Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ABL118W8.850ON50450426280.0
KLTH0C03608g8.850ON49542015540.0
Kwal_27.102048.850ON49442015190.0
SAKL0D01166g8.850ON50542014910.0
Skud_13.4588.850ON51442614730.0
TDEL0B001908.850ON49242114580.0
Ecym_46198.850ON48742314570.0
ZYRO0C14872g8.850ON49642314540.0
Kpol_237.18.850ON50342414440.0
YMR285C (NGL2)8.850ON51542614440.0
NCAS0C003108.850ON55642514400.0
TBLA0B029008.850ON52042414350.0
Smik_13.5018.850ON51542414330.0
TPHA0I003208.850ON52942514310.0
CAGL0I02684g8.850ON49342314260.0
NDAI0K003708.850ON56842414250.0
KLLA0C06248g8.850ON51642614160.0
Suva_13.4758.850ON51542614100.0
KAFR0L019608.850ON51142313700.0
KNAG0K006508.850ON48243113350.0
TBLA0D033008.850ON48043311661e-156
NDAI0E002608.850ON49844011111e-147
NCAS0B002708.850ON47642810811e-143
YML118W (NGL3)8.850ON5054389171e-118
KAFR0A028608.850ON4784369141e-118
Suva_13.258.850ON5024389081e-116
Skud_13.238.850ON4984369071e-116
Smik_13.168.850ON5024388981e-115
KNAG0G034708.850ON4664338521e-108
CAGL0B02387g8.850ON4714318171e-103
ACR288W7.78ON7362271964e-15
Ecym_73547.78ON7852281921e-14
KLTH0D02310g7.78ON7392331884e-14
Kwal_26.71127.78ON7422331875e-14
Suva_1.457.78ON8312521851e-13
CAGL0H06149g7.78ON8732471822e-13
SAKL0B10032g7.78ON7312331761e-12
Kpol_1040.147.78ON7842301761e-12
TPHA0H026807.78ON8722301733e-12
KAFR0K006707.78ON7952321733e-12
Skud_1.407.78ON8692471724e-12
KLLA0F15884g7.78ON7902241714e-12
KNAG0D048407.78ON7792381705e-12
YAL021C (CCR4)7.78ON8372491672e-11
ZYRO0D05302g7.78ON8572351644e-11
TDEL0H037307.78ON7972301609e-11
NDAI0H025207.78ON8982251601e-10
Smik_1.457.78ON8392461554e-10
TBLA0A046607.78ON8962251511e-09
NCAS0F016407.78ON8552371412e-08
TDEL0H036007.90ON3662451312e-07
KLLA0F07733g7.90ON3712551213e-06
ZYRO0D05588g7.90ON3562341204e-06
Smik_15.1257.90ON3632391124e-05
KAFR0D012507.90ON3562391106e-05
CAGL0F01001g7.90ON3592441107e-05
Suva_15.1277.90ON3632451098e-05
Kpol_1044.67.90ON3722521091e-04
TBLA0E022607.90ON3882491081e-04
YOL042W (NGL1)7.90ON3632371062e-04
ACR277C7.90ON3782451035e-04
Kwal_26.71707.90ON3722621035e-04
Skud_15.1157.90ON3632351027e-04
KLTH0D02574g7.90ON3682511010.001
SAKL0B09768g7.90ON3682461010.001
TPHA0L005307.90ON391251980.002
NDAI0A085307.90ON365237970.003
NCAS0I005007.90ON389237960.003
KNAG0L005507.90ON381254950.004
Ecym_26367.90ON367262940.005
Suva_9.189na 1ON10763730.60
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL118W
         (504 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...  1016   0.0  
KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   603   0.0  
Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   589   0.0  
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   578   0.0  
Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   572   0.0  
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   566   0.0  
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   565   0.0  
ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   564   0.0  
Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   560   0.0  
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   560   0.0  
NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850      559   0.0  
TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   557   0.0  
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   556   0.0  
TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   555   0.0  
CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   553   0.0  
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   553   0.0  
KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   550   0.0  
Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   547   0.0  
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   532   0.0  
KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   518   0.0  
TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...   453   e-156
NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   432   e-147
NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      421   e-143
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...   357   e-118
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   356   e-118
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   354   e-116
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   353   e-116
Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   350   e-115
KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   332   e-108
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   319   e-103
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    80   4e-15
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    79   1e-14
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    77   4e-14
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    77   5e-14
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    76   1e-13
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    75   2e-13
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    72   1e-12
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    72   1e-12
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    71   3e-12
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    71   3e-12
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    71   4e-12
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    70   4e-12
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    70   5e-12
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    69   2e-11
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    68   4e-11
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    66   9e-11
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      66   1e-10
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    64   4e-10
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    63   1e-09
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      59   2e-08
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    55   2e-07
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    51   3e-06
ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} simila...    51   4e-06
Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042...    48   4e-05
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    47   6e-05
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    47   7e-05
Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042...    47   8e-05
Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119...    47   1e-04
TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {O...    46   1e-04
YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putat...    45   2e-04
ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON} S...    44   5e-04
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    44   5e-04
Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042...    44   7e-04
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    44   0.001
SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {...    44   0.001
TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90...    42   0.002
NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa] ...    42   0.003
NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90 ...    42   0.003
KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90...    41   0.004
Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {O...    41   0.005
Suva_9.189 Chr9 complement(313656..313979) [324 bp, 107 aa] {ON}...    33   0.60 

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score = 1016 bits (2628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/504 (96%), Positives = 485/504 (96%)

Query: 1   MTLQEDTSLQSMMASERELNDQLERVSLVETNSSNSKVHAEPGSAEKTSKKPKANGRPSA 60
           MTLQEDTSLQSMMASERELNDQLERVSLVETNSSNSKVHAEPGSAEKTSKKPKANGRPSA
Sbjct: 1   MTLQEDTSLQSMMASERELNDQLERVSLVETNSSNSKVHAEPGSAEKTSKKPKANGRPSA 60

Query: 61  EEXXXXXXXXXXXXXXXXXXXGEDVGFIKRPLLVCNGDEAKGFVFRMMTYNCLAQALIRR 120
           EE                   GEDVGFIKRPLLVCNGDEAKGFVFRMMTYNCLAQALIRR
Sbjct: 61  EEIEKIRAQRKAKKEAAGKQGGEDVGFIKRPLLVCNGDEAKGFVFRMMTYNCLAQALIRR 120

Query: 121 KLFPTSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHR 180
           KLFPTSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHR
Sbjct: 121 KLFPTSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHR 180

Query: 181 SFGKNHGIAIVWRRSLFNKVDETLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRY 240
           SFGKNHGIAIVWRRSLFNKVDETLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRY
Sbjct: 181 SFGKNHGIAIVWRRSLFNKVDETLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRY 240

Query: 241 PGSAQSGIVVGTSHLFWHPFGTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPF 300
           PGSAQSGIVVGTSHLFWHPFGTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPF
Sbjct: 241 PGSAQSGIVVGTSHLFWHPFGTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPF 300

Query: 301 FCGDFNSQPFDAPYLSMCSKPIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKF 360
           FCGDFNSQPFDAPYLSMCSKPIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKF
Sbjct: 301 FCGDFNSQPFDAPYLSMCSKPIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKF 360

Query: 361 GAGQPETPVPDSFDGTPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRG 420
           GAGQPETPVPDSFDGTPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRG
Sbjct: 361 GAGQPETPVPDSFDGTPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRG 420

Query: 421 EPEISNWAHAWRGLLDYIMYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPS 480
           EPEISNWAHAWRGLLDYIMYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPS
Sbjct: 421 EPEISNWAHAWRGLLDYIMYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPS 480

Query: 481 HGQPHEGEYPSDHLSLMCELELLM 504
           HGQPHEGEYPSDHLSLMCELELLM
Sbjct: 481 HGQPHEGEYPSDHLSLMCELELLM 504

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/420 (63%), Positives = 333/420 (79%), Gaps = 1/420 (0%)

Query: 84  DVGFIKRPLLVCNGDE-AKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142
           D+ FI RP+L  N  E A GFVF++MTYNCLAQALIRRKLFPTSGNALKWFKRS+VLL+E
Sbjct: 74  DLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNE 133

Query: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202
             +YN DV+CLQE+D+ QY+SFW +  +  GY S+FHR   KNHGIAIVW+R +F  VD+
Sbjct: 134 FMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAIVWKRDMFTMVDK 193

Query: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGT 262
            LID+D+E SG +E RTTTKNVGL +AL +T ++  +YPGS++ GI+VGT+HLFWHPFGT
Sbjct: 194 MLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGT 253

Query: 263 YERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPI 322
           +ER RQCY++L++MK F+ R+ +L+       + W+PFFCGDFNSQPFD PYLS+ SKP+
Sbjct: 254 FERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPFDTPYLSVSSKPV 313

Query: 323 IYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQRAL 382
            Y+GRA+TVIECSTSY FS  RDG   D+EEGGNIEKFG GQPE PVP+ F  T EQ+ L
Sbjct: 314 TYKGRAKTVIECSTSYTFSKARDGEECDDEEGGNIEKFGDGQPEHPVPEKFSATEEQKGL 373

Query: 383 VDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMYVM 442
           V++M SLHN+LDMR IS+YS+ Y++VH ENAG+DNN  EPEISNWA  WRGLLDYI ++ 
Sbjct: 374 VESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWAETWRGLLDYIFFIK 433

Query: 443 PWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCELEL 502
            WDFSD    +++  FQ    + +R LLR+PPA EMP+HGQPHEGEY SDHLS+MCELEL
Sbjct: 434 KWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGEYGSDHLSMMCELEL 493

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/420 (62%), Positives = 336/420 (80%), Gaps = 2/420 (0%)

Query: 84  DVGFIKRPLLVCNGDEA-KGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142
           D+ FI RP+L  + + + +GFVF++MTYNCLAQALIRRKLFPTSGNALKWFKRS+VLL+E
Sbjct: 74  DLQFISRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNE 133

Query: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202
             +Y  DV CLQEID+ QY+SFW +     GY S+FHR   KNHGIAIVW+R LF  VD+
Sbjct: 134 FMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDK 193

Query: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGT 262
            L+D+D+E SG ++ RTTTKNVGL++AL ++ ++  +YPG+++ GI+VGT+HLFWHPFGT
Sbjct: 194 MLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGT 253

Query: 263 YERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPI 322
           +ER RQCY++L++MK F+ R+ +L+ GS     +W+PFFCGDFN+QPFD PYLSM SKP+
Sbjct: 254 FERTRQCYVLLNKMKDFIHRVNVLQDGS-SPEKKWYPFFCGDFNAQPFDTPYLSMSSKPV 312

Query: 323 IYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQRAL 382
           +Y+ RA+TVIECSTSY FS  RDG   D+EEGGNIEKFG GQPE PVPD+++  PEQ+ L
Sbjct: 313 VYKDRAKTVIECSTSYTFSKARDGEECDDEEGGNIEKFGDGQPEHPVPDTYEAAPEQKEL 372

Query: 383 VDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMYVM 442
           V  M  LHN+LDMRAIS+YS+AY++VHPENAG DN   EPEISNWA  WRGLLDYI ++ 
Sbjct: 373 VQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEISNWAETWRGLLDYIFFIK 432

Query: 443 PWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCELEL 502
            W+F+DN   +++  F+K   V + SLLR+PP+ EMP+HGQPHEGEY SDHLSLMCE+EL
Sbjct: 433 QWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIEL 492

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/420 (63%), Positives = 332/420 (79%), Gaps = 1/420 (0%)

Query: 84  DVGFIKRPLLVCNGDE-AKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142
           D+ FIKRPLL  + +E  KGF F++MTYN LAQALIRRKLFP+SGNA+KWFKRSKVLL+E
Sbjct: 84  DLQFIKRPLLCLHEEEPVKGFKFKIMTYNALAQALIRRKLFPSSGNAVKWFKRSKVLLNE 143

Query: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202
            ++Y+ DV CLQEIDH QY++FW +  Q  GY S+FHR   KNHG+AIVWR SLF  VD 
Sbjct: 144 FKHYDADVHCLQEIDHIQYQAFWKEEFQKLGYASQFHRIGTKNHGVAIVWRCSLFTMVDT 203

Query: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGT 262
            L+D+D+E SG+I  RTTTKN GLI+AL++TD++  ++PG+ +SGI++GT+HLFWHPFGT
Sbjct: 204 MLVDYDKEPSGDIPPRTTTKNAGLILALKFTDKVLNQFPGTKKSGILIGTTHLFWHPFGT 263

Query: 263 YERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPI 322
           +ER RQCY++L++MK  + R+ +L+       S W+PF CGDFNSQPFD PYLSM SKP+
Sbjct: 264 FERTRQCYVVLNKMKELIHRVNVLQNNQDRDYSHWYPFICGDFNSQPFDTPYLSMTSKPV 323

Query: 323 IYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQRAL 382
            Y GRA+TVIECSTS+ FS LRDG   ++EEGGNIEKFG GQPE PVP  F  T EQ AL
Sbjct: 324 TYRGRAKTVIECSTSFTFSKLRDGEEGEDEEGGNIEKFGKGQPEHPVPKEFHATEEQTAL 383

Query: 383 VDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMYVM 442
           V  M+SLHN+LDMRAISLY++ Y++VHPENAG+DN+ GEPEISNWA  WRGLLDYI +V 
Sbjct: 384 VKQMESLHNSLDMRAISLYAVGYKHVHPENAGLDNDSGEPEISNWAETWRGLLDYIFFVK 443

Query: 443 PWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCELEL 502
            W+ +D + VD I  F++   + +R LLR+PP  EM  HGQPHEGEYPSDHLS+MCE+EL
Sbjct: 444 NWNGTDRSSVDKIDVFERENGIKIRGLLRMPPGEEMTKHGQPHEGEYPSDHLSMMCEIEL 503

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/426 (61%), Positives = 331/426 (77%), Gaps = 5/426 (1%)

Query: 84  DVGFIKRPLL-VCNGDEAKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142
           ++ FI+RPLL +  G+   GF F++MTYNCLAQALIRRKLFP SG+ALKWF+RSKVLL+E
Sbjct: 89  ELHFIQRPLLSLGEGEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNE 148

Query: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202
            +YYN DVICLQE+DH Q++SFW       GY  ++HR+  KNHG+AI+WRRS+F KVD+
Sbjct: 149 FKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDK 208

Query: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQS--GIVVGTSHLFWHPF 260
            LID+D+E SG I  RTTT NVGL++AL+++ E+  +    +    GI++GT+HLFWHPF
Sbjct: 209 MLIDYDKEASGSILTRTTTNNVGLVLALKFSKEVLSKLGKKSSKKCGILIGTTHLFWHPF 268

Query: 261 GTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSK 320
           GTYER RQCY++L +MK F+ R+ +L+  + G  S W PFFCGDFNSQPFD PYLSM SK
Sbjct: 269 GTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSK 328

Query: 321 PIIYEGRARTVIECSTSYKFSSLRDG-CAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQ 379
           P+ Y+ RA+TVIECSTS+KFS +RDG   AD+EEGGNIEKFG  QPE+PVP++F    EQ
Sbjct: 329 PVHYKSRAKTVIECSTSFKFSKVRDGEEGADDEEGGNIEKFGKDQPESPVPENFHANDEQ 388

Query: 380 RALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIM 439
             +VD M  LHN+LDMRAISLYS+ Y+ VHPENAG+DN+RGEPEISNWA+ WRGLLDY+ 
Sbjct: 389 IEIVDDMVQLHNSLDMRAISLYSVGYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLF 448

Query: 440 YVMPWDFSDN-TEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMC 498
           Y+  WD   N  EV+++ +F+K   +  R  LR+PPASEM  HGQPH GEYPSDHLS++C
Sbjct: 449 YIKKWDLQSNRQEVENLSDFEKKNEIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVC 508

Query: 499 ELELLM 504
           +LEL +
Sbjct: 509 DLELQL 514

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  566 bits (1458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/421 (62%), Positives = 331/421 (78%), Gaps = 2/421 (0%)

Query: 84  DVGFIKRPLLVCNGDEA-KGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142
           ++ FIKRPLL  + DE  +G  F+++TYNCLAQALIRRKLFP SG++LKWF+RSKVL  E
Sbjct: 70  ELQFIKRPLLTLHEDEPIEGLSFKLLTYNCLAQALIRRKLFPDSGDSLKWFRRSKVLQYE 129

Query: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202
            ++YN DV+CLQEID+ QY+ FW D L   GY ++F++   KNHG++I W+R LF   D 
Sbjct: 130 FKHYNADVLCLQEIDYIQYQQFWKDELDKLGYDTQFYKQPCKNHGVSIAWKRHLFQLTDR 189

Query: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGT 262
            LID+D+E SG+IE+RT T N GLI+AL++TD  K+  P   +SGI+VGTSHLFWHPFGT
Sbjct: 190 MLIDYDKESSGKIEKRTLTHNSGLILALKFTDAAKQSCPHIRKSGILVGTSHLFWHPFGT 249

Query: 263 YERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPI 322
           YER RQCY++L +MK F+KR+ +L+  + G  S W PFFCGDFNSQPFD PYLSM SKP+
Sbjct: 250 YERTRQCYVVLKKMKEFMKRVNVLQNNNDGNLSHWVPFFCGDFNSQPFDTPYLSMTSKPV 309

Query: 323 IYEGRARTVIECSTSYKFSSLRD-GCAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQRA 381
            Y GRA+TV+ECSTSY FS LR+    A++EEGGNIEKFG  QP+TPVP++FD TPEQ+ 
Sbjct: 310 EYTGRAKTVVECSTSYTFSKLRNGEEDAEDEEGGNIEKFGKDQPQTPVPETFDATPEQQK 369

Query: 382 LVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMYV 441
           LV+ MQ LHN++DMRAISLY++ Y  VHPEN+GIDN+RGEPE+SNWA+ WRGLLDYI+ +
Sbjct: 370 LVEEMQELHNSIDMRAISLYAVGYGEVHPENSGIDNDRGEPEMSNWANTWRGLLDYILLI 429

Query: 442 MPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCELE 501
             WD SD  +VD +  F+K  S+ +R LLR+PPASEM  HGQPHEGEY SDHLS+MC +E
Sbjct: 430 TQWDSSDRKKVDSLETFEKENSLKLRGLLRMPPASEMSHHGQPHEGEYASDHLSMMCTIE 489

Query: 502 L 502
           L
Sbjct: 490 L 490

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/423 (60%), Positives = 327/423 (77%), Gaps = 5/423 (1%)

Query: 84  DVGFIKRPLLVCNGDEA--KGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLS 141
           ++ FI RP+L     +   KGF F +MTYNCLAQ+LIRR LFPTSG ALKW KRS VLL 
Sbjct: 68  NLEFIARPMLPLKVTQTVHKGFSFSLMTYNCLAQSLIRRSLFPTSGRALKWTKRSMVLLK 127

Query: 142 ELQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVD 201
           E ++YN DV+CLQEID+TQY SFWM+ L + GY S+FHR   K+HG+AI W++ LF  +D
Sbjct: 128 EFKHYNADVLCLQEIDYTQYYSFWMNRLSNLGYGSRFHRMDNKSHGVAIFWKKDLFIWMD 187

Query: 202 ETLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFG 261
           + LI+FD E SGEIE R TT NVG+I+AL ++D++K+ +PG+ +SGI+VGTSHLFWHPFG
Sbjct: 188 QMLINFDNEDSGEIEPRKTTNNVGMILALGFSDKVKQSFPGTVKSGIIVGTSHLFWHPFG 247

Query: 262 TYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKP 321
           TYER RQCY+IL++MK F+ R+ L +       ++W+PFFCGDFNSQPFDAPYLS+ SKP
Sbjct: 248 TYERTRQCYVILNKMKEFIHRVHLSQNEHHTDLTKWYPFFCGDFNSQPFDAPYLSITSKP 307

Query: 322 IIYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQRA 381
           ++Y GRA+TVIECS +YKF  L  G     E+GG +   G  +P  PVP+SF  T E  +
Sbjct: 308 VLYSGRAKTVIECSAAYKFPDLGAGARGANEDGGTV---GEDRPVDPVPESFQPTAEVSS 364

Query: 382 LVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMYV 441
           LV  M+ LHN+LDMRAISLY++AY++VHP+NAG+DN RGEPEISNWA+ WRGLLDYIMY+
Sbjct: 365 LVQKMEKLHNSLDMRAISLYAVAYKHVHPDNAGLDNERGEPEISNWAYTWRGLLDYIMYI 424

Query: 442 MPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCELE 501
            PW  S+N EVD +  F+K + + V+ +LR+PPA EM SHGQPH+GEYPSDHL++MC+LE
Sbjct: 425 TPWQASNNVEVDSLESFEKLSHITVQEMLRMPPAKEMSSHGQPHDGEYPSDHLAMMCKLE 484

Query: 502 LLM 504
           + M
Sbjct: 485 VEM 487

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/423 (61%), Positives = 329/423 (77%), Gaps = 4/423 (0%)

Query: 84  DVGFIKRPLL-VCNGDEAKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142
           ++ FIKRP+L +  G+  +GF F++MTYNCLAQALIRRKLFPTSG+ALKW++RSKVLL+E
Sbjct: 74  ELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNE 133

Query: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202
            +YYN DVICLQEID+ QY+SFW D L   GY S+FHR   KNHG+AIVW+R  F   D+
Sbjct: 134 FKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDK 193

Query: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGT 262
            LIDFD E SG+I  RTTT N GLI++L+++D++ + +    ++GI+VGT+HLFWHPFGT
Sbjct: 194 MLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQEH-NLKKTGIIVGTTHLFWHPFGT 252

Query: 263 YERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPI 322
           +ER RQCY++L+++K F  R+ +L+ G+ G  S W+PFFCGDFNSQPFD+PYLSM  KPI
Sbjct: 253 FERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPI 312

Query: 323 IYEGRARTVIECSTSYKFSSLRDGCAADEEEGG--NIEKFGAGQPETPVPDSFDGTPEQR 380
            Y  RA+TVIECSTSY FS +RDG   D EE    NIEKFG  QP+ PVP  ++    +R
Sbjct: 313 EYSKRAKTVIECSTSYTFSKMRDGEEDDAEEEEGGNIEKFGTDQPDHPVPQHYEAKDHER 372

Query: 381 ALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMY 440
            LV+ MQSLHN+LDMRA+SLYS+AYR VHPENAG+DN RGEPEISNWAH WRGLLDY+ +
Sbjct: 373 ELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFF 432

Query: 441 VMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCEL 500
           +  WDFSD  E+D +  F++  S+ +R LLRVPP  EM  HGQPH GEYPSDHL ++CEL
Sbjct: 433 IRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCEL 492

Query: 501 ELL 503
           EL+
Sbjct: 493 ELV 495

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/424 (60%), Positives = 322/424 (75%), Gaps = 3/424 (0%)

Query: 84  DVGFIKRPLLVCNGDE-AKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142
           ++ FIKRP+L  + DE   GF F +MTYNCLAQALIRRKLFP SG A+KWF+RSKVLL E
Sbjct: 80  ELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLYE 139

Query: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202
            Q+YN DVICLQEIDH QY++FW    +  GY S+FHR   KNHG+AIVW+R +F   D 
Sbjct: 140 FQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAIVWKREMFKMTDR 199

Query: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQS-GIVVGTSHLFWHPFG 261
            LIDFD+E S +I  RT T N GLI++L+++D+I    P + ++ GI++GT+HLFWHPFG
Sbjct: 200 MLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNTKTTGIIIGTTHLFWHPFG 259

Query: 262 TYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKP 321
           TYER RQCY++L++MK F+ R+ +L+ G+ G  S W PFFCGDFNSQPFD+PYLSM SKP
Sbjct: 260 TYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQPFDSPYLSMTSKP 319

Query: 322 IIYEGRARTVIECSTSYKFSSLRDGCA-ADEEEGGNIEKFGAGQPETPVPDSFDGTPEQR 380
           I Y  RA+TVI+CSTSYKFS LR+G    D+EEGGNIEKFG  QP+TPVP++F    EQ 
Sbjct: 320 IEYTERAKTVIQCSTSYKFSKLRNGEEDVDDEEGGNIEKFGKDQPQTPVPETFIANEEQT 379

Query: 381 ALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMY 440
           ALV+ M  +HN L MRA SLYS+ Y++VH ENAGIDN RGEP ISNWA+ WRGLLDYI +
Sbjct: 380 ALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNWANTWRGLLDYIFH 439

Query: 441 VMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCEL 500
           V  WDF +   VD + +F+   S+ +R  LR+P  SEMP HGQPHEGEY SDHLS++C +
Sbjct: 440 VNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHEGEYASDHLSMICNI 499

Query: 501 ELLM 504
           ELL+
Sbjct: 500 ELLL 503

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/426 (60%), Positives = 325/426 (76%), Gaps = 5/426 (1%)

Query: 84  DVGFIKRPLLVCNGDE-AKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142
           ++ FI+RP L  +  E   GF F++MTYNCLAQALIRRKLFP SG+ALKW++RSKVLL+E
Sbjct: 90  ELHFIRRPFLSLHEAEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDALKWYRRSKVLLNE 149

Query: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202
            +YYN DVICLQEIDH Q++SFW D     GY  +++R+  KNHG+AI+WRR LF++VD+
Sbjct: 150 FKYYNSDVICLQEIDHIQFQSFWKDEFSKLGYDGQYYRNATKNHGVAIMWRRELFHQVDK 209

Query: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRY--PGSAQSGIVVGTSHLFWHPF 260
            LID+D+E S  I  RTTT NVGL++AL++++++        S + GI++GT+HLFWHPF
Sbjct: 210 MLIDYDKESSESISTRTTTNNVGLVLALKFSEKVLSNLGKKSSKKCGILIGTTHLFWHPF 269

Query: 261 GTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSK 320
           GTYER RQCYI+L +MK F+ R+ +L+  + G  S W PFFCGDFNSQPFD PYLSM SK
Sbjct: 270 GTYERTRQCYIVLKKMKEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSK 329

Query: 321 PIIYEGRARTVIECSTSYKFSSLRDG-CAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQ 379
           P+ Y  RA+TVI CSTSYKFS +RDG   AD+EEGGNIEK+G  QPE+PVP+ F    EQ
Sbjct: 330 PVHYRNRAKTVIGCSTSYKFSKVRDGEEGADDEEGGNIEKYGKDQPESPVPEKFHANEEQ 389

Query: 380 RALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIM 439
             LVD M  LHN+LDMRAISLYS+ Y+ VHPENAG+DN+RGEPEISNWA+ WRGLLDY+ 
Sbjct: 390 SELVDKMAQLHNSLDMRAISLYSVGYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLF 449

Query: 440 YVMPWDFSDN-TEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMC 498
           YV  WD   N  EV+ +G+F+K   V  R  LR+PP +EM  HGQPH GEY SDHLS++C
Sbjct: 450 YVKKWDPQSNCQEVETLGDFEKENKVKCRGFLRMPPGNEMTKHGQPHVGEYASDHLSMVC 509

Query: 499 ELELLM 504
           +LEL +
Sbjct: 510 DLELQL 515

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/425 (62%), Positives = 328/425 (77%), Gaps = 5/425 (1%)

Query: 84  DVGFIKRPLLVCNGDE-AKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142
           D+ FI+RP+L  + +E   GF   +MTYNCLAQALIRRKLFP SG+ALKWFKRSKVL +E
Sbjct: 132 DLQFIQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGDALKWFKRSKVLSNE 191

Query: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202
            ++YNPDVICLQEIDH QY+SFW    +  GY S+FHR   KNHG+AI+WR+ LF   D+
Sbjct: 192 FKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNHGVAIIWRKELFTLTDK 251

Query: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYP-GSAQSGIVVGTSHLFWHPFG 261
            LIDFD+E SGEI  RTTT N GL ++L++T++   ++  G+++ GI+VGT+HLFWHPFG
Sbjct: 252 MLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTHLFWHPFG 311

Query: 262 TYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKP 321
           TYER RQCY++L++MK F+ R+ +L+  + G  S W+PFFCGDFNSQPFD PYLSM SKP
Sbjct: 312 TYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPFDTPYLSMTSKP 371

Query: 322 IIYEGRARTVIECSTSYKFSSLR-DGCAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQR 380
           I Y+GRA+TVIECSTSYKFS  R     ADEEEGGNIEKFG  QP+TPVPD F    EQ+
Sbjct: 372 IHYKGRAKTVIECSTSYKFSKKRDGEEDADEEEGGNIEKFGKDQPQTPVPDHFIANEEQK 431

Query: 381 ALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMY 440
            LV  M+ LHN+LDMRAISLY + YR VHPENAG+DN+ GEPEISNWAH W GLLDYI++
Sbjct: 432 KLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDCGEPEISNWAHTWNGLLDYILF 491

Query: 441 VMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPS--HGQPHEGEYPSDHLSLMC 498
           +  W F D   VD + +F+K  S+ VR  LR+PP++EM    HGQPH GEYPSDHLS++C
Sbjct: 492 IKHWGFDDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPHTGEYPSDHLSMIC 551

Query: 499 ELELL 503
           ELEL+
Sbjct: 552 ELELI 556

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/424 (59%), Positives = 328/424 (77%), Gaps = 2/424 (0%)

Query: 83  EDVGFIKRPLLVCNGDE-AKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLS 141
           +++ FIKRP+L  + +E  KGF F +MTYNCLAQALIRRKLFP  G+ALKW +RSKVLL+
Sbjct: 97  KELQFIKRPILQMHENEPVKGFKFSLMTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLN 156

Query: 142 ELQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVD 201
           E ++YNPD+ICLQEIDH QY+SFW +     GY  +F++   KNHG+++VW++ LF   D
Sbjct: 157 EFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTD 216

Query: 202 ETLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSA-QSGIVVGTSHLFWHPF 260
             L+D+D+E SG+IE RTTT N+ L+++L+++ ++  R+P +  ++GI++GT+HLFWHPF
Sbjct: 217 RMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPF 276

Query: 261 GTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSK 320
           GTYER RQCYIIL++MK F+ R+ +L+       S W+PFFCGDFNSQPFD+PYLSM SK
Sbjct: 277 GTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSK 336

Query: 321 PIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQR 380
           PI Y GR++TVIECSTS+KFS  RDG   D+EEGGNIEKFG  QP+ PVPD +    EQ+
Sbjct: 337 PIKYSGRSKTVIECSTSFKFSKKRDGEEGDDEEGGNIEKFGKDQPQHPVPDDYQANDEQK 396

Query: 381 ALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMY 440
            LV  MQ LHN+LDMRAISLYS  Y  VHPEN+GIDN R EPEISNWAH WRGLLDY+ Y
Sbjct: 397 LLVTKMQELHNSLDMRAISLYSAGYSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFY 456

Query: 441 VMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCEL 500
           +  WDF+ N E+D + +F++   + +R  LR+PPA E+PSHGQP EGEYPSDHL ++CE+
Sbjct: 457 IKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEV 516

Query: 501 ELLM 504
           EL +
Sbjct: 517 ELCL 520

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/424 (60%), Positives = 326/424 (76%), Gaps = 5/424 (1%)

Query: 84  DVGFIKRPLLVCNGDE-AKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142
           ++ FIKRP LV +  E   GF F++MTYNCLAQALIRRKLFP SG+ALKW++RS+VLL+E
Sbjct: 90  ELHFIKRPFLVLHEKEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNE 149

Query: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202
            +YY  DVICLQEIDH Q++SFW D     GY  +++R+  KNHG+AI+WRR +F +VD+
Sbjct: 150 FKYYKADVICLQEIDHIQFQSFWKDEFNKLGYDGQYYRNSTKNHGVAIMWRREMFQQVDK 209

Query: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEI--KRRYPGSAQSGIVVGTSHLFWHPF 260
            LID+D+E S  I  RTTT NVGL++AL++++++        S + GI++GT+HLFWHPF
Sbjct: 210 MLIDYDKETSENISTRTTTNNVGLVLALKFSEKVLSNLSKSSSKKCGILIGTTHLFWHPF 269

Query: 261 GTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSK 320
           GTYER RQCY++L +MK F+ R+ +L+  + G  S W PFFCGDFNSQPFD PYLSM SK
Sbjct: 270 GTYERTRQCYVVLKKMKEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSK 329

Query: 321 PIIYEGRARTVIECSTSYKFSSLRDGC-AADEEEGGNIEKFGAGQPETPVPDSFDGTPEQ 379
           P+ Y+ RA+TVIECSTS+KFS  RDG  +AD+EEGGNIEK+G  QPE+PVP+++    EQ
Sbjct: 330 PVHYKNRAKTVIECSTSFKFSKARDGDESADDEEGGNIEKYGKDQPESPVPENYHANEEQ 389

Query: 380 RALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIM 439
             LVD M  LHN+LDMRAISLYS+ YR VHPENAG+DN+RGEPEISNWA+ WRGLLDY+ 
Sbjct: 390 IELVDKMAQLHNSLDMRAISLYSVGYRNVHPENAGLDNDRGEPEISNWANTWRGLLDYLF 449

Query: 440 YVMPWDFSDN-TEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMC 498
           YV  WD   N  EV+++G+F+K   +  R  LR+PP  EM  HGQPH GEY SDHLS++C
Sbjct: 450 YVKKWDLRSNCQEVENLGDFEKVNEMKCRGFLRMPPGKEMTKHGQPHVGEYASDHLSMVC 509

Query: 499 ELEL 502
           +LEL
Sbjct: 510 DLEL 513

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/425 (59%), Positives = 328/425 (77%), Gaps = 6/425 (1%)

Query: 84  DVGFIKRPLLVCNGDEA-KGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142
           ++ FI+RPLL  + DE  K F F +MTYNCLAQALIRRKLFP SG A+KW++RS+VLL+E
Sbjct: 103 ELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAVKWYRRSRVLLNE 162

Query: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202
            +YYNPD+ICLQEIDH Q++SFW +  +  GY S+FHR   KNHG+AIVW+ +LF   D 
Sbjct: 163 FKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAIVWKNNLFRLTDR 222

Query: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYP---GSAQSGIVVGTSHLFWHP 259
            LIDFD+E SG+I  RT T N GLI++L+Y+D +  +YP    + +SGI++GT+HLFWHP
Sbjct: 223 MLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIGTTHLFWHP 282

Query: 260 FGTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCS 319
           FGTYER RQC+++L+++K F KR+ +L+  + G    W  FFCGDFNSQPFD PYLS+ S
Sbjct: 283 FGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFDTPYLSITS 342

Query: 320 KPIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGG--NIEKFGAGQPETPVPDSFDGTP 377
           KP+ Y+ RA+ VIECSTSY +S LR+G   + E+    NIEKFG  QP+TPVPDS+  TP
Sbjct: 343 KPVEYKERAKIVIECSTSYTYSKLRNGDDDEAEDEEGGNIEKFGKDQPQTPVPDSYTPTP 402

Query: 378 EQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDY 437
           EQ  LV  M+SLHN+L+M+A SLY++ Y+ VHPEN+G+DN +GEPEISNWAH+WRGLLDY
Sbjct: 403 EQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEISNWAHSWRGLLDY 462

Query: 438 IMYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLM 497
           I YV  WDFSD  EV+D  +F+K   + +R  LR+PPA+EM  +GQPH+GEYPSDHLS+M
Sbjct: 463 IFYVDHWDFSDCKEVEDFEKFEKKNHMKLRGYLRMPPATEMSKYGQPHQGEYPSDHLSMM 522

Query: 498 CELEL 502
           C++EL
Sbjct: 523 CKIEL 527

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/423 (58%), Positives = 325/423 (76%), Gaps = 4/423 (0%)

Query: 84  DVGFIKRPLLVCNGDE-AKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142
           ++ FI+R +L  + +E  +G   ++M+YNCLAQALIRRKLFP SG ALKW++RS+VLL+E
Sbjct: 70  ELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEALKWYRRSRVLLNE 129

Query: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202
            ++Y+PDV+CLQEID+ QY+SFW +  Q  GY S+FHR   KNHG+ I+W+   F   D 
Sbjct: 130 FKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVCIIWKHEKFEMSDR 189

Query: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKR--RYPGSAQSGIVVGTSHLFWHPF 260
            LIDFD E+SG+IE RTTT N  LI+AL++T ++K   +     +SGI+VGT+HLFWHPF
Sbjct: 190 MLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGILVGTTHLFWHPF 249

Query: 261 GTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSK 320
           GTYER RQCY++L++MK F+ R+ +L+  + G  S W+PFFCGDFNSQPFD+PYLSM  K
Sbjct: 250 GTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFDSPYLSMTCK 309

Query: 321 PIIYEGRARTVIECSTSYKFSSLRD-GCAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQ 379
           PI Y+ RA+TVIECSTS+KFS  R+ G  A++EEGGNIEKFG  QP+TPVP+ F    EQ
Sbjct: 310 PIKYDSRAKTVIECSTSFKFSKKRESGEDAEDEEGGNIEKFGKDQPQTPVPEKFVANDEQ 369

Query: 380 RALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIM 439
             LV  M+ LHN+LDMRA+SLYS+AY  VHPEN+G+DN RGEPEISNWAH WRGLLDY+ 
Sbjct: 370 TKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEISNWAHTWRGLLDYMF 429

Query: 440 YVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCE 499
            +  W+F D TE+D + +F+ + ++ +R LLR+PP SEM +HGQPH GEYPSDHL L+ E
Sbjct: 430 MIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQPHVGEYPSDHLCLLSE 489

Query: 500 LEL 502
           +EL
Sbjct: 490 VEL 492

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/424 (59%), Positives = 327/424 (77%), Gaps = 4/424 (0%)

Query: 84  DVGFIKRPLLVCNGDE-AKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142
           ++ FIKRP+L  + +E  +GF F MMTYNCLAQALIRRKLFP SG+ALKW++RSKVLL+E
Sbjct: 145 ELQFIKRPILYLHEEEPVQGFKFSMMTYNCLAQALIRRKLFPDSGDALKWYRRSKVLLNE 204

Query: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202
             YY+PD+ICLQE+DH QY+SFW    +  GY S++HR   KNHG++I+WRRSLF   D+
Sbjct: 205 FTYYSPDIICLQEVDHIQYQSFWKTEFEKLGYQSQYHRKGVKNHGVSIIWRRSLFTMTDK 264

Query: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPG--SAQSGIVVGTSHLFWHPF 260
            LI+FD+E SG +  RTTT NVGLI++L++T E K ++    + ++GI++GT+HLFWHPF
Sbjct: 265 MLIEFDKESSGNVPPRTTTNNVGLILSLKFTPEAKAQFKNVETTKTGIIIGTTHLFWHPF 324

Query: 261 GTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSK 320
           GTYER RQCY++L++MK F+ R+ +L+  +    S W+PFFCGDFNSQPFD+PYLSM  K
Sbjct: 325 GTYERTRQCYVVLNKMKEFMHRVNVLQNNNDRDLSHWYPFFCGDFNSQPFDSPYLSMVRK 384

Query: 321 PIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGG-NIEKFGAGQPETPVPDSFDGTPEQ 379
           P+ Y GRA+TVIECSTSYKFS  RDG    ++E G NIEKFG  QP+TPVP+ F    EQ
Sbjct: 385 PVEYSGRAKTVIECSTSYKFSKKRDGEEDVDDEEGGNIEKFGIDQPQTPVPEEFIANGEQ 444

Query: 380 RALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIM 439
             LV  M+ LHN+L+MRAISLY + Y+ VHPENA IDN  GEPEISNWAH W GLLDY++
Sbjct: 445 TILVKDMEKLHNSLNMRAISLYGVGYKNVHPENASIDNECGEPEISNWAHTWNGLLDYLL 504

Query: 440 YVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCE 499
           +V  W FSD T+ + + +F+++ S+ +R  LR+PPA+EM  HGQPH GEYPSDHLS++C 
Sbjct: 505 FVKEWTFSDCTKTETLKQFEESNSMRIRGFLRMPPANEMTKHGQPHVGEYPSDHLSMLCS 564

Query: 500 LELL 503
           +ELL
Sbjct: 565 IELL 568

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/426 (60%), Positives = 320/426 (75%), Gaps = 5/426 (1%)

Query: 84  DVGFIKRPLLVCNGDEAKGFV-----FRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKV 138
           D+ FIKRP+L    D +           +MTYNCLAQALIRR LFPTSGNA+KWFKRS+V
Sbjct: 91  DLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQV 150

Query: 139 LLSELQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFN 198
           LL+E +YYN DV+CLQEID  QYKSFW       GY  +FH +  KNHG+ I W+  LF+
Sbjct: 151 LLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFD 210

Query: 199 KVDETLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWH 258
             D+ LID+D+E +G IE RTTTKNVG++++L++  ++  +YP +  SGI++GT+HLFWH
Sbjct: 211 MTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWH 270

Query: 259 PFGTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMC 318
           PFGTYER RQCYI+L ++K F  R+ +L+    G  S W  FFCGDFNSQPFDAPYLS+ 
Sbjct: 271 PFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSIT 330

Query: 319 SKPIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKFGAGQPETPVPDSFDGTPE 378
           SKP+ Y GRA+TVIECSTS+ FS LRDG   + EEGGNIEKFG GQPETPVP+SF G  E
Sbjct: 331 SKPVEYTGRAKTVIECSTSFTFSKLRDGDEGEGEEGGNIEKFGKGQPETPVPESFSGNEE 390

Query: 379 QRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYI 438
           Q+ L + M++LHN +DMRAISLYS+AY  VHPEN+G+DN R EPEISNWAHAWRGLLDY+
Sbjct: 391 QKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYL 450

Query: 439 MYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMC 498
            YV  WD  D T++D++  F++N  V V  LLR+PPA EM  HGQPHEGEYPSDHL ++ 
Sbjct: 451 YYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIV 510

Query: 499 ELELLM 504
           +L ++M
Sbjct: 511 KLGIIM 516

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/426 (60%), Positives = 326/426 (76%), Gaps = 5/426 (1%)

Query: 84  DVGFIKRPLLVCNGDE-AKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142
           ++ FIKRP L  + +E   GF F++MTYNCLAQALIRRKLFP SG+ALKW++RS+VLL+E
Sbjct: 90  ELHFIKRPFLSLHEEEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNE 149

Query: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202
            ++YN DVICLQEIDH Q++SFW +     GY  ++HR+  KNHG+AI+WRR +F +VD+
Sbjct: 150 FRHYNADVICLQEIDHIQFQSFWKEEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDK 209

Query: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRY--PGSAQSGIVVGTSHLFWHPF 260
            LIDFD+E SG I  RTTT NVGL++AL++++++        S +SGI++GTSHLFWHPF
Sbjct: 210 MLIDFDKEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPF 269

Query: 261 GTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSK 320
           GTYER RQCYI+L +M+ F+ R+ +L+  + G  S W PFFCGDFNSQPFD PYLSM  K
Sbjct: 270 GTYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCK 329

Query: 321 PIIYEGRARTVIECSTSYKFSSLR-DGCAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQ 379
           P+ YE RA+TVIECSTS+KFS +R     ADEEEGGNIEKFG  QPE+PVP  F    EQ
Sbjct: 330 PVHYEKRAKTVIECSTSFKFSKVRDGEEGADEEEGGNIEKFGKDQPESPVPKDFHANEEQ 389

Query: 380 RALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIM 439
             LVD M  LHN+LDMRA+SLYS+AY+ VHPENAG+DN+RGEPEISNWA+ WRGLLDY+ 
Sbjct: 390 IELVDEMAQLHNSLDMRAVSLYSVAYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLF 449

Query: 440 YVMPWDFSDN-TEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMC 498
           Y+  WD   N  EVD + +F+K+  +  R  LR+PP SEM  HGQPH GEY SDHLS++C
Sbjct: 450 YIKKWDLRSNCQEVDSLDDFEKDNEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVC 509

Query: 499 ELELLM 504
           ++EL +
Sbjct: 510 DIELQL 515

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/423 (58%), Positives = 319/423 (75%), Gaps = 4/423 (0%)

Query: 84  DVGFIKRPLLVCNGDEAK-GFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142
           ++ FI+RPLL  +  E+  GF F++MTYNCLAQALIRRKLFP SG A+KWF+RSKVLL+E
Sbjct: 87  ELQFIRRPLLALSKAESTAGFEFKIMTYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLNE 146

Query: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202
            +YY+ DVICLQE+D  Q+++FW +     GY S+FH    KNHGI+I+W+RSLF   D+
Sbjct: 147 FKYYDSDVICLQEVDRIQFQTFWKEEFDKLGYDSQFHAKPSKNHGISILWKRSLFTMTDK 206

Query: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGT 262
            LID+D+E SG I  RTTT NVGL++AL+++ ++  R+P + +SGI+VGT+HLFWHPFGT
Sbjct: 207 MLIDYDKEISGNIPPRTTTNNVGLVLALKFSPKVLERFPNTRKSGIIVGTTHLFWHPFGT 266

Query: 263 YERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPI 322
           YER RQCYI+L++ K F+ R+ +L+  +      W+ FF GDFNSQPFD PYLSM SKP+
Sbjct: 267 YERTRQCYIVLNKTKEFMHRVNVLQNNNDEIKDHWYTFFGGDFNSQPFDTPYLSMTSKPV 326

Query: 323 IYEGRARTVIECSTSYKFSSLR-DGCAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQRA 381
            Y  RA+TVIECSTSY FS  R     A++EEGGNIEKFG  QP TPVP  FD + EQ++
Sbjct: 327 KYSNRAKTVIECSTSYTFSKSRDGEEDAEDEEGGNIEKFGKDQPATPVPSFFDASSEQQS 386

Query: 382 LVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMYV 441
           LV  M+ LHN+LDMRAISLYS+ Y  VH ENAG+DN RGEPEISNWAHAW GLLDY+  +
Sbjct: 387 LVANMEKLHNSLDMRAISLYSVGYGTVHIENAGLDNTRGEPEISNWAHAWNGLLDYLFVI 446

Query: 442 MPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPS--HGQPHEGEYPSDHLSLMCE 499
             WDFSD  +VD + +F+    + V++ L++P  +EM    HGQPH GEYPSDHLS++C+
Sbjct: 447 KSWDFSDKIQVDSLKKFEDENELKVKAFLKMPTKAEMGKFGHGQPHVGEYPSDHLSMICK 506

Query: 500 LEL 502
           LEL
Sbjct: 507 LEL 509

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  518 bits (1335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/431 (58%), Positives = 320/431 (74%), Gaps = 10/431 (2%)

Query: 84  DVGFIKRPLLVCNGDEAKG-----FVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKV 138
           ++ FI+RP+L  + D A G         +MTYNCLAQALIRRKLFP SG ALKW++RS+V
Sbjct: 52  ELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPALKWYRRSQV 111

Query: 139 LLSELQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFN 198
           LL++ ++Y PDV+CLQE+D  Q+ SFW    +  GY ++FH+   KNHG+A+VWR  LF 
Sbjct: 112 LLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVAVVWRSKLFT 171

Query: 199 KVDETLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWH 258
             D+ LIDFD+EQSG++  RTTT N GL++AL++T++    +  + +SGI+VGT+HLFWH
Sbjct: 172 MADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWH 231

Query: 259 PFGTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMC 318
           PFGT+ER RQCY++L++MK F+ R+ +L+  + G    W PFFCGDFNSQP+DAPYLSM 
Sbjct: 232 PFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQPYDAPYLSMT 291

Query: 319 SKPIIYEGRARTVIECSTSYKFSSLR---DGCAADEEEGGNIEKFGAGQPETPVPDSFDG 375
           SKP+ Y GRARTVIECSTSY FS  R   D  A +EEEGGNIE FG  QP  PVP +F+ 
Sbjct: 292 SKPVSYSGRARTVIECSTSYTFSKQRDGEDAAADEEEEGGNIEIFGKDQPHHPVPATFEP 351

Query: 376 TPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLL 435
             EQ ALV  M++LHN+LDMRA+SLYS+ YR VHPENAG DN RGEPEISNWAH W GLL
Sbjct: 352 NAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEISNWAHTWNGLL 411

Query: 436 DYIMYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMP--SHGQPHEGEYPSDH 493
           DY+ YV  WDF D T VD + EF++++ V V+ LLR+P   EM    HGQPH GEYPSDH
Sbjct: 412 DYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQPHTGEYPSDH 471

Query: 494 LSLMCELELLM 504
           L+++C+LEL +
Sbjct: 472 LAMVCDLELAL 482

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score =  453 bits (1166), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 216/433 (49%), Positives = 299/433 (69%), Gaps = 19/433 (4%)

Query: 84  DVGFIKRPLLVC---NGDEAKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLL 140
           ++ FIKRP+L          KGF F +MTYNCLAQA+IRR++F  SG ALKWF+RSKVL+
Sbjct: 49  ELSFIKRPILYLPHHGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPALKWFRRSKVLM 108

Query: 141 SELQYYNPDVICLQEIDHTQYKSFWMDALQ-HAGYCSKFHRSFGKNHGIAIVWRRSLFNK 199
           +E+ YYNPD++CLQEID  QY++FW D L+ +    + +++   K+HG+ I W++S+F +
Sbjct: 109 NEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGVLIAWKKSIFKQ 168

Query: 200 VDETLIDFDEEQSGEIERRTTTKNVGLIVALEYTDE-IKRRYPGSAQS------GIVVGT 252
           VD  ++DFD+ ++  I RRT T+N+ + VAL++ DE I + +P    S      G ++ T
Sbjct: 169 VDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQNDIGFIIST 228

Query: 253 SHLFWHPFGTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDA 312
           +HLFWHPFGT+ER RQCYI+L +MK F+  L + +       + W+PF CGDFNS P DA
Sbjct: 229 THLFWHPFGTFERTRQCYILLEKMKKFIDILNVKDH----LKTHWYPFICGDFNSTPRDA 284

Query: 313 PYLSMCSKPIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKFGAGQPETPVPDS 372
           PYLSM SKPI Y GR + VIECST+YKFS  R+G   D +E    EK    QP+  VPDS
Sbjct: 285 PYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNGEIGDSDEEE--EKKLINQPKDMVPDS 342

Query: 373 FDGTPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWR 432
           F  T EQ  LV  +QSLHN L +RA SLY LAY+ V P N  I+N+RGEPE ++WA +W 
Sbjct: 343 FTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDPSNVNINNDRGEPEFTSWAKSWH 402

Query: 433 GLLDYIMYVMPWDFSD-NTEV-DDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYP 490
           G+LDYIMYV  WD ++  +E+ + + EF+KN  ++++ LL++P   +MP H QP E EYP
Sbjct: 403 GVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKGLLKMPLNKDMPFHTQPFEREYP 462

Query: 491 SDHLSLMCELELL 503
           SDH+S++CE+E+L
Sbjct: 463 SDHISILCEMEIL 475

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  432 bits (1111), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 210/440 (47%), Positives = 287/440 (65%), Gaps = 31/440 (7%)

Query: 84  DVGFIKRPLLVCNGDE-AKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142
           ++ FIKRPLL  + D+  KG + ++MTYNCLAQ+LI+R LFP SG ALKW +RSKVLL+E
Sbjct: 69  ELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVRRSKVLLNE 128

Query: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202
           L+YY+ D++ LQEID  Q+K +W   L   GY  +F++  GK HG+ I W+R+LF KV  
Sbjct: 129 LKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKRNLFAKVKS 188

Query: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGT 262
             IDFDE  SG I+ RT TKNVGL++ALE+ ++ K       + G+++GT+HLFWH FGT
Sbjct: 189 LPIDFDETLSGTIKPRTRTKNVGLVIALEFLNKDK---SAIKKKGVIIGTTHLFWHLFGT 245

Query: 263 YERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPI 322
           +ER RQCY+++ +M  F+K+L        G   +W+PFF GDFNSQP DAPY+S+ SKP+
Sbjct: 246 FERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQPKDAPYVSITSKPV 297

Query: 323 IYEGRARTVIECSTSYKFSSLR------------------DGCAADEEEGGNIEKFGAGQ 364
            ++   + VIECS +YK+S  R                     ++D E     E+    Q
Sbjct: 298 SFQNETKIVIECSAAYKYSKKRNGEEEEKNEGKEKQHEIDSSDSSDAETDEEKEEIIPNQ 357

Query: 365 PETPVPDSFDGTPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEI 424
           P    P  F  T EQ  LV  + +LHN+L++RAISLYS+ YR V PENA I+N+RGEPE+
Sbjct: 358 PSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYINNDRGEPEL 417

Query: 425 SNWAHAWRGLLDYIMYVMPWDFSDNTE-VDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQ 483
           S WA  W GLLDYI ++  WD   N E VD +  F++  +V +R LL++P + EM  H  
Sbjct: 418 SEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQSKEMCEHAI 477

Query: 484 PHEGEYPSDHLSLMCELELL 503
           P++GEYPSDHL +M +LELL
Sbjct: 478 PYKGEYPSDHLCMMIQLELL 497

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  421 bits (1081), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 211/428 (49%), Positives = 272/428 (63%), Gaps = 15/428 (3%)

Query: 84  DVGFIKRPLLVCNGDEAKG----FVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVL 139
           ++ F +RP L  + +E         F ++TYNCLAQ LI R +FP SGNALKW +RSK +
Sbjct: 53  ELQFQRRPFLTLHDNEPDNGESKHEFSILTYNCLAQGLIMRDMFPESGNALKWTRRSKTM 112

Query: 140 LSELQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNK 199
           ++EL+YYNPD++CLQEID    K FW    +  GY  KF +   K HG+ I WR S+F  
Sbjct: 113 INELKYYNPDIMCLQEIDFKYVKEFWSVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKF 172

Query: 200 VDETLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHP 259
            D+  +DFDE  +G+I  RT T+N+GLIVAL++ D      P     GIVV T+HLFWHP
Sbjct: 173 YDQCQVDFDELLAGDIPPRTKTRNIGLIVALQFLDN-NNNNPSRESHGIVVATTHLFWHP 231

Query: 260 FGTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCS 319
           FGT+ER RQCY++LS M  FL  L           + W+PF  GDFNSQP DAPY+SM +
Sbjct: 232 FGTFERTRQCYLMLSEMNKFLSFL-----NEHSGITNWYPFLTGDFNSQPKDAPYMSMTT 286

Query: 320 KPIIYEGRARTVIECSTSYKFSSLRDGCAADEEE----GGNIEKFGAGQPETPVPDSFDG 375
           KPI Y    RTVIECSTSY +S  R+G     E+        E+F   QP  P P  F  
Sbjct: 287 KPIQYHDEMRTVIECSTSYTYSKKRNGDMDVNEKEQSDSEEDEEFIKKQPTDPRPAFFQP 346

Query: 376 TPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLL 435
           T EQ ALV+ +Q LHN+L  RAISLYS+ YR VHPEN+ I+N RGEPE S+W   W GLL
Sbjct: 347 TKEQAALVNTIQQLHNSLPFRAISLYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLL 406

Query: 436 DYIMYVMPWDFSD-NTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHL 494
           DYI Y+  W+  D N +V+ +  F+K  ++ +   L++P   EM  H QP+EGEYPSDHL
Sbjct: 407 DYIFYIKAWNLKDKNDDVETLETFEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHL 466

Query: 495 SLMCELEL 502
           +LMC+L+L
Sbjct: 467 ALMCKLQL 474

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score =  357 bits (917), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 180/438 (41%), Positives = 263/438 (60%), Gaps = 34/438 (7%)

Query: 84  DVGFIKRPLLVCNGDEAKGFV------------FRMMTYNCLAQALIRRKLFPTSGNALK 131
           D+ FI+RP L  N D +KG               ++MTYN LAQ LIRR  FP SG ALK
Sbjct: 76  DLQFIERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLAQTLIRRDFFPESGPALK 135

Query: 132 WFKRSKVLLSELQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIV 191
           W KRSKVL+ EL+ Y PDV+ LQE+D+ +  +FW +     G+   F R  GK HG+ + 
Sbjct: 136 WHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVIFKRHEGKTHGLLVA 194

Query: 192 WRRSLFNKVDETLIDFDEEQSGE-IERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVV 250
           W    F   ++ ++D+D   +G  I  RT TKN+ LI++L +     +    S+  GI+V
Sbjct: 195 WNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYF-----KGITDSSSRGIIV 249

Query: 251 GTSHLFWHPFGTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPF 310
             +HLFWHPFG +ER RQ Y++L +++         E  +C   + WH    GDFN++P 
Sbjct: 250 ANTHLFWHPFGVFERLRQSYLVLQKIQ---------EIKACSKYNGWHSLLMGDFNTEPE 300

Query: 311 DAPYLSMCSKPIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKF-GAG---QPE 366
           + PYL++  +P+I +G  R ++ECS +Y++S  R+G  +D+++    EK  G G   QP+
Sbjct: 301 EPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGEESDQDDEECDEKSRGEGHSDQPQ 360

Query: 367 TPVPDSFDGTPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISN 426
            P P+SF  T E++ALV+ + +LHN+L ++ +SLY + Y  VHPENA  + + GEP +SN
Sbjct: 361 NPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPENA--NGSHGEPGLSN 418

Query: 427 WAHAWRGLLDYIMYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHE 486
           WA+ W GLLDYI Y+      D  + + +  F+ N +V +   LR+P A EMP H QP E
Sbjct: 419 WANTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFE 478

Query: 487 GEYPSDHLSLMCELELLM 504
           GEY SDH+SLMC++ L  
Sbjct: 479 GEYASDHISLMCQIRLFF 496

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  356 bits (914), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 183/436 (41%), Positives = 275/436 (63%), Gaps = 32/436 (7%)

Query: 87  FIKRPLL-VCNGDEAKGFV-FRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSELQ 144
           FIKR +L + N +E    V  ++MTYN L+Q+LIRR+++P + +A+KW  RSKV+L+E++
Sbjct: 53  FIKRAILQLPNVEELDNSVDLKIMTYNTLSQSLIRREIYPDAHDAIKWHVRSKVILNEIK 112

Query: 145 YYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSF--GKNHGIAIVWRRSLFNKVDE 202
           YYN D++C QE+D  Q+  FW+  L   GY  +F++ F   K HG+AI WR +LF + D 
Sbjct: 113 YYNCDIMCFQEVDVIQWDKFWLPELSKLGYEGEFYKDFRGPKVHGVAIFWRSNLFEQFDV 172

Query: 203 TLIDFDEEQSGE-IERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFG 261
             I+FD+  +G  I + T T NVGLIVAL++     +      +SGIV+GT+HLFWHPFG
Sbjct: 173 IKINFDDIVAGNAISKTTRTWNVGLIVALKF-----KSSNAKFRSGIVIGTTHLFWHPFG 227

Query: 262 TYERARQCYIILSRMKVFLKRLRLLERGSCG----AASQWHPFFCGDFNSQPFDAPYLSM 317
           T+ER RQ  I+L + +  +  L       CG     +++W P   GDFNSQP D PYLS+
Sbjct: 228 TFERTRQLAILLKKFRKLIDNL----NTECGHINEMSNRWLPILTGDFNSQPCDMPYLSI 283

Query: 318 CSKPIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKFGA-----------GQPE 366
            SKP+   G A+TVIECST+YKFS  R G     EE  + E+  +             P 
Sbjct: 284 TSKPVSASGEAKTVIECSTAYKFSRRRSGSINSSEEVDHNEETQSEKEVEEEEDEESNPI 343

Query: 367 TPVPDSFDGTPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISN 426
            P P  F+ T EQ+ L+  ++ +HN+++++A SL+ +AY+ VH  + G+ N + EPE+S+
Sbjct: 344 DPRPSHFEATSEQKDLIAKLEKVHNSINLKATSLFGIAYKKVH--SIGL-NCKNEPELSH 400

Query: 427 WAHAWRGLLDYIMYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHE 486
            +  W GLLDYI  + PW+  + T+   + +F+K  S+ V+ LL++P   E+P + QPH+
Sbjct: 401 TSIFWTGLLDYIFILEPWNEVEKTDWGSLEDFEKRMSLRVKGLLKMPEMKELPKNVQPHQ 460

Query: 487 GEYPSDHLSLMCELEL 502
           G+YPSDHLS++C+L +
Sbjct: 461 GQYPSDHLSMICDLNV 476

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  354 bits (908), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 184/438 (42%), Positives = 259/438 (59%), Gaps = 40/438 (9%)

Query: 84  DVGFIKRPLLVCNGDEAKGFV--------FRMMTYNCLAQALIRRKLFPTSGNALKWFKR 135
           D+ FIKRP L  + + A+G           ++MTYN LAQ LIRR  FP SG+ALKW KR
Sbjct: 78  DLQFIKRPFLHLHHEIAQGSTESTPNSLDVKIMTYNTLAQTLIRRNFFPQSGSALKWHKR 137

Query: 136 SKVLLSELQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRS 195
           SKVL+ EL+ Y PD++ LQE+D+ + K FW +  +  G+   F R  GK HG+ I W   
Sbjct: 138 SKVLVHELKTYKPDIVSLQEVDYNELK-FWQENFRKLGFDLTFKRHDGKTHGLLIAWNSG 196

Query: 196 LFNKVDETLIDFDEEQSGE-IERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSH 254
            F   +E ++D+D   +G  I  RT TKN+ LI +L       +     +  G++V  +H
Sbjct: 197 KFQLENEWMLDYDNILAGNAIPARTRTKNIALIASLRL-----KNISDPSTDGVIVANTH 251

Query: 255 LFWHPFGTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPY 314
           LFWHPFG +ER RQ Y++L++++         E  +C   + WH    GDFN++P + PY
Sbjct: 252 LFWHPFGVFERLRQSYLVLAKIQ---------EIKACPKYNGWHSVLMGDFNTEPEEPPY 302

Query: 315 LSMCSKPIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGG------NIEKFGAG---QP 365
           L++  KP+   G AR + ECS +Y++S  R+G     EEGG      + +  G G   QP
Sbjct: 303 LAITRKPVALTGSARVMAECSLAYRYSKKRNG-----EEGGQDDEECDEQSRGEGRFNQP 357

Query: 366 ETPVPDSFDGTPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEIS 425
           + P P SF  T EQ+ALVD + +LHN+L +R +SLY L Y  V PEN+   N  GEPE+S
Sbjct: 358 QNPKPKSFTATSEQKALVDQLVALHNSLHVRGVSLYGLGYGKVQPENSHESN--GEPELS 415

Query: 426 NWAHAWRGLLDYIMYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPH 485
           NWA++W GLLDYI Y+   D     + + + +F+   ++ V   L++P A EMP H QP 
Sbjct: 416 NWANSWCGLLDYIFYIEHSDEHSAHDQNPVDDFENKNNLRVMGYLKMPRAKEMPKHSQPF 475

Query: 486 EGEYPSDHLSLMCELELL 503
           EGEY SDH+SLMC+L  L
Sbjct: 476 EGEYASDHVSLMCQLRFL 493

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  353 bits (907), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 178/436 (40%), Positives = 259/436 (59%), Gaps = 33/436 (7%)

Query: 84  DVGFIKRPLL-----VCNGDEAKGFVF-------RMMTYNCLAQALIRRKLFPTSGNALK 131
           D+ FI+RP L     V    +  G          ++MTYN LAQ LIRR  FP SG+ALK
Sbjct: 78  DLQFIERPFLHVYREVSQDSKTSGMQVPPSSLDVQIMTYNTLAQTLIRRDFFPQSGSALK 137

Query: 132 WFKRSKVLLSELQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIV 191
           W KRSKVL+ EL+ Y PD++ LQE+D+ +   FW +     G+ S F R  GK HG+ + 
Sbjct: 138 WHKRSKVLVHELKTYKPDIVSLQEVDYNEL-GFWHENFHKLGFGSTFRRHEGKTHGLMVA 196

Query: 192 WRRSLFNKVDETLIDFDEEQSGE-IERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVV 250
           W    F + +E ++D+D   +G  I  RT TKN+ LIV+L       +     + SG++V
Sbjct: 197 WNNEKFQQDNEWMLDYDTILAGNAISARTRTKNIALIVSLSV-----KNMTNLSTSGVIV 251

Query: 251 GTSHLFWHPFGTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPF 310
             +HLFWHPFG +ER RQ +++L +++         E  +C     WH    GDFN++P 
Sbjct: 252 ANTHLFWHPFGVFERLRQSFLVLKKIE---------EIKTCPKYYGWHSLLMGDFNTEPE 302

Query: 311 DAPYLSMCSKPIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKFGAGQ---PET 367
           + PY+++  +P+   G AR + ECS +Y++S +R+G  +D++E  + E  G GQ   P+ 
Sbjct: 303 EPPYMAITRRPLTLTGSARAMTECSLAYRYSKMRNGEESDQDEECDEESTGEGQHDQPQN 362

Query: 368 PVPDSFDGTPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNW 427
           P P  F  T EQ+ LV+ + +LHN+L ++ ISLY L+Y  VHP+N+    N GEPE+SNW
Sbjct: 363 PKPKYFVATKEQKNLVNQLVALHNSLHVKGISLYGLSYGKVHPDNS--KENHGEPELSNW 420

Query: 428 AHAWRGLLDYIMYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEG 487
           A+ W GLLDYI Y+   D   +++ + +  F+   +V +   LR+P A EMP H QP EG
Sbjct: 421 ANTWCGLLDYIFYIERNDNVSSSKDEPVKNFEDQNNVKIIGYLRMPRAEEMPKHSQPFEG 480

Query: 488 EYPSDHLSLMCELELL 503
           EY SDH+SLMC+L L 
Sbjct: 481 EYASDHISLMCQLRLF 496

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  350 bits (898), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 180/438 (41%), Positives = 257/438 (58%), Gaps = 35/438 (7%)

Query: 84  DVGFIKRPLLVCN-----GDEAKGFV--------FRMMTYNCLAQALIRRKLFPTSGNAL 130
           D+ FI+RPLL  +      D    F+         ++MTYN LAQ LIRR  FP SG+AL
Sbjct: 76  DLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSAL 135

Query: 131 KWFKRSKVLLSELQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAI 190
           KW KRSKVL+ EL+ Y PD++ LQE+D+ + K FW +     G+   F R+ GK HG+ +
Sbjct: 136 KWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLSFRRNGGKTHGLLV 194

Query: 191 VWRRSLFNKVDETLIDFDEEQSGE-IERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIV 249
            W    F   +E ++D+D+  +G  I  RT TKN+ LIV+L + D        ++ +GIV
Sbjct: 195 AWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDT-----RNASTNGIV 249

Query: 250 VGTSHLFWHPFGTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQP 309
           V  +HLFWHPFG +ER RQ Y++L +++         E         WH    GDFN++P
Sbjct: 250 VANTHLFWHPFGVFERLRQSYLVLQKIQ---------EIKDFPKYHGWHSLLMGDFNTEP 300

Query: 310 FDAPYLSMCSKPIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIE----KFGAGQP 365
            + PYL++ SKP+   G  R ++ECS +Y++S  R+G  +D+++    E    +    QP
Sbjct: 301 EEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGEESDQDDEDYDENSRGERNLNQP 360

Query: 366 ETPVPDSFDGTPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEIS 425
           + P P  F  T E++ LV+ + +LHN+L ++ ISLY L Y  VHPENA  +   GEPE+S
Sbjct: 361 KNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPENA--NEGHGEPELS 418

Query: 426 NWAHAWRGLLDYIMYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPH 485
           NWA+ W GLLDYI Y+   D +   +   +  F++N  V V   LR+P   EMP H QP 
Sbjct: 419 NWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPF 478

Query: 486 EGEYPSDHLSLMCELELL 503
           EGEY SDH+SLMC++ L 
Sbjct: 479 EGEYASDHISLMCQIRLF 496

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  332 bits (852), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 175/433 (40%), Positives = 253/433 (58%), Gaps = 28/433 (6%)

Query: 87  FIKRPLL----VCNGDEAKGFV-FRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLS 141
           FIKRPLL    V       G+V  ++MTYN LAQ LIRR  FP + +A+KW +RS+VL+ 
Sbjct: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102

Query: 142 ELQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLF--NK 199
           EL+YY+ DV+CLQE D  Q+  FW++     GY   F    GK HG+AIVW+ S+F    
Sbjct: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162

Query: 200 VDETLIDFDEEQSG-EIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWH 258
           +D+  +  D+  +G +I   T T+ V L VAL        R        I+  T+HLFWH
Sbjct: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKHHKTSR-------PIIFSTTHLFWH 215

Query: 259 PFGTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMC 318
            FGT+ER RQ ++ILS +  F+K+   +    C    + + FF GDFNSQP DAPYLS+ 
Sbjct: 216 LFGTFERTRQLFVILSELNKFIKK---VTDAHCPRGQRCYTFFTGDFNSQPCDAPYLSLT 272

Query: 319 SKPIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKFG-------AGQPETPVPD 371
            KP+  +GRA+++IECS SY++S  R+    D+E+    E            +P+ P P 
Sbjct: 273 DKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRPQDPRPY 332

Query: 372 SFDGTPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNN--RGEPEISNWAH 429
           ++D  PEQ   V  +Q+LHN + ++ +SLY + Y  VHPEN+   +     EP++S+ A 
Sbjct: 333 TYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRAL 392

Query: 430 AWRGLLDYIMYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEY 489
            W GLLDYI  +  W   + T++ D+   ++ T + +   LR+P   EM  H +PHE EY
Sbjct: 393 HWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPHENEY 451

Query: 490 PSDHLSLMCELEL 502
           PSDHL++MC++ L
Sbjct: 452 PSDHLAMMCDISL 464

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  319 bits (817), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 177/431 (41%), Positives = 243/431 (56%), Gaps = 35/431 (8%)

Query: 87  FIKRP-LLVCNGDE-AKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSELQ 144
           FI+RP LLV +GD   +G    +MTYNCLAQ LIRR++FP SG ALKWF RSKVLL E++
Sbjct: 60  FIERPILLVPHGDNYERGLPLSIMTYNCLAQTLIRREMFPESGPALKWFVRSKVLLHEIK 119

Query: 145 YYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDETL 204
           +YN D+ CLQEID  QY  FW + L   GY + +     K+HG+ I W+  LF       
Sbjct: 120 HYNADICCLQEIDDVQYDLFWSEELPKFGYKTIYFHQDSKSHGVMIAWKEELFQLESHMN 179

Query: 205 IDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYP--GSAQSGIVVGTSHLFWHPFGT 262
           I+FD+E    I+ RT T NVGL+VAL +TD  + R     +++SG+++GT HLFWHPFGT
Sbjct: 180 IEFDKEAPAGIQPRTRTNNVGLLVALAFTDAFRARNNRIRTSRSGVIIGTFHLFWHPFGT 239

Query: 263 YERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPI 322
           Y+R RQC +I  ++  F   ++            +   F GDFNSQP   PYL +     
Sbjct: 240 YDRTRQCLVIKKKILEFAGTVK----------GDYCKMFTGDFNSQPNSVPYLVLTQPRA 289

Query: 323 IYEGRARTVIECSTSYKFSSLRD-----------GCAADEEEGGNIEKFGAGQPETPVPD 371
               + RT IE ST+Y++S  R+               +EE+       G     TP PD
Sbjct: 290 QLNTQQRTSIEASTAYRYSERRNLGKEYSMEEEEEEEEEEEKREYEYDQGTDPWNTPRPD 349

Query: 372 SFDGTPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAW 431
            FD T EQR LV+ +    N + + A SLYS+ Y  V P +     +  EPE+S+W+  W
Sbjct: 350 EFDSTEEQRQLVNNLIDRCNDVPLCATSLYSIGYHTVDPTHIA---DHHEPELSSWSTKW 406

Query: 432 RGLLDYIMYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPS 491
            GLLDYI YV       N        F+   ++ +   L++P  ++M +H QP+ GEYPS
Sbjct: 407 AGLLDYIFYV-------NQRPSTPATFETANNIAIAGYLQMPTHAQMHNHSQPYTGEYPS 459

Query: 492 DHLSLMCELEL 502
           DH+S+MC LE+
Sbjct: 460 DHISMMCALEI 470

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 94/227 (41%), Gaps = 37/227 (16%)

Query: 105 FRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163
           F +++YN L Q     K++      AL W  R + L  E+  Y  D+ICLQE++   Y+ 
Sbjct: 398 FTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKDEVLAYQTDIICLQEVESKTYEE 457

Query: 164 FWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD----- 208
           FW+  L+  GY   FH          +   K  G  I ++ S F  V +  IDF      
Sbjct: 458 FWLPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVFKDAIDFSSVWMK 517

Query: 209 ----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTYE 264
               +     + R     NV LI        IK R+  + +   VV T+HL W P     
Sbjct: 518 HKKFQRTEDYLNRAMNKDNVALI--------IKLRHERTGEHVWVV-TTHLHWDPHFNDV 568

Query: 265 RARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPF---FCGDFNSQ 308
           +  Q  ++L  ++  LK     + G  G+           CGDFNSQ
Sbjct: 569 KTFQVAVMLDYIEKLLK-----QHGGVGSPQDKKKIPLVICGDFNSQ 610

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 99/228 (43%), Gaps = 31/228 (13%)

Query: 105 FRMMTYNCLAQALIRRKLFPTSGN-ALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163
           F +++YN L Q     K++    + AL W  R + L  E+  Y  DVICLQE++   Y+ 
Sbjct: 445 FTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKEEVLSYQTDVICLQEVESKTYEE 504

Query: 164 FWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD----- 208
           FW+  L+  GY   FH          +   K  G  I ++ S F+ + +  IDF      
Sbjct: 505 FWLPLLEKQGYSGVFHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCIFKDAIDFSSVWMK 564

Query: 209 ----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTYE 264
               +     + R     N+ LIV L++  E+   +       + V T+HL W P     
Sbjct: 565 HKKFQRTEDYLNRAMNKDNIALIVKLKH--ELSGEH-------VWVVTTHLHWDPHFNDV 615

Query: 265 RARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDA 312
           +  Q  ++L  ++  LK+   +  G+     +     CGDFNSQ   A
Sbjct: 616 KTFQVGVLLDYIEKLLKQQSNI--GNPQEKKKVPLIICGDFNSQSHSA 661

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 95/233 (40%), Gaps = 37/233 (15%)

Query: 105 FRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163
           F +++YN L Q     K++  T   AL W  R + L  ++  YN D++CLQE++   Y+ 
Sbjct: 408 FTILSYNTLCQHYATPKMYRFTPSWALSWEYRREKLKEQILSYNTDIVCLQEVECKTYED 467

Query: 164 FWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD----- 208
           FW   L+  GY   FH          +   K  G    ++ S F  + +  +DF      
Sbjct: 468 FWAPLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKEAVDFSSVWMK 527

Query: 209 ----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTYE 264
               +     + R     NV L+V L++           +   +   T+HL W P     
Sbjct: 528 HKKFQRTEDYLNRAMNKDNVALVVKLQHI---------KSGEHVWAATTHLHWDPQFNDV 578

Query: 265 RARQCYIILSRMKVFLKRLRLLERGSCGAASQWHP---FFCGDFNSQPFDAPY 314
           +  Q  ++L  M+  +K     E+ +C    +        CGDFNSQ   A Y
Sbjct: 579 KTFQVGVLLDYMEKVIK-----EQNNCNNTQELKKVPVVICGDFNSQTNSAVY 626

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 76.6 bits (187), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 95/233 (40%), Gaps = 37/233 (15%)

Query: 105 FRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163
           F +++YN L Q     K++  T   AL W  R + L  ++ YY+ D+ICLQE++   Y+ 
Sbjct: 410 FTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYED 469

Query: 164 FWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD----- 208
           FW   L+  GY   FH          +   K  G  + +R S F  + +  +DF      
Sbjct: 470 FWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMK 529

Query: 209 ----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTYE 264
               +     + R     NV L+V L++           +   +   T+HL W P     
Sbjct: 530 HKKFQRTEDYLNRAMNKDNVALLVKLQHL---------KSGEHVWAATTHLHWDPQFNDV 580

Query: 265 RARQCYIILSRMKVFLKRLRLLERGSCGAASQWHP---FFCGDFNSQPFDAPY 314
           +  Q  ++L  M+  +K     E      + +        CGDFNSQ   A Y
Sbjct: 581 KTFQVGVLLDHMEKVIK-----EHSGYNNSQELKKVPVIICGDFNSQVDSAVY 628

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 102/252 (40%), Gaps = 37/252 (14%)

Query: 105 FRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163
           F +++YN L Q     K++  T   AL W  R   L  ++  Y+ DV+CLQE++   ++ 
Sbjct: 499 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYSSDVLCLQEVESKTFED 558

Query: 164 FWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD----- 208
           +W+  L+  GY   FH          +   K  G  I ++R  F  V+   +DF      
Sbjct: 559 YWVPLLEKHGYTGVFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKMVNRDSMDFSGAWMK 618

Query: 209 ----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTYE 264
               +     + R     NV L + L++          S+   I V T+HL W P     
Sbjct: 619 HKKFQRTEDYLNRAMNKDNVALFLKLQHV---------SSGDTIWVVTTHLHWDPKFNDV 669

Query: 265 RARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPIIY 324
           +  Q  ++L  ++  LK        S     +     CGDFNS      Y++     +I 
Sbjct: 670 KTFQVGVLLDHLETLLKEDT--THNSRQDIKKSPVLICGDFNS------YINSAVYELIS 721

Query: 325 EGRARTVIECST 336
            GR +   E S+
Sbjct: 722 TGRVQAHQEGSS 733

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 100/247 (40%), Gaps = 44/247 (17%)

Query: 105 FRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163
           F M++YN L Q     K++  T   AL W  R + L  ++  +N D+ICLQE++   ++ 
Sbjct: 538 FTMLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILNFNTDIICLQEVEAKTFED 597

Query: 164 FWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD----- 208
           FW   L+  GY   FH          +   K  G    ++ S F  + +  +DF      
Sbjct: 598 FWQPLLEKHGYTGLFHAKTRAKTMQSKDSKKVDGCCAFYKTSKFKMLFKECVDFSGLWMK 657

Query: 209 ----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIV--VGTSHLFWHPFGT 262
               +     + R     NV +++ L++            QSG +  + T+HL W P   
Sbjct: 658 HKKFQRTEDYLNRAMNKDNVAIVMKLQHI-----------QSGEIMWLVTTHLHWDPKFN 706

Query: 263 YERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPI 322
             +  Q  ++L  M+  LK     E+       ++    CGD NS      YLS     +
Sbjct: 707 DVKTFQVGVLLDHMETLLK-----EQNPKQDVKKYPLVICGDLNS------YLSSSVYEL 755

Query: 323 IYEGRAR 329
              GR +
Sbjct: 756 FSTGRVQ 762

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 92/233 (39%), Gaps = 37/233 (15%)

Query: 105 FRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163
           F +++YN L Q     K++  T   AL W  R   L  ++  +  DV+CLQE++   ++ 
Sbjct: 399 FTLLSYNTLCQHYATPKMYRYTPSWALSWDYRRDKLKEQIISFQADVVCLQEVECKTFED 458

Query: 164 FWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD----- 208
           FW   LQ  GY   FH          +   K  G  + ++ S F  V +  +DF      
Sbjct: 459 FWAPFLQKHGYTGVFHAKTRARTMQSKDSKKVDGCCVFYKNSEFKLVFKDAVDFSSVWMK 518

Query: 209 ----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTYE 264
               +     + R     NV L V L++               I V T+HL W P     
Sbjct: 519 HKKFQRTEDYLNRAMNKDNVALFVKLQHL---------KTNEQIWVTTTHLHWDPQFNDV 569

Query: 265 RARQCYIILSRMKVFLKRLRLLERGSCGAASQWHP---FFCGDFNSQPFDAPY 314
           +  Q  ++L  M+  L+     ++   G   +        CGDFNSQ   A Y
Sbjct: 570 KTFQVGVLLDYMEKLLR-----DQNGVGNNQEMKKVPLVICGDFNSQLDSAVY 617

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 94/230 (40%), Gaps = 31/230 (13%)

Query: 105 FRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163
           F +++YN L Q     K++  T   AL W  R + L  ++  +  DVICLQE++   Y+ 
Sbjct: 452 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSFKSDVICLQEVESKSYEE 511

Query: 164 FWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD----- 208
           FW+  LQ  GY   F+          +   K  G  I ++ S FN + +  +DF      
Sbjct: 512 FWLPLLQKNGYAGTFYAKTRAKTMQTKDSKKVDGCCIFYKESEFNVLYKDSVDFSGVWMK 571

Query: 209 ----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTYE 264
               +     + R     NV L + LE+          S +S  VV T+HL W P     
Sbjct: 572 HKKFQRTEDYLNRAMNKDNVALYMKLEHI--------KSGESVWVV-TTHLHWDPQFNDV 622

Query: 265 RARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPY 314
           +  Q  I+L  ++  LK        S     +     CGD NS    A Y
Sbjct: 623 KTFQVGILLDHLEELLKDNN--NASSKQEIRKCPVIICGDLNSHLDSAVY 670

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 92/230 (40%), Gaps = 31/230 (13%)

Query: 105 FRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163
           F +++YN L Q     K++  T    L W  R + L +++     DVICLQE++   Y+ 
Sbjct: 540 FTVLSYNTLCQHYATPKMYRYTPSWVLSWDTRREQLKNQILGIQSDVICLQEVEAQTYED 599

Query: 164 FWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD----- 208
           FW+  LQ  GY   FH          +   K  G  I ++ S F    +  +DF      
Sbjct: 600 FWLPLLQKRGYLGIFHAKTRAKTMQSKDSKKVDGCCIFYKESEFKLQHQESVDFSGVWMK 659

Query: 209 ----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTYE 264
               +     + R     NV L V LE+ +        S +S  VV T+HL W P     
Sbjct: 660 HKKFQRTEDYLNRAMNKDNVALFVKLEHIN--------SGESVWVV-TTHLHWDPQFNDV 710

Query: 265 RARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPY 314
           +  Q  ++L  ++  LK        S     +     CGD NS    A Y
Sbjct: 711 KTFQVGVLLDHLESLLKDYN--NASSKQEIRKCPVIICGDLNSHLQSAVY 758

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 95/232 (40%), Gaps = 38/232 (16%)

Query: 105 FRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163
           F +++YN L Q     K++  T   AL+W  R + L  ++  Y  D++CLQE++   Y+ 
Sbjct: 466 FTILSYNTLCQHYATPKMYRYTPSWALRWDYRREKLKEQILSYGCDILCLQEVESKTYED 525

Query: 164 FWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD----- 208
           FW   L+  GY   FH          +   K  G  + +++S F  + +  +DF      
Sbjct: 526 FWAPLLEKNGYTGYFHCKTRAKTMQAKDSKKVDGCCVFYKKSKFKLITKEALDFSGAWQK 585

Query: 209 ----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSG--IVVGTSHLFWHPFGT 262
               +     + R     NV + + L++            QSG  + V T+HL W P   
Sbjct: 586 HKRFQRTEDYLNRAMNKDNVAIYMKLQH-----------VQSGEYLWVVTTHLHWDPKFN 634

Query: 263 YERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPY 314
             +  Q  ++L  M+  +K     E        ++     GDFNS    A Y
Sbjct: 635 DVKTFQVGVLLDHMESIIK-----EENPKQDVKKFPIIITGDFNSYLTSAVY 681

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 98/247 (39%), Gaps = 37/247 (14%)

Query: 104 VFRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYK 162
            F +++YN L Q     K++  T   AL W  R   L  ++  Y+ DV+CLQE++   ++
Sbjct: 536 TFSVLSYNTLCQHYATPKMYRYTPSWALTWDYRRSKLKEQILSYDSDVLCLQEVESKTFE 595

Query: 163 SFWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD---- 208
            +W+  L   GY   F+          +   K  G  I ++R  F  V +  +DF     
Sbjct: 596 DYWVPLLDKHGYTGIFYAKARAKTMHSKDSKKVDGCCIFFKRDQFKLVTKDAMDFSGAWM 655

Query: 209 -----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTY 263
                +     + R     NV L + L++          S+   I V T+HL W P    
Sbjct: 656 KHKKFQRTEDYLNRAMNKDNVALFLKLQHV---------SSGDTIWVVTTHLHWDPKFND 706

Query: 264 ERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPII 323
            +  Q  ++L  ++  LK        S     +     CGDFNS      Y++     +I
Sbjct: 707 VKTFQVGVLLDHLESLLKEDT--THNSRQDIKKSPVLICGDFNS------YINSAVYELI 758

Query: 324 YEGRART 330
             GR + 
Sbjct: 759 STGRVQV 765

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 92/224 (41%), Gaps = 31/224 (13%)

Query: 105 FRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163
           F +++YN L       K++  T   AL W  R + L  +L  ++ DVICLQE++   Y+ 
Sbjct: 454 FTLLSYNTLCHHYATPKMYRFTPSWALSWDYRREKLKEQLLDFDTDVICLQEVETLTYEE 513

Query: 164 FWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD----- 208
           +W+  ++   Y   FH          +   K  G AI +++  F  V +  IDF      
Sbjct: 514 YWVPLMEKYNYSCLFHAKTRAKTMHAKDSKKVDGCAIFYKKDQFQLVFQDSIDFSSAWRS 573

Query: 209 ----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTYE 264
                     + R     NV LI  L++ +             + V T+HL W P     
Sbjct: 574 HKKFHRTEDYLNRAMNKDNVALIAELKHLN---------TNENVWVVTTHLHWDPQFNDV 624

Query: 265 RARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQ 308
           +  Q  ++L  ++  +K+   +   +     +     CGDFNSQ
Sbjct: 625 KTFQVGVMLDYLETLIKQHHHVNNNN--DIKKIPMVICGDFNSQ 666

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 100/238 (42%), Gaps = 34/238 (14%)

Query: 105 FRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163
           F +++YN L Q     K++  T   AL W  R   L  ++  Y+ D++CLQE++   ++ 
Sbjct: 435 FTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRAKLRDQILSYSCDIMCLQEVEARTFED 494

Query: 164 FWMDALQHAGYCSKF----------HRSFGKNHGIAIVWRRSLFNKVDETLIDF------ 207
           FW+  L+  GY   F          HR   K  G  + ++R+ F  + +  +DF      
Sbjct: 495 FWLPLLEKHGYSGSFHAKTRAKLLQHRDSKKVDGCCVFFKRTKFRLIKKEEVDFSSTWMK 554

Query: 208 -DEEQSGE--IERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTYE 264
            ++ Q  E  + R     N+ L   L++          ++   I V T+HL W P     
Sbjct: 555 HEKFQRTEDFLNRAMNKDNIALYFKLQHI---------ASGEHIWVATTHLHWDPKFNDV 605

Query: 265 RARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPI 322
           +  Q  ++L  ++  +++     R     A       CGDFNS    A Y  + S  +
Sbjct: 606 KTFQVGVLLDHLQTLIRQDN--PRQDVKKAPV---IICGDFNSYIDSAVYELLSSGSV 658

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 97/249 (38%), Gaps = 43/249 (17%)

Query: 104 VFRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYK 162
            F +++YN L Q     K++  T   AL W  R   L  ++  Y+ D++CLQE++   ++
Sbjct: 504 TFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFE 563

Query: 163 SFWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD---- 208
            +W+  L   GY   FH          +   K  G  I ++R  F  + +  +DF     
Sbjct: 564 EYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDFSGAWM 623

Query: 209 -----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTY 263
                +     + R     NV L + L++           +   I   T+HL W P    
Sbjct: 624 KHKKFQRTEDYLNRAMNKDNVALFLKLQHI---------PSGDTIWAVTTHLHWDPKFND 674

Query: 264 ERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPF---FCGDFNSQPFDAPYLSMCSK 320
            +  Q  ++L  ++  LK     E  S         F    CGDFNS      Y++    
Sbjct: 675 VKTFQVGVLLDHLETLLK-----EETSHNFRQDIKKFPVLICGDFNS------YINSAVY 723

Query: 321 PIIYEGRAR 329
            +I  GR +
Sbjct: 724 ELINTGRVQ 732

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 93/235 (39%), Gaps = 41/235 (17%)

Query: 105 FRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163
           F +M+YN L Q     K++  T   AL W  R + L  E+  Y  D++CLQE++   Y+ 
Sbjct: 524 FTIMSYNILCQHYATPKMYRYTPSWALSWDHRRQRLTEEVMSYMTDIVCLQEVEAKTYEE 583

Query: 164 FWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD----- 208
            W   +   GY   FH          +   K  G  + ++ S F    +  +DF      
Sbjct: 584 HWAPLMLKQGYSGVFHAKTRAKTMHSKDSKKVDGCCVFYKESEFKLQFKDEVDFSSTWMK 643

Query: 209 ----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTYE 264
               +     + R     NV + + L +           +   + + T+HL W P     
Sbjct: 644 HKKFQRTEDYLNRAMNKDNVVIYIKLNHL---------KSGESVWIATTHLHWDPQFNDV 694

Query: 265 RARQCYIILSRMKVFLKRLRLLERGSCGAASQWHP-----FFCGDFNSQPFDAPY 314
           +  Q  I++  ++  +K     E GS   +S+  P       CGDFNSQ   A Y
Sbjct: 695 KTFQVGILMDHLEELIK-----EHGS--PSSRQDPKKSPVIICGDFNSQKDSAVY 742

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 93/230 (40%), Gaps = 31/230 (13%)

Query: 105 FRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163
           F +++YN L Q     K++  T   AL W  R + L  ++  Y  DVICLQE++   ++ 
Sbjct: 464 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLTEQILSYMTDVICLQEVEAKTFEE 523

Query: 164 FWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD----- 208
           +W   +Q  GY   FH          +   K  G  + +R + F    +  +DF      
Sbjct: 524 YWAPLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCVFYRENEFKLAYKDAVDFSGVWQK 583

Query: 209 ----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTYE 264
               +     + R     NV + + L++          S +S  +V T+HL W P     
Sbjct: 584 HKKFQRTEDYLNRAMNKDNVAIYLKLQHIK--------SGESVWIV-TTHLHWDPQFNDV 634

Query: 265 RARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPY 314
           +  Q  +++  ++  LK        S   A +     CGD NS+   A Y
Sbjct: 635 KTFQVGVLMDHIENLLKEQS--NAQSKQEAKKCPVILCGDLNSEIHSAVY 682

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 90/225 (40%), Gaps = 38/225 (16%)

Query: 105 FRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163
           F +++YN L Q     K++  T   AL W  R + L  ++  Y  D++CLQE++   ++ 
Sbjct: 569 FTILSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILSYQSDILCLQEVESKTFEE 628

Query: 164 FWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD----- 208
           FW   L+   Y   FH          +   K  G  I +++S F  + +  +DF      
Sbjct: 629 FWGPLLEKYDYQGVFHIKTRAKTMQTKESKKVDGCCIFFKKSKFKLLAKEAMDFSGTWMK 688

Query: 209 ----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSG--IVVGTSHLFWHPFGT 262
               +     + R     NV L + L+           S  SG  + V T+HL W P   
Sbjct: 689 HKKFQRTEDYLNRAMNKDNVALYMKLQ-----------SITSGETVWVVTTHLHWDPKFN 737

Query: 263 YERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNS 307
             +  Q  I+L  M+  LK     E        + +   CGD NS
Sbjct: 738 DVKTFQVGILLDHMETLLK-----EENPKQDVKKANVVICGDLNS 777

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 95/246 (38%), Gaps = 37/246 (15%)

Query: 104 VFRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYK 162
            F +++YN L Q     K++  T   AL W  R   L  ++  Y+ D++CLQE++   ++
Sbjct: 506 TFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFE 565

Query: 163 SFWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD---- 208
            +W+  L   GY   FH          +   K  G  I +++  F  + +  +DF     
Sbjct: 566 DYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKKDQFKLITKDAMDFSGAWM 625

Query: 209 -----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTY 263
                +     + R     NV L + L++           +   I   T+HL W P    
Sbjct: 626 KHKKFQRTEDYLNRAMNKDNVALFLKLQHI---------PSGDTIWAVTTHLHWDPKFND 676

Query: 264 ERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPII 323
            +  Q  ++L  ++  L+             S      CGDFNS      Y++     +I
Sbjct: 677 VKTFQVGVLLDHLETLLREETTHNFRQDIKKSPV--LICGDFNS------YINSAVYELI 728

Query: 324 YEGRAR 329
             GR +
Sbjct: 729 STGRVQ 734

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 89/225 (39%), Gaps = 35/225 (15%)

Query: 105 FRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163
           F +++YN L Q     K++  T   AL W  R   L  ++  +  D++CLQE++   Y  
Sbjct: 564 FTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRDKLKDQILSFKSDILCLQEVESRTYDD 623

Query: 164 FWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD----- 208
           FW   LQ  GY   FH          +   K  G  I ++ S F  + +  +DF      
Sbjct: 624 FWEPLLQKHGYKGIFHAKTRAKTMQTKDSKKVDGCCIFYKESEFKVLFKEAVDFSGIWMK 683

Query: 209 ----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIV--VGTSHLFWHPFGT 262
               +     + R     NV + + L++            +SG V  + T+HL W P   
Sbjct: 684 HKNFQRTEDYLNRAMNKDNVAIYMKLQHI-----------KSGEVTWIVTTHLHWDPQFN 732

Query: 263 YERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNS 307
             +  Q  ++L  ++  LK    +   S     +     CGD NS
Sbjct: 733 DVKTFQVGVLLDHLESLLKEHSNIH--SKQDVKKCPIIICGDLNS 775

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 95/237 (40%), Gaps = 39/237 (16%)

Query: 105 FRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163
           F +++YN L Q     K++  T   AL W  R + L  ++  Y  D++CLQE++   ++ 
Sbjct: 526 FTLLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSYQSDILCLQEVESKTFEE 585

Query: 164 FWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD----- 208
           FW   L+   Y   FH          +   K  G  I +++S F  + +  +DF      
Sbjct: 586 FWSPLLEKYDYQGIFHIKTRAKTMQSKDSKKVDGCCIFFKKSKFKLLFKEAMDFSGTWMK 645

Query: 209 ----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSG--IVVGTSHLFWHPFGT 262
               +     + R     NV L + L+           S  SG  + V T+HL W P   
Sbjct: 646 HKKFQRTEDYLNRAMNKDNVALYLKLQ-----------SLTSGESVWVVTTHLHWDPKFN 694

Query: 263 YERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCS 319
             +  Q  I+L  M+  LK     E        + +   CGD NS  FD+    + S
Sbjct: 695 DVKTFQVGILLDHMEALLK-----EENPKQDVKKANVVICGDLNSY-FDSAVYELLS 745

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 100/245 (40%), Gaps = 57/245 (23%)

Query: 105 FRMMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVLLSE-LQYYNPDVICLQEIDHTQYK 162
           F  MTYN L+   +  +++    +  K W  R K+L  E L  Y  D++CLQE+  + Y 
Sbjct: 29  FTFMTYNMLSPHYMWPQVYTYVPDEYKDWNYRHKLLEKEILNSYRADIMCLQELTASDYH 88

Query: 163 SFWMDAL-QHAGYCSKF---------HRSFGKNHGIAIVWRRSLFNKVDETLI------- 205
            +W + + +   Y S+F          +      G+ I +  + F+ +  T I       
Sbjct: 89  QYWEEVIDRDFHYGSRFIAKPPPQYWQKDAKDVDGVGIFYNLNKFDYISSTSIHLNDLIG 148

Query: 206 --DFDE----------------EQSGE---IERRTTTKNVGLIVALEYTDEIKRRYPGSA 244
             D DE                   GE   +E   +   VGL VAL++ D          
Sbjct: 149 SFDLDELSYLKSKQVKLTDGAGNPKGEKTLLEILKSRNQVGLFVALKHKD---------T 199

Query: 245 QSGIVVGTSHLFWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFC 302
            +  VV  +HL+W     Y+  +  QC II+ ++   ++ L + E G+    ++    F 
Sbjct: 200 NTIFVVINTHLYW----KYDEVKLTQCLIIMRKLAKIIRDLLVGEHGT--TYNKMKVVFA 253

Query: 303 GDFNS 307
           GD NS
Sbjct: 254 GDLNS 258

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 60/255 (23%), Positives = 104/255 (40%), Gaps = 40/255 (15%)

Query: 105 FRMMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVLLSELQY-YNPDVICLQEIDHTQYK 162
           F M+TYN L+   +  +++    +  K W  R ++L  EL Y Y  D+ICLQE+    Y 
Sbjct: 34  FTMLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDYN 93

Query: 163 SFWMDALQH-AGYCSKFHRSFGKNH---------GIAIVWRRSLFN-------KVDETLI 205
            FW   + +   Y S F       +         G+ I +    F         +++ + 
Sbjct: 94  EFWKKQMMNRMNYGSNFTAKTPPKYWTKPLECMDGVGIFYNLDKFEYLFSSSLYLNDLVG 153

Query: 206 DFDEEQSGEIERR--TTTKNVGLIVALEYTDEIKRRYPG----------SAQSGIVVGTS 253
            FD+++   +     T T   G ++  +    + +               ++S IVV  +
Sbjct: 154 TFDQQELHYLTHHNITLTNGAGDVIGEDSLYNVAKARNQVCLFVMLRHRESKSIIVVINT 213

Query: 254 HLFWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFD 311
           HL+W     Y+  +  QC II+ +++  +K L +   G     S     F GDFNS   D
Sbjct: 214 HLYW----KYDEVKLVQCLIIMRKLQRIIKGLLMGIEGV--TYSNVKILFSGDFNSSR-D 266

Query: 312 APYLSMCSKPIIYEG 326
           +  +   +  II  G
Sbjct: 267 SLVIKFLNGKIIKHG 281

>ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 356

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 100/234 (42%), Gaps = 39/234 (16%)

Query: 107 MMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVLLSE-LQYYNPDVICLQEIDHTQYKSF 164
           ++TYN L+   +  +++    +  K W  R K+L  E L  Y  D++CLQE+    Y+ +
Sbjct: 24  VLTYNMLSPYYMWPQVYTYVPDEYKKWNYRHKLLQKEILGLYRADIMCLQELTSLDYQQY 83

Query: 165 WMDAL-QHAGYCSKF---------HRSFGKNHGIAIVWRRSLFNKVDETLI-------DF 207
           W   L +   Y SK+          RS  +  G+ + +  + F+ +  T I        F
Sbjct: 84  WNKVLMEKYNYGSKYIAKPPPKYWERSLSEMDGVGVFYDLNKFDYISSTGIYLNDLFGTF 143

Query: 208 DEEQSGEIERRTTTKNVGL---IVALEYTDEIKRRYP---------GSAQSGIVVGTSHL 255
           D ++   +E +      G    +  +  +D +K R            +  + ++V  +HL
Sbjct: 144 DLKEQNYLEHKMLQLTDGQGNPMEKMTLSDVLKGRNQVCMFVSLRHKATNTFLIVINTHL 203

Query: 256 FWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNS 307
           +W     Y+  +  QC II+ R+   +K L +  + +    ++    F GD NS
Sbjct: 204 YW----KYDEVKLAQCMIIMRRLSKIIKDLLIGVQDT--TYNKVKIIFAGDMNS 251

>Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 100/239 (41%), Gaps = 46/239 (19%)

Query: 105 FRMMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVLLSEL-QYYNPDVICLQEIDHTQYK 162
           F ++TYN L+ + +  +++       K W  R K+L  EL   +  D++CLQE+    Y+
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHKLLERELLNTFKADIMCLQEMTARDYE 86

Query: 163 SFWMDAL-QHAGYCSKF----HRSFGKN-----HGIAIVWRRSLFNKVDET-------LI 205
            +W D +     Y SKF       + KN      G++I +    F+ +  T       L 
Sbjct: 87  DYWRDYIGVDINYGSKFIPKTPPKYWKNPVKDMDGVSIFYNLEKFDYISSTGIYLNQLLN 146

Query: 206 DFDEEQSGEIERRTTTKNVG---------LIVALEYTDEI------KRRYPGSAQSGIVV 250
            F+E +   +  +  T   G         L+  L+  +++      K +  G+     VV
Sbjct: 147 VFNERELKYLFNKKVTLTDGASNIVGEDSLLDVLKGKNQVCLFVSLKHKETGTV---FVV 203

Query: 251 GTSHLFWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNS 307
             +HL+W     Y+  +  QC II+  +   +K+L     G   +  +    F GD NS
Sbjct: 204 LNTHLYWK----YDEVKLTQCMIIMRELSKIIKQLL---SGDVKSQRKVKILFTGDLNS 255

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 99/239 (41%), Gaps = 48/239 (20%)

Query: 105 FRMMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVLLSE-LQYYNPDVICLQEIDHTQYK 162
           F ++TYN L+Q+ +  +++       K W  R K+L  E L+ YN D+ICLQE+    Y+
Sbjct: 22  FTLLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEYEILKLYNADIICLQELTSRDYE 81

Query: 163 SFWMDALQHAGYCSKF---------HRSFGKNHGIAIVWRRSLFNKVDETLI-------- 205
            +W   L      S F          ++     G+ I +   +F  +D   I        
Sbjct: 82  YYWRKKLSKFNKGSDFICKTPPKYWTKAADDLDGVGIFYNLDMFELIDSNGIRLSDFLIS 141

Query: 206 DFDEEQSGEIERRTTTKNVG---------LIVALEYTDEI------KRRYPGSAQSGIVV 250
           DF++ +   +  R      G         ++  LE  +++      K +  G+      V
Sbjct: 142 DFEQPELDYLASRKLVLTDGEGRQIKVSNILDVLEEKNQVCLFMTLKHKRTGATVV---V 198

Query: 251 GTSHLFWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNS 307
            T+HL+W     Y+  +  QC II+ ++   +K  +L + GS          F GD NS
Sbjct: 199 VTTHLYW----KYDEIKLTQCMIIMRQLSKIMKD-QLKKDGSSFVKV----LFAGDLNS 248

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 56/244 (22%), Positives = 102/244 (41%), Gaps = 53/244 (21%)

Query: 104 VFRMMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVLLSEL-QYYNPDVICLQEIDHTQY 161
           +F +++YN L+ + +  +++       K W  R K+L  EL   Y  D++CLQE+    Y
Sbjct: 21  LFTLLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELLDKYRADIMCLQELTSEDY 80

Query: 162 KSFWMDALQH-----AGYCSK-----FHRSFGKNHGIAIVWRRSLFNKV-------DETL 204
            +FW  ALQ      + Y +K     + R   +  G+ I +    F  +       ++ L
Sbjct: 81  SNFWKKALQTNMNYGSNYIAKTPPQYWKRPVEQMDGVGIFYNLDKFEFISRSGIYLNQLL 140

Query: 205 IDFDEEQSGEIERRTTTKNVG---------LIVALEYTDEI------KRRYPGSAQSGIV 249
             F   +   +E++  T   G         L+  L+  +++      K +  G+     V
Sbjct: 141 GVFSNNELEYLEKKPVTLTDGAGNQVGEQSLLQILKSKNQVALFVSLKHKETGNV---FV 197

Query: 250 VGTSHLFWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSCGAAS----QWHPFFCG 303
           V  +HL+W     Y+  +  QC II+  +       R++E+   G  +    +    F G
Sbjct: 198 VINTHLYW----KYDDVKLTQCMIIMRELA------RIIEKHLVGLENVTDDKIKILFTG 247

Query: 304 DFNS 307
           D NS
Sbjct: 248 DLNS 251

>Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 100/245 (40%), Gaps = 58/245 (23%)

Query: 105 FRMMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVLLSEL-QYYNPDVICLQEIDHTQYK 162
           F ++TYN L+ + +  +++       K W  R K+L  EL   +  D++CLQE+    Y+
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAERYKNWNYRHKLLEKELLTTFKADIMCLQEMTTRDYE 86

Query: 163 SFWMDAL-QHAGYCSKF---------HRSFGKNHGIAIVWRRSLFNKV-------DETLI 205
           ++W +++     Y SKF          +      G++I +    F+ +       ++ L 
Sbjct: 87  NYWHNSIGVDINYGSKFISKTPPKYWEKPVKDMDGVSIFYNLEKFDYISSSGIYLNQLLN 146

Query: 206 DFDEEQSGEIERRTTT--------------------KN-VGLIVALEYTDEIKRRYPGSA 244
            F+E +   +  +  T                    KN V L V+L++ +          
Sbjct: 147 VFNERELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLKHKE---------T 197

Query: 245 QSGIVVGTSHLFWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFC 302
            +  VV  +HL+W     Y+  +  QC II+  +   +K+L     G   A  +    F 
Sbjct: 198 NTIFVVLNTHLYWK----YDEVKLTQCMIIMRELSKIIKQLL---PGDANAQEKVKILFT 250

Query: 303 GDFNS 307
           GD NS
Sbjct: 251 GDLNS 255

>Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119
           bp, 372 aa] {ON}
           (12595..13362,13366..13545,13548..13718) [1119 nt, 373
           aa]
          Length = 372

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 101/252 (40%), Gaps = 40/252 (15%)

Query: 89  KRPLLVCNGDEAKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE--LQYY 146
           KRP  +       G  F ++TYN L+   +  +++    +  K +K   +LL +  L+ Y
Sbjct: 21  KRPNGINIPRRIPGHKFTLLTYNMLSPYYMWPQVYNYVPDEFKDWKYRHMLLEDELLRTY 80

Query: 147 NPDVICLQEIDHTQYKSFWMDAL-QHAGYCSKF---------HRSFGKNHGIAIVWRRSL 196
             DV+CLQE+    Y S+W     +   Y SKF          ++  +  G  I +    
Sbjct: 81  KADVMCLQELTWEDYLSYWKPVFGKQLNYGSKFVAKTPPKYWDKTEQQMDGEGIFFNLDK 140

Query: 197 FNKVDETLI-------DFDEEQSGEIERRTT--TKNVGLIVALEYTDEIKRRYP------ 241
           F  +  T +        F+E +   ++R+    T   G  V  E   EI +         
Sbjct: 141 FEYISSTRLFLNDVVNTFEEHELNYMKRKIVKLTDGAGNPVGEETLYEILKNRNQVCLFV 200

Query: 242 ----GSAQSGIVVGTSHLFWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSCGAAS 295
                   +  VV  +HL+W     Y+  +  QC II+ ++   +  L +   G+  + S
Sbjct: 201 SLKHKETNNVFVVINTHLYW----KYDEVKLTQCMIIMRKLSQIINELLI---GADPSLS 253

Query: 296 QWHPFFCGDFNS 307
           +   F  GD NS
Sbjct: 254 KDVIFITGDLNS 265

>TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {ON}
           Anc_7.90 YOL042W
          Length = 388

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/249 (21%), Positives = 97/249 (38%), Gaps = 55/249 (22%)

Query: 100 AKGFVFRMMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVLLSE-LQYYNPDVICLQEID 157
           AK   F  ++YN L+   +  +++       K W  R  +L  E L  Y  D++C+QE+ 
Sbjct: 39  AKNPTFTFLSYNMLSPHYMWPQVYTYVPQEYKDWKYRHNLLEKEILDKYRSDIMCVQELT 98

Query: 158 HTQYKSFWMDALQHA-GYCSKF---------HRSFGKNHGIAIVWRRSLFNKVDETLID- 206
              Y SFW D+L+    Y S+F          +S  +  G+ I +   +F+ +    I+ 
Sbjct: 99  TIDYYSFWRDSLRKGFNYGSRFIAKNPPNYWTKSLVEMDGVGIFYNLDMFDYIGSRSINL 158

Query: 207 ------FDEEQ--------------SGEI-------ERRTTTKNVGLIVALEYTDEIKRR 239
                 FD ++              +G++       E   +   V L V +E+       
Sbjct: 159 NDLASTFDRKELDYMAAKEITILNGNGDVTGKESLYELALSKNQVCLFVMVEHK------ 212

Query: 240 YPGSAQSGIVVGTSHLFWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSCGAASQW 297
               ++   V+  +HL+W     YE  +  QC II+ ++   +  L           ++ 
Sbjct: 213 ---ISKDVFVIINTHLYW----KYEEVKLTQCMIIMRKLAKIVNELLFNAESRDMNYNKV 265

Query: 298 HPFFCGDFN 306
              F GD N
Sbjct: 266 KILFSGDLN 274

>YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putative
           endonuclease, has a domain similar to a
           magnesium-dependent endonuclease motif in mRNA
           deadenylase Ccr4p; the authentic, non-tagged protein is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 363

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/237 (21%), Positives = 100/237 (42%), Gaps = 42/237 (17%)

Query: 105 FRMMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVLLSEL-QYYNPDVICLQEIDHTQYK 162
           F ++TYN L+ + +  +++       K W  R ++L  EL   +  D++CLQE+    Y+
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFKADIMCLQEMTARDYE 86

Query: 163 SFWMDAL-QHAGYCSKF---------HRSFGKNHGIAIVWRRSLFNKV-------DETLI 205
            +W D++     Y SKF          +      G++I +  + F+ +       ++ L 
Sbjct: 87  DYWHDSIGVDVNYGSKFISKTPPKYWKKPVKDMDGVSIFYNLAKFDFISSSGIYLNQLLN 146

Query: 206 DFDEEQSGEIERRTTTKNVG---------LIVALEYTDE----IKRRYPGSAQSGIVVGT 252
            F++ +   +  +  T   G         L+  L+  ++    +  R+  +    +V+ T
Sbjct: 147 VFNQRELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLRHKETGTIFVVLNT 206

Query: 253 SHLFWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNS 307
            HL+W     Y+  +  QC II+  +   +K+L     G      +    F GD NS
Sbjct: 207 -HLYW----KYDEVKLTQCMIIMRELSKIIKQLL---PGDVKGQERVKILFTGDLNS 255

>ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL042W
           (NGL1)
          Length = 378

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 57/245 (23%), Positives = 95/245 (38%), Gaps = 58/245 (23%)

Query: 105 FRMMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVLLSELQY-YNPDVICLQEIDHTQYK 162
           F ++TYN L+   +  +++       K W  R K+L  EL + Y+ D++CLQE+    Y+
Sbjct: 42  FNLLTYNMLSPYYMWPQVYTYVPEPFKKWEYRHKLLEYELFHKYHADILCLQELTGKDYE 101

Query: 163 SFWMDALQH-----AGYCSK-----FHRSFGKNHGIAIVWRRSLFNKV------------ 200
            FW   ++      + Y  K     + RS  +  G+   +    F  V            
Sbjct: 102 KFWRKQMKRRMNFESQYAQKPPPAYWKRSQEEMDGVGTFYNADKFEHVATDLEYLSDTLG 161

Query: 201 ----------DETLIDFDEEQSGEIERR------TTTKNVGLIVALEYTDEIKRRYPGSA 244
                      +T ++  +     +E++      T    V L V L +            
Sbjct: 162 VLTPTEKEWMAQTQVEVTDATGHVVEKQSLKTVLTQRNQVCLFVTLLHK---------PT 212

Query: 245 QSGIVVGTSHLFWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFC 302
            S  VV  + L+W     Y+  +  QC+II+ R+K  +K  RLL R    + S       
Sbjct: 213 GSLFVVVNTQLYWK----YDEVKLAQCFIIMRRLKAIVK--RLLTRKDT-SYSNIKVLLS 265

Query: 303 GDFNS 307
           GD NS
Sbjct: 266 GDLNS 270

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 60/262 (22%), Positives = 98/262 (37%), Gaps = 60/262 (22%)

Query: 94  VCNGDEAKGFVFRMMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVLLSE-LQYYNPDVI 151
           + NG     F F  MTYN L+   +  +++       K W  R ++L  E L  Y  D++
Sbjct: 25  IKNGTSRSTFTF--MTYNMLSPYYMWPQVYTYVPEKYKEWSYRHRLLEREILNLYRADIM 82

Query: 152 CLQEIDHTQYKSFWMDALQ-HAGYCSKF---------HRSFGKNHGIAIVWRRSLFNKVD 201
           C+QE+    Y  FW    +    Y S F          R   +  G+ I +    F  + 
Sbjct: 83  CVQELTCKDYDGFWKGHFKSKMNYGSSFISKTPPKYWQRPPDEMDGVGIFYNLDKFEHIS 142

Query: 202 ETLIDFDE---------------------EQSGEIERRTTTKN-------VGLIVALEYT 233
            T I  ++                       +GE   + +  N       V L V+L + 
Sbjct: 143 TTSIYLNDLIGLFNISELNYLKSTIITLTNGAGEPVDKDSLLNVLHGRNQVSLFVSLMHK 202

Query: 234 DEIKRRYPGSAQSGIVVGTSHLFWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSC 291
           +          ++  VV  +HL+W     Y+  +  QC  I+ ++   +K L +   G  
Sbjct: 203 E---------TRTLFVVINTHLYW----KYDEVKLCQCLTIMRKLHRVIKSLLMGREGV- 248

Query: 292 GAASQWHPFFCGDFNSQPFDAP 313
              S+    F GD NS P D+P
Sbjct: 249 -TYSKVKILFAGDLNSAP-DSP 268

>Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 94/235 (40%), Gaps = 38/235 (16%)

Query: 105 FRMMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVLLSEL-QYYNPDVICLQEIDHTQYK 162
           F ++TYN L+ + +  +++       K W  R K+L  EL   +  D++CLQE+    Y+
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAERYKSWSYRHKLLEKELLNSFKADIMCLQEMTRRDYE 86

Query: 163 SFWMDAL-QHAGYCSKF---------HRSFGKNHGIAIVWRRSLFNKV-------DETLI 205
            +W D++  +  Y SKF          +      G++I +    F+ +       ++ L 
Sbjct: 87  DYWHDSIGVNINYGSKFISKTPPKYWKKPLEDMDGVSIFYNLDKFDFISSSGIYLNQLLN 146

Query: 206 DFDEEQSGEI--ERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSH--------- 254
            F+E +   +  +R   T     +V     D +     G  Q  + V   H         
Sbjct: 147 VFNERELKYLYNKRVILTDGASNVVG---EDSLLDVLKGKNQVCLFVSLKHKETDTIFVV 203

Query: 255 LFWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNS 307
           L  H +  Y+  +  QC II+  +   +++L     G      +    F GD NS
Sbjct: 204 LNTHLYWKYDEVKLTQCMIIMRELSKIIEQLL---PGDAKGRGKVKILFTGDLNS 255

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 98/251 (39%), Gaps = 58/251 (23%)

Query: 105 FRMMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVLLSE-LQYYNPDVICLQEIDHTQYK 162
           F +MTYN L+   +  +++       K W  R ++L  E L  Y  D++C+QE+    Y+
Sbjct: 30  FTLMTYNMLSPYYMWPQVYTYVPEKYKDWSYRHRLLEREILNLYRADIMCVQELTCKDYE 89

Query: 163 SFWMDALQH-----AGYCSK-----FHRSFGKNHGIAIVWRRSLF--------------- 197
            FW +  +      + Y +K     + R   +  G+ I +  + F               
Sbjct: 90  GFWKNHFKTKMNYGSSYIAKTPPKYWKRPEDEMDGVGIFYNLNKFEHISTSSIYLNDLIG 149

Query: 198 -------NKVDETLIDFDEEQSGEIERRTTT------KNVGLIVALEYTDEIKRRYPGSA 244
                  N +  T+I         I++ +          V L V+L + +          
Sbjct: 150 LFNISELNYLKSTIITLTNGAGEPIDKDSLLNVLHGRNQVSLFVSLLHKE---------T 200

Query: 245 QSGIVVGTSHLFWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFC 302
           ++  VV  +HL+W     Y+  +  QC  I+ ++   +K L +   G     S+    F 
Sbjct: 201 RTLFVVVNTHLYW----KYDEVKLCQCLTIMRKLHRVIKSLLMGMEGV--TYSKVKILFA 254

Query: 303 GDFNSQPFDAP 313
           GD NS P D+P
Sbjct: 255 GDLNSAP-DSP 264

>SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042W
          Length = 368

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/246 (21%), Positives = 93/246 (37%), Gaps = 57/246 (23%)

Query: 105 FRMMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVLLSEL-QYYNPDVICLQEIDHTQYK 162
           F ++TYN L+   +  +++       K W  R ++L  EL + Y  D++CLQE+    Y 
Sbjct: 30  FTLLTYNMLSPCYMWPQVYTYVPEKFKEWGYRHRLLEDELFKTYKADIMCLQELTTKDYH 89

Query: 163 SFWMDALQHA-GYCSKF---------HRSFGKNHGIAIVWRRSLFNKVDETLIDFDE--- 209
           +FW   ++    Y S F          R   +  G+ I +    F  +  + I  ++   
Sbjct: 90  NFWDKQMKETLNYGSNFISKTPPKYWKRPTDEMDGVGIFYNLDKFEYISSSSIYLNDVLG 149

Query: 210 ------------------EQSGEIERRTTTKN-------VGLIVALEYTDEIKRRYPGSA 244
                               +GE   +    N       V L V+L + D          
Sbjct: 150 IFNVRELKYMKETMITLTNGAGEAIGKDNLMNILQGRNQVCLFVSLRHKD---------T 200

Query: 245 QSGIVVGTSHLFWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFC 302
            +  VV  +HL+W     Y+  +  QC  I+ +++  +K L +   G     S+    F 
Sbjct: 201 NTVFVVINTHLYWK----YDEVKLSQCLTIMRKLERIIKSLLMGVEGV--TYSKVKILFS 254

Query: 303 GDFNSQ 308
           GD NS 
Sbjct: 255 GDLNSN 260

>TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90
           YOL042W
          Length = 391

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 99/251 (39%), Gaps = 63/251 (25%)

Query: 105 FRMMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVLLSEL-QYYNPDVICLQEIDHTQYK 162
           F M+TYN L+   +  +++    +  K W  R K+L  EL Q Y  D++CLQE+    Y 
Sbjct: 48  FTMLTYNMLSPHYMWPQVYTYVPDQYKDWKYRHKLLEFELMQKYKADIMCLQELTWEDYI 107

Query: 163 SFWMDAL-QHAGYCSKF---------HRSFGKNHGIAIVWRRSLFNKVDETLI------- 205
           S+W     +   Y SKF          ++  +  G  I + +  F  +  T +       
Sbjct: 108 SYWKPKCNEKMNYGSKFVAKTPPAYWEKTKQEMDGEGIFFNQEKFEYISSTKLFLNDVVG 167

Query: 206 DFDEEQSGEIERR---------------------TTTKNVGLIVALEYTDEIKRRYPGSA 244
            F+E +   ++++                     TT   V L V+L +          + 
Sbjct: 168 TFEEHEIEYMKKKIVTLTDGAGKPTGTNNLFTVATTRNQVCLFVSLRH---------KAT 218

Query: 245 QSGIVVGTSHLFWHPFGTYERAR--QCYIILSRMKVFLKRL------RLLERGSCGAASQ 296
            +  VV  +HL+W     Y+  +  QC II+ ++   +  L      ++++  +     +
Sbjct: 219 NTVFVVINTHLYW----KYDEVKLTQCMIIMRKLSHIINELLIGSNAKIVDNSTISKDVK 274

Query: 297 WHPFFCGDFNS 307
               F GD NS
Sbjct: 275 --IIFSGDLNS 283

>NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa]
           {ON} Anc_7.90 YOL042W
          Length = 365

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 97/237 (40%), Gaps = 44/237 (18%)

Query: 105 FRMMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVL-LSELQYYNPDVICLQEIDHTQYK 162
           F +++YN L+ + +  +++    +  K W  R  +L L  L  Y  D++C+QE+    Y 
Sbjct: 30  FTVLSYNMLSPSYMWPQVYTYVPDQYKDWNYRHTLLELELLDKYKADIMCVQEMTKRDYI 89

Query: 163 SFWMDAL-QHAGYCSKF---------HRSFGKNHGIAIVWRRSLFNKV-------DETLI 205
            +W   L    GY SKF          R      G+AI +    F+ +       +E L 
Sbjct: 90  DYWQLKLGTTIGYGSKFIAKSPPKYWERHLLDLDGVAIFYNLQKFDFISSSGIYLNEFLD 149

Query: 206 DFDEEQSGEIERRT--TTKNVGLIVALEYTDEIKR-----------RYPGSAQSGIVVGT 252
            F+ E+   ++ +T   T   G+ +  +   EI             ++  + Q  I++ T
Sbjct: 150 VFNPEELQYLKEKTLELTDGAGIKIDEKTLFEILSVKNQVSLFVCLKHKETGQVFIIINT 209

Query: 253 SHLFWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNS 307
            HL+W     Y+  +  QC II+  +   +  L    R      S+    F GD NS
Sbjct: 210 -HLYW----KYDEVKLSQCIIIMRELSKIIDELLQDVR-----HSKVKIIFAGDLNS 256

>NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90
           YOL042W
          Length = 389

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 94/237 (39%), Gaps = 43/237 (18%)

Query: 105 FRMMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVLLSELQ-YYNPDVICLQEIDHTQYK 162
           F ++TYN L+ + +  +++    +  K W  R K+L SEL   Y  D++CLQE+    Y 
Sbjct: 30  FTLLTYNMLSPSYMWPQVYTYVPDPYKDWQYRHKLLESELLGSYKADIMCLQEMTSRDYN 89

Query: 163 SFWMDALQHA-GYCSKF---------HRSFGKNHGIAIVWRRSLFNKVDETLIDFDE--- 209
             W   L    GY SKF          R   +  G+ I +    F+ +  + I  ++   
Sbjct: 90  ENWKRLLGSGIGYGSKFIAKSPPLYWEREVDEIDGVGIFYNLKKFDFISSSGIYLNQFLN 149

Query: 210 -EQSGEIE-----RRTTTKNVGLIVALEYTDE-----------IKRRYPGSAQSGIVVGT 252
              S E+E     R   T   G+ +  +   +           +  ++  + +  +V+ T
Sbjct: 150 VFSSTELEYLHSKRLVLTDGAGVPIGEKNLLDVISGKNQVCLFVSLKHKETGEMFVVINT 209

Query: 253 SHLFWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNS 307
            HL+W     Y+  +  QC II+  +   +  L            +    F GD NS
Sbjct: 210 -HLYWK----YDEVKLTQCMIIMRELSKIIDEL----VKGVDDPGKVKILFTGDLNS 257

>KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90
           YOL042W
          Length = 381

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 58/254 (22%), Positives = 102/254 (40%), Gaps = 44/254 (17%)

Query: 105 FRMMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVLLSELQ-YYNPDVICLQEIDHTQYK 162
           F ++TYN L+ A +  +++       K W  R  +L  EL   Y  D++C+QE+    Y+
Sbjct: 39  FTLLTYNILSPAYMWPQVYTYVPEQCKQWEFRHDLLEQELLGKYKADIMCIQEMTKRDYQ 98

Query: 163 SFWMDALQHAGYC-------SKFHRSFGKNH-----GIAIVWRRSLF----------NKV 200
            FW      +G C       SK    + K       G+AI + R +F          N++
Sbjct: 99  QFWSPI--ASGKCDMGSEFISKTAPKYWKREPDELDGVAIFYNRKMFDFVSSKGIYLNQM 156

Query: 201 DETLIDFDEEQSGEIERRTT------TKNVGLIVALEYTDEIKRRYPGSAQSG---IVVG 251
            +   D + E  G+ +   T      T    L+  L+  +++        +S     VV 
Sbjct: 157 LDAFNDHELEYLGQKKLGLTDGAGNPTGETNLLNFLKLKNQVSLFVSLQHKSTGMYFVVI 216

Query: 252 TSHLFWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQP 309
            +HL+W     Y+  +  QC +I+  +   +    LL+        +    F GD NS  
Sbjct: 217 NTHLYW----KYDEVKLTQCMVIMRELSQIID--DLLKDVPDVTKEKVKIIFTGDLNSTK 270

Query: 310 FDAPYLSMCSKPII 323
            ++P ++     II
Sbjct: 271 -NSPVINFLRGNII 283

>Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii ACR277C
          Length = 367

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 96/262 (36%), Gaps = 58/262 (22%)

Query: 107 MMTYNCLAQALIRRKLFPTSGNALK-WFKRSKVLLSELQY-YNPDVICLQEIDHTQYKSF 164
           ++TYN L+   +  +++    +  K W  R K+L  EL Y +  D++CLQE+    Y  F
Sbjct: 32  VLTYNMLSPYYMWPQVYTYVPDKFKDWNYRHKLLEYELFYKHKADILCLQELTTEDYNQF 91

Query: 165 WMDALQ-HAGYCSKF---------HRSFGKNHGIAIVWRRSLFNKVDETLI-------DF 207
           W   ++    Y S F              +  G+   +       +  T+I        F
Sbjct: 92  WRKQMKRRLSYGSNFISKPPPKYWTAGLQEMDGVGTFYNTEKLEFISSTVIYLNDFLSMF 151

Query: 208 DEEQSGEIERRTTTKNVG---------------------LIVALEYTDEIKRRYPGSAQS 246
            + +   + RR  T+  G                     L V L   D          +S
Sbjct: 152 SKRELDWMSRRQITQTNGANDPVTTRSLLSILLDRNQVCLFVCLREKD---------TKS 202

Query: 247 GIVVGTSHLFWHPFGTYERAR--QCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGD 304
            IVV  +HL+W     Y+  +  QC  I+ ++K  + +L     G     SQ      GD
Sbjct: 203 LIVVVNTHLYWK----YDEVKLSQCLTIMRKLKQVINKLTTTLEGV--TYSQIKIILGGD 256

Query: 305 FNSQPFDAPYLSMCSKPIIYEG 326
            NS   D+  +   +  II  G
Sbjct: 257 LNSTR-DSLLIKFLNGNIITHG 277

>Suva_9.189 Chr9 complement(313656..313979) [324 bp, 107 aa] {ON}
           YIL014C-A (REAL)
          Length = 107

 Score = 32.7 bits (73), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 13/63 (20%), Positives = 26/63 (41%)

Query: 103 FVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYK 162
           ++  +   + + + L+  KL PT  NA +W        S+ +Y      C +  D   + 
Sbjct: 43  YILNVSAIDGIMETLVETKLVPTLENATQWVSDMSAYWSQFEYGEEPTYCPKSFDLNDFY 102

Query: 163 SFW 165
            +W
Sbjct: 103 EYW 105

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,264,780
Number of extensions: 2285884
Number of successful extensions: 6192
Number of sequences better than 10.0: 72
Number of HSP's gapped: 6179
Number of HSP's successfully gapped: 72
Length of query: 504
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 390
Effective length of database: 40,409,475
Effective search space: 15759695250
Effective search space used: 15759695250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)