  I+ RL
Sbjct: 350 PFNINFLKVMRTCFKKNNNLVLATDIFQNCFHNFYFCATRMNDSELNVIKEYQNFILSRL 409

Query: 481 VRARRNSAAADFVDQWALDSEARSHLLEH 509
           +  +  S A  F++      E +  L+ +
Sbjct: 410 IEKKGFSNALTFINDHCFSLENKRQLMNY 438

>NCAS0B02180 Chr2 complement(355823..357655) [1833 bp, 610 aa] {ON}
           Anc_8.547 YBR196C
          Length = 610

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 50/111 (45%), Gaps = 6/111 (5%)

Query: 147 SSDLK-HLVSK-DGT-IALLQKLYGFYREQFADAPIGRPSPGRLHDANSFARWFMAESKL 203
           + DLK H VS  DGT IA + K+       F  A     +   + +ANS   WF+  S  
Sbjct: 240 AGDLKVHFVSNIDGTHIAEVLKVVNPETTLFLIASKTFTTAETITNANSAKTWFLQNSGN 299

Query: 204 RLARTV--FAELVGNPTELAKLPRDTETIITLLQLHLGAKHIFWRDPGNSV 252
             A     FA L  N TE+AK   DT+ +    +  +G ++  W   G SV
Sbjct: 300 EPAHVAKHFAALSTNETEVAKFGIDTKNMFG-FENWVGGRYSVWSAIGLSV 349

>Smik_2.12 Chr2 complement(10644..13673) [3030 bp, 1009 aa] {ON}
           YBL106C (REAL)
          Length = 1009

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 36/92 (39%), Gaps = 21/92 (22%)

Query: 136 FIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIGRPSPGRL-----HDA 190
           F ++L P Y P  DL   + K  T  ++Q LY                P  L     HD 
Sbjct: 215 FFYQLDP-YAPGGDLSTNIEKKRTPKVIQSLY---------------HPNSLHILTVHDD 258

Query: 191 NSFARWFMAESKLRLARTVFAELVGNPTELAK 222
           NS   W +   KL  AR++F   V  P+   K
Sbjct: 259 NSLVFWDVNSGKLIQARSIFETDVNFPSSALK 290

>Skud_2.3 Chr2 complement(1409..4441) [3033 bp, 1010 aa] {ON}
           YBL106C (REAL)
          Length = 1010

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 37/92 (40%), Gaps = 21/92 (22%)

Query: 136 FIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIGRPSPGRL-----HDA 190
           F ++L P Y P  DL   + K  T  ++Q LY                P  L     H+ 
Sbjct: 215 FFYQLEP-YAPGGDLSTGIEKKRTPKVIQSLY---------------HPNSLHVLTVHED 258

Query: 191 NSFARWFMAESKLRLARTVFAELVGNPTELAK 222
           NS   W ++  KL  AR++F   V  P   +K
Sbjct: 259 NSLVFWDVSSGKLIQARSIFETHVNFPISTSK 290

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.135    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,537,491
Number of extensions: 1857830
Number of successful extensions: 3665
Number of sequences better than 10.0: 23
Number of HSP's gapped: 3716
Number of HSP's successfully gapped: 28
Length of query: 537
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 423
Effective length of database: 40,409,475
Effective search space: 17093207925
Effective search space used: 17093207925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)