Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ABL117C8.849ON60260232500.0
Ecym_46208.849ON5975938491e-105
KLLA0C06226g8.849ON5925427491e-90
ZYRO0C14850g8.849ON5945927464e-90
KNAG0M02650singletonON5745487243e-87
YMR284W (YKU70)8.849ON6025847222e-86
TDEL0B001808.849ON5825627141e-85
SAKL0D01188g8.849ON5815417114e-85
Smik_13.5008.849ON6025627101e-84
KLTH0C03586g8.849ON5785417053e-84
Skud_13.4578.849ON6025817021e-83
Kwal_27.101998.849ON5725626992e-83
Suva_13.4748.849ON6025856952e-82
NCAS0C003208.849ON6085676881e-81
NDAI0K003608.849ON6205776647e-78
KAFR0L019508.849ON5885626556e-77
TPHA0I003108.849ON6085496481e-75
TBLA0B028908.849ON6485996203e-71
CAGL0I02662g8.849ON6065705912e-67
AFR443CsingletonON5765665561e-62
Kpol_1068.18.849ON5144755311e-59
TBLA0H006008.434ON124946742.6
NDAI0J009608.331ON240973724.2
Ecym_44607.111ON731107699.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL117C
         (602 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON} S...  1256   0.0  
Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {O...   331   e-105
KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} simila...   293   1e-90
ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} simi...   291   4e-90
KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {...   283   3e-87
YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subu...   282   2e-86
TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849...   279   1e-85
SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON...   278   4e-85
Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284...   278   1e-84
KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} simila...   276   3e-84
Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284...   275   1e-83
Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284...   273   2e-83
Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284...   272   2e-82
NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}...   269   1e-81
NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849     260   7e-78
KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8....   256   6e-77
TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849...   254   1e-75
TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.8...   243   3e-71
CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} simila...   232   2e-67
AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}...   218   1e-62
Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON} com...   209   1e-59
TBLA0H00600 Chr8 complement(122446..126195) [3750 bp, 1249 aa] {...    33   2.6  
NDAI0J00960 Chr10 complement(214481..221710) [7230 bp, 2409 aa] ...    32   4.2  
Ecym_4460 Chr4 (939029..941224) [2196 bp, 731 aa] {ON} similar t...    31   9.4  

>ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 602

 Score = 1256 bits (3250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/602 (100%), Positives = 602/602 (100%)

Query: 1   MGERQDKSGGQSGHFVKPVTHDYIDRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRAL 60
           MGERQDKSGGQSGHFVKPVTHDYIDRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRAL
Sbjct: 1   MGERQDKSGGQSGHFVKPVTHDYIDRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRAL 60

Query: 61  LHMVEELIIVQPNSAVGCLTFRNGRRAEDGIVEAFPLRPLDANYVRNISDCVADLEETGM 120
           LHMVEELIIVQPNSAVGCLTFRNGRRAEDGIVEAFPLRPLDANYVRNISDCVADLEETGM
Sbjct: 61  LHMVEELIIVQPNSAVGCLTFRNGRRAEDGIVEAFPLRPLDANYVRNISDCVADLEETGM 120

Query: 121 VGQHFPFTATVPASLDVMLAASDRYFTEDTQNADNRIFLVTDVDTPVEFTDPIRLEKVQA 180
           VGQHFPFTATVPASLDVMLAASDRYFTEDTQNADNRIFLVTDVDTPVEFTDPIRLEKVQA
Sbjct: 121 VGQHFPFTATVPASLDVMLAASDRYFTEDTQNADNRIFLVTDVDTPVEFTDPIRLEKVQA 180

Query: 181 RLLSLYRRRIDITTFFLHTEHAAFNDSSYAEILKTREWGIPGAPQSTSPLSICKLREKML 240
           RLLSLYRRRIDITTFFLHTEHAAFNDSSYAEILKTREWGIPGAPQSTSPLSICKLREKML
Sbjct: 181 RLLSLYRRRIDITTFFLHTEHAAFNDSSYAEILKTREWGIPGAPQSTSPLSICKLREKML 240

Query: 241 SQKDLNRAYFSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKY 300
           SQKDLNRAYFSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKY
Sbjct: 241 SQKDLNRAYFSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKY 300

Query: 301 KTVDNEKYIRDADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPY 360
           KTVDNEKYIRDADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPY
Sbjct: 301 KTVDNEKYIRDADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPY 360

Query: 361 YSNIGRAYYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPSDG 420
           YSNIGRAYYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPSDG
Sbjct: 361 YSNIGRAYYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPSDG 420

Query: 421 ETCALRLVRIPFIEEVRCFPTLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSDIR 480
           ETCALRLVRIPFIEEVRCFPTLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSDIR
Sbjct: 421 ETCALRLVRIPFIEEVRCFPTLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSDIR 480

Query: 481 NPLLRNFYSTLYHEQSQDAKRKMPELQYLPESDSTLHKVQLVRDRIENSIIHDEPPIISE 540
           NPLLRNFYSTLYHEQSQDAKRKMPELQYLPESDSTLHKVQLVRDRIENSIIHDEPPIISE
Sbjct: 481 NPLLRNFYSTLYHEQSQDAKRKMPELQYLPESDSTLHKVQLVRDRIENSIIHDEPPIISE 540

Query: 541 YINCWNIYYNHIIDKAVYEYGAPKRPLKYFTGDTLHLEDALTPNQQRTQRNTAKNAKTRF 600
           YINCWNIYYNHIIDKAVYEYGAPKRPLKYFTGDTLHLEDALTPNQQRTQRNTAKNAKTRF
Sbjct: 541 YINCWNIYYNHIIDKAVYEYGAPKRPLKYFTGDTLHLEDALTPNQQRTQRNTAKNAKTRF 600

Query: 601 NL 602
           NL
Sbjct: 601 NL 602

>Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABL117C
          Length = 597

 Score =  331 bits (849), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 195/593 (32%), Positives = 331/593 (55%), Gaps = 29/593 (4%)

Query: 25  DRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFRNG 84
           +R Q+I++CIELS  +   +  +   A + E++ ALL ++++L ++ PNS V C  ++  
Sbjct: 19  ERRQSIIVCIELSSRVYQ-SSEISPKAQLAEMLEALLELMKQLAMLLPNSEVCCYVYQCR 77

Query: 85  R-RAEDGIVEAFPLRPLDANYVRNISDCVADLEETGM-VGQHFPFTATVPASLDVMLAAS 142
           R   +DGI E  PL  ++   +  IS  ++D++   M +    PF     + L  +LA  
Sbjct: 78  RLNVKDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGSPLSSVLAKI 137

Query: 143 DRYF----TEDTQNADNRIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRIDITTFFLH 198
                   T++ +  + RI L+T  D P E+ D    +K +  + +LY     I TFF+H
Sbjct: 138 QHQLQGKTTDEWKFRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIVTFFIH 197

Query: 199 TEHAAFNDSSYAEILK--TREWGIPGAPQ-----STSPLSICKLREKMLSQKDLNRAYFS 251
           ++   FND+ YA++LK   R   +    Q     +T P+ I +L+ K+L +K+ N+ +F 
Sbjct: 198 SQTRPFNDTFYADLLKPLRRPEDLDKNIQYYDGPNTKPIEIKELKGKLLQKKEGNKFHFK 257

Query: 252 CPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKYKTVDNEKYIRD 311
           C  +INK  D ++S+ G+ A T E+ G R+KYI +   + +     RK+    N+    D
Sbjct: 258 CAFIINKQNDFIISLKGFFAITQEKAGERFKYIYQKGAKPQDAFSHRKFYNA-NDGEAAD 316

Query: 312 ADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPYYSNIGRAYYIL 371
           +  + V+ IGG  IE T+ + +KM    S++E+FLE++GFR+++    YY+NI  + Y++
Sbjct: 317 SRLTKVFDIGGLNIEFTEEQDQKMINSFSEHETFLELIGFRSVDKVNFYYNNISTSSYVI 376

Query: 372 PRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPSDGETC--ALRLVR 429
           P +  + GS+K L+ L  SM +KGKAAIVWG+L    HP LF ++  D +       LVR
Sbjct: 377 PDDNVYEGSSKTLSHLYASMTKKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTNQGFYLVR 436

Query: 430 IPFIEEVRCFPTLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSDIRNPLLRNFYS 489
           +PFIEE+R FP    ++R  + +EY L+K ++ N+I  F+L++SYR ++  +P+L++FY+
Sbjct: 437 LPFIEEIRRFPQTLQKNRSVNIQEYALMKKITGNIIAFFNLKSSYRAAEFPSPVLKSFYT 496

Query: 490 TLYHEQSQDAKRKMPELQYLPESDSTLHKVQLVRDRIENSIIHDEPPIISEYINCWNIYY 549
           TL  +  Q +      + +   +D TL KVQ +R+ I  S  + E PI+++Y+  WN YY
Sbjct: 497 TLSDKLLQKSLSDQWGMGFKLSNDITLGKVQHLRELINKSSQNMEQPILAKYMKYWNTYY 556

Query: 550 NHIIDKAVYEYGAPKRPLKYFTGDTLHLEDALTPNQQRTQRNTAKNAKTRFNL 602
           N   + ++      K+  + ++GD         P  Q++ R  A NAK+ FNL
Sbjct: 557 NKEGNNSI---TNRKKLYQIYSGD---------PQVQKSMRIRATNAKSVFNL 597

>KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 592

 Score =  293 bits (749), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 174/542 (32%), Positives = 287/542 (52%), Gaps = 24/542 (4%)

Query: 30  IVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFRNGR-RAE 88
           IV CI+L+ T+      L G   +LE++ +L  ++ +L++V P++AVGC  +      AE
Sbjct: 37  IVFCIQLTPTMYLSNPDLGGKIQLLEILDSLNDLMSQLVVVMPSTAVGCYIYNCSHPNAE 96

Query: 89  DGIVEAFPLRPLDANYVRNISDCVADLEETG-MVGQHFPFT-ATVPASLDVMLAASDRYF 146
           D + E  PLR ++   ++ +SD + D+E+   ++    P      P  L  +L      F
Sbjct: 97  DNVYELIPLRDVNYKNMKRVSDLLEDIEQDRILLKDEIPIADPNNPIELSPVLIKVRETF 156

Query: 147 TE----DTQNADNRIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRIDITTFFLHTEHA 202
            +      Q  + +IF  TD D P EF +     +++  +  LY   I+  TFF+ +E  
Sbjct: 157 LQPIEGQKQLTNKKIFFFTDDDKPAEFLNVDSRSRLRKVVDDLYDYYINFVTFFIGSEDK 216

Query: 203 AFNDSSYAEILK-------TREWGIPGAPQSTSPLSICKLREKMLSQKDLNRAYFSCPLV 255
            F+DS YA+ILK        + W     P ST+P++   ++ K+   K++ R  F CPL+
Sbjct: 217 PFDDSMYADILKWGSKINEAQSWLSSHGP-STNPINASYIKSKVKRTKEIKRIKFRCPLM 275

Query: 256 INKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKYKTVDNEKYIRDADRS 315
           +++ ADLVVSV GY   +HE PG++YK +  +    +  +  R+Y   +  + + ++  S
Sbjct: 276 LDERADLVVSVNGYTIVSHEIPGSKYKLVYANGSVRREAYSHREYLDAETGEAVDNSQLS 335

Query: 316 SVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPYYSNIGRAYYILPREL 375
            VY  G   IE+T+ E  K+  G S++ESFL+++GFR+      YY NI    +++P E 
Sbjct: 336 KVYTFGDEIIELTEDENLKIQSGYSEHESFLKLIGFRSTEQCLHYYDNIDVPAFVVPNEE 395

Query: 376 PFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPSDGE--TCALRLVRIPFI 433
            ++GS K LASL R+M  K K+A+VWG+L+    P++F L PS  +       L ++PF+
Sbjct: 396 DYAGSIKTLASLYRTMLFKKKSAMVWGKLRPNSPPSMFVLTPSSKKDYNQGFYLYKVPFM 455

Query: 434 EEVRCFPTLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSDIRNPLLRNFYSTLYH 493
           EEVR  P       L  + +Y+++  V++ LI  F+L+  YRPSD  NP L+  +  L  
Sbjct: 456 EEVRKLPDFLNHSALIESDDYKVMSKVTETLINFFNLKNGYRPSDFHNPALQKHFKILRE 515

Query: 494 EQSQ-DAKRKMPELQYLPESDSTLHKVQLVRDRIENSIIHDE--PPIISEYINCWNIYYN 550
              Q +  +  PE     E D TL KV+ +  RI +S   D+     + +Y+  WN +YN
Sbjct: 516 YLLQIEVDKSKPE----DEGDETLQKVKQIYARIASSAKSDDVKQQRLVKYLKLWNSFYN 571

Query: 551 HI 552
            +
Sbjct: 572 RL 573

>ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 594

 Score =  291 bits (746), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 185/592 (31%), Positives = 299/592 (50%), Gaps = 37/592 (6%)

Query: 3   ERQDKSGGQSGHFVKPVTHDYIDRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLH 62
           E+QDK   QS  + K   H      + I+ CIELS  +      L     ++E++  L  
Sbjct: 12  EQQDKQHTQSKSYRKYEVH------EGIIFCIELSAGMFQELSELNYKVQLVEILETLEQ 65

Query: 63  MVEELIIVQPNSAVGCLTFR-NGRRAEDGIVEAFPLRPLDANYVRNISDCVADLEETGMV 121
           ++ +L+IV+P + +GC  +  N   A++ I E FPLR ++A  ++ +SD + DL    + 
Sbjct: 66  LMSQLVIVRPGTGIGCYFYNCNKDDAKNHIYEFFPLRDINAKSMKKLSDLLDDLANDRIT 125

Query: 122 GQHF-PFTATVPASLDVMLA-ASDRYFTE-DTQNADN--RIFLVTDVDTPVEFTDPIRLE 176
            Q F P+  +    LD +     D +  E + Q A N  ++FL TD D+P E  D     
Sbjct: 126 LQKFLPYDESERTPLDFLYGFIQDEFLKEVEGQKAFNNKKVFLFTDNDSPPEAEDNETKS 185

Query: 177 KVQARLLSLYRRRIDITTFFLHTEHAAFNDSSYAEILK--------TREWGIPGAPQSTS 228
           +++  +  +    I+ TTFF+  E A F+DS Y+++LK          E+  P    +T+
Sbjct: 186 RLRHLVDDMDDHFINFTTFFIGKEEAPFDDSFYSDVLKLGATAEDPNTEFDGP----NTT 241

Query: 229 PLSICKLREKMLSQKDLNRAYFSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHD 288
           P+S   ++ ++L ++++ R  F C L++ +    +V + GY     ERPG RY+ + + D
Sbjct: 242 PISASYIKSRVLRKQEVKRIMFQCCLILEERMQFMVGIKGYTIIIQERPGQRYRLVYEKD 301

Query: 289 GRTKSVHQCRKYKTVDNEKYIRDADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEI 348
              K  +  RK+   +  + I +   + V+  G   I +TD EL ++ +  ++ ESFL+I
Sbjct: 302 EVRKEANSKRKFLDSNTGEVIEEG-LTKVFPYGDLDITITDEELNEVRKSYTEEESFLKI 360

Query: 349 LGFRAINTAAPYYSNIGRAYYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGF 408
           +GFR  N    Y++NI RA +++P E  F GS + LASL +++  KGK A+VWG+LK   
Sbjct: 361 IGFRDYNKCIHYFNNIDRALFVVPDEFRFEGSIRTLASLFKNLRAKGKVAVVWGKLKTNS 420

Query: 409 HPTLFALIPSDGE--TCALRLVRIPFIEEVRCFPTLDGEDRLFHTREYELVKTVSQNLIR 466
           HP +F L PS  E       L RIPF EE+R FP        + T EY  +K  ++++I 
Sbjct: 421 HPAVFVLSPSRNEDPNEGFYLYRIPFAEELRRFPQSLIRHNSYDTPEYNQLKDTTKSIID 480

Query: 467 HFSLRTSYRPSDIRNPLLRNFYSTLYH-----EQSQDAKRKMPELQYLPESDSTLHKVQL 521
           HF     YRPS+ RNP L+  +  L+      EQ ++        Q L   D +L K+  
Sbjct: 481 HFQFAKGYRPSEFRNPDLQKHFKILHDYLLQVEQEEEDDSPESSKQRLLSEDDSLLKLAQ 540

Query: 522 VRDRIENSIIHDEPPI--ISEYINCWNIYYNHIIDKAVYEYG---APKRPLK 568
           +RD+I +S    +P    + EY   WN  Y  +      E      PK+P K
Sbjct: 541 IRDKIMDSAQSSDPKKFQLDEYFQLWNRLYEDVSKATTLEDAPRPKPKQPRK 592

>KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {ON}
           
          Length = 574

 Score =  283 bits (724), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 170/548 (31%), Positives = 300/548 (54%), Gaps = 30/548 (5%)

Query: 25  DRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCL---TF 81
           D ++ I+ CIEL+ TL  P  SL+G + +LE++ +L  ++ +L+IV+P S+VGC+   T 
Sbjct: 20  DTHEGILFCIELTGTLFEPVESLQGRSNLLEILYSLKELMYQLVIVRPGSSVGCIFHYTD 79

Query: 82  RNGRRAEDGIVEAFPLRPLDANYVRNISDCVADLEETGM-VGQHFPFTATVPASLDVMLA 140
            NG  A DG+ E  PLR ++A  ++ +SD + D+EE  + + Q+F F  +   SL+ +  
Sbjct: 80  ING--AVDGVYEFLPLRDVNAKDMKTLSDFLEDIEEKRINIFQYFKFDGSKHVSLERLFQ 137

Query: 141 ASDRYFTEDTQNADN----RIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRIDITTFF 196
                ++E+ ++       R FL TD D P E  D     ++   +  L    +  TTFF
Sbjct: 138 LIGEKYSEEREDGKKFTHKRAFLFTDNDAPPESNDTEATRRISKIVDDLDETAVSFTTFF 197

Query: 197 LHTEHAAFNDSSYAEILKT------REWGIPGAPQSTSPLSICKLREKMLSQKDLNRAYF 250
           + +E A F++  Y+ +LK        ++  P    S  P++   ++ ++L  K++ R  F
Sbjct: 198 IGSEEAPFDNRFYSNVLKLGAQLKHSDYDGP----SVRPITGSDIKARILRGKEIKRTMF 253

Query: 251 SCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKYKTVDNEKYIR 310
            CPL +NK ++ ++ + GY   THE+ GTRYK   + +   +     RKY      + + 
Sbjct: 254 QCPLYLNKDSNFIIGIRGYAIVTHEKYGTRYKLTYEKEDIRQEAFSKRKYLNSKTGEEVD 313

Query: 311 DADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPYYSNIGRAYYI 370
             D S V   G   IE++   L++M     +   F+++LGFR+ +    Y++NI +  +I
Sbjct: 314 PKDISKVIPYGDVNIELSAEALQQMRASYEEEGPFMKVLGFRSTDLCVKYFNNIDKPSFI 373

Query: 371 LPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPSDGE--TCALRLV 428
           +P EL + GS K LASL R++  K K+AI+WG+ K+  +  L+ ++PS  E       + 
Sbjct: 374 VPDELQYEGSIKTLASLFRTLRSKNKSAIIWGKPKSNSNSALYIMVPSHREDRNDGFYMH 433

Query: 429 RIPFIEEVRCFPTLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSDIRNPLLRNFY 488
           RIPF++E+R  P +   D  +   + +L+ TV++ ++++F+LR  Y PS+ +NP ++N+Y
Sbjct: 434 RIPFLDELRKVP-IKMVDNDWTQLDNDLL-TVTETILKYFNLRQGYIPSEFKNPGIQNYY 491

Query: 489 STL--YHEQSQDAKRKMPEL--QYLPESDSTLHKVQLVRDRIENSIIHDEPPIISEYINC 544
             L  Y  Q ++ K +  +   + L   D TL K+  +R +IE S  +D   ++S Y+N 
Sbjct: 492 KVLHDYILQVEEIKHEGWDFSQEELLRQDDTLKKISHIRGKIEAS--NDSDKVLSGYMNM 549

Query: 545 WNIYYNHI 552
           WN++Y  +
Sbjct: 550 WNLFYKSL 557

>YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subunit
           of the telomeric Ku complex (Yku70p-Yku80p), involved in
           telomere length maintenance, structure and telomere
           position effect; relocates to sites of double-strand
           cleavage to promote nonhomologous end joining during DSB
           repair
          Length = 602

 Score =  282 bits (722), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 170/584 (29%), Positives = 316/584 (54%), Gaps = 43/584 (7%)

Query: 10  GQSGHF---VKPVTHDYIDRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEE 66
           G SG     V    +   D ++ I+ CIELS+T+   +  L+  +P+LE++ +L  ++ +
Sbjct: 9   GNSGELNDQVDETGYRKFDIHEGILFCIELSETMFKESSDLEYKSPLLEILESLDELMSQ 68

Query: 67  LIIVQPNSAVGCLTFRNGRR-AEDGIVEAFPLRPLDANYVRNISDCVADLEETGMVG--Q 123
           L+I +P +A+GC  +   R  A++GI E FPLR ++A +++ ++D + DL  +G +    
Sbjct: 69  LVITRPGTAIGCYFYYCNREDAKEGIYELFPLRDINATFMKKLNDLLEDLS-SGRISLYD 127

Query: 124 HFPFTAT---VPASLDVMLAASDRYFTEDT----QNADNRIFLVTDVDTPVEFTDPIRLE 176
           +F F  T       L V+       F E+     Q ++ R+FL TD+D P E  D     
Sbjct: 128 YFMFQQTGSEKQVRLSVLFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKPQEAQDIDERA 187

Query: 177 KVQARLLSLYRRRIDITTFFLHTEHAAFNDSSYAEILK-----TREWGIPGAPQ--STSP 229
           +++   + L+  +++  TFF+      F++  Y++IL+         G+       ST P
Sbjct: 188 RLRRLTIDLFDNKVNFATFFIGYADKPFDNEFYSDILQLGSHTNENTGLDSEFDGPSTKP 247

Query: 230 LSICKLREKMLSQKDLNRAYFSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDG 289
           +    ++ ++L +K++ R  F CPL++++  + +V V GY   THE+ G RYK + +H+ 
Sbjct: 248 IDAKYIKSRILRKKEVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYKLVYEHED 307

Query: 290 RTKSVHQCRKY-KTVDNEKYIRDADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEI 348
             +  +  RK+   +  E          VY  G   I ++D++ + +    ++ ++FL+I
Sbjct: 308 IRQEAYSKRKFLNPITGEDVT--GKTVKVYPYGDLDINLSDSQDQIVMEAYTQKDAFLKI 365

Query: 349 LGFRAINTAAPYYSNIGRAYYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGF 408
           +GFR+ + +  Y++NI ++ +I+P E  + GS + LASL + + +K K AI+WG+LK+  
Sbjct: 366 IGFRSSSKSIHYFNNIDKSSFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGKLKSNS 425

Query: 409 HPTLFALIPSDGETC--ALRLVRIPFIEEVRCFPTL----DGEDRLFHTREYELVKTVSQ 462
           HP+L+ L PS  +       L R+PF++E+R FP+L    DG +   H  +Y+ +K V+Q
Sbjct: 426 HPSLYTLSPSSVKDYNEGFYLYRVPFLDEIRKFPSLLSYDDGSE---HKLDYDNMKKVTQ 482

Query: 463 NLIRHFSLRTSYRPSDIRNPLLRNFYSTLYH-----EQSQDAKRKMPELQY--LPESDST 515
           +++ +F+LR  Y PSD +NPLL+  Y  L+      E + D + + P  +   +   D +
Sbjct: 483 SIMGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQIETTFD-ENETPNTKKDRMMREDDS 541

Query: 516 LHKVQLVRDRIENSIIHDEPPI--ISEYINCWNIYYNHIIDKAV 557
           L K+  +R++I  S   ++P I  +++Y+  WN++Y    D  +
Sbjct: 542 LRKLYYIRNKILESEKSEDPIIQRLNKYVKIWNMFYKKFNDDNI 585

>TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849
           YMR284W
          Length = 582

 Score =  279 bits (714), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 165/562 (29%), Positives = 304/562 (54%), Gaps = 27/562 (4%)

Query: 25  DRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFRNG 84
           D ++ I+ CIELS  +      L     ++E++  L  ++ +L+I +P++ +GC  F   
Sbjct: 20  DIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCYFFNCN 79

Query: 85  RR-AEDGIVEAFPLRPLDANYVRNISDCVADLE-ETGMVGQHFPFTATVPASLDVMLAAS 142
           R  A+DGI    PL+ ++A  ++ +SD + DL+ E   + Q  P+ A+    L+ +L   
Sbjct: 80  RSDAKDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDASKHTPLESLLELV 139

Query: 143 DRYFTEDT--QNADN--RIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRIDITTFFLH 198
              F +D   Q A N  +IF  TD D+P E +D     +++  +  L  R I+ TTFF+ 
Sbjct: 140 REEFVKDVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDDRFINFTTFFIG 199

Query: 199 TEHAAFNDSSYAEILK-------TREWGIPGAPQSTSPLSICKLREKMLSQKDLNRAYFS 251
                F++  Y++IL+       + E+  P    +T+P+S   ++ ++L ++++ R  F 
Sbjct: 200 KPGLPFDEGFYSDILRLGATTKASDEFDGP----NTTPISAAYIKSRVLRKQEIKRIMFQ 255

Query: 252 CPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKYKTVDNEKYIRD 311
           CPL++ + +  +V V GY   +HE+PG RYK + +++   +     RKY      + I+D
Sbjct: 256 CPLILEEKSKFIVGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNAKTGEEIKD 315

Query: 312 ADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPYYSNIGRAYYIL 371
              + VY  G   IE++++++ ++    +  ESFL+++GF++  T   YY+NI +A +++
Sbjct: 316 G-LTKVYPYGDLDIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNIEKATFVV 374

Query: 372 PRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPSDGETC--ALRLVR 429
           P E  + GS + L+SL +++ +K K AIVWG+LK+  +P +F  +PSD  +      L R
Sbjct: 375 PDEGRYEGSIRTLSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPNEGFYLYR 434

Query: 430 IPFIEEVRCFPTLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSDIRNPLLRNFYS 489
           +PF++E+R  P +          +YE +K  ++ LI HF+L+  + PS+ +NP L+  + 
Sbjct: 435 VPFLDELRRIPPMLISHGEIQDDDYENLKEATKKLINHFNLKNGFEPSEFKNPGLQKHFK 494

Query: 490 TLYH---EQSQDAKRKMPELQ--YLPESDSTLHKVQLVRDRIENSIIHDEP--PIISEYI 542
            L+    +  ++ ++   E Q   L E D +L ++  +RD+I+ S    +P    +S+Y+
Sbjct: 495 ILHDYLLQIEEEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESANSKDPNKQKLSKYL 554

Query: 543 NCWNIYYNHIIDKAVYEYGAPK 564
             WN  Y+ I D+      APK
Sbjct: 555 AIWNSLYDKIFDQETAIADAPK 576

>SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON}
           similar to uniprot|P32807 Saccharomyces cerevisiae
           YMR284W YKU70 Forms heterodimer with Yku80p known as Ku
           binds chromosome ends and is involved in maintaining
           normal telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 581

 Score =  278 bits (711), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 162/541 (29%), Positives = 297/541 (54%), Gaps = 25/541 (4%)

Query: 30  IVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFR-NGRRAE 88
           IV CIEL+ T+      L     ++E++ +L  ++ +LI+  PN+ VGC  F+ N   +E
Sbjct: 28  IVFCIELTSTMYRKVTELNHKIQLVEILESLAELMSQLIVTSPNTGVGCYFFQCNKDNSE 87

Query: 89  DGIVEAFPLRPLDANYVRNISDCVADLE-ETGMVGQHFPFTATVPASLDVMLAASDRYFT 147
            GI E  PL+ ++A  ++ ++D + DL+ +   + + FPF  ++  SL+ +L      F 
Sbjct: 88  HGIYEFLPLKDVNAKNMKKLNDLLEDLQFKRATLEEKFPFVPSLDVSLESVLVFLREQFI 147

Query: 148 EDTQN----ADNRIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRIDITTFFLHTEHAA 203
           ++  N     + ++FL TD   P  + +      ++  +  L    I+ T FF+ TE   
Sbjct: 148 KELPNRKAYNNGKVFLFTDNGKPNGYENLESRSGLRKIVNDLNDCYINFTPFFIDTEEKP 207

Query: 204 FNDSSYAEILKTREWG--IPGAPQ----STSPLSICKLREKMLSQKDLNRAYFSCPLVIN 257
           F+ S Y++ILK R     + G+      +T+P+    ++ ++  +K+  R  F CPL+++
Sbjct: 208 FDQSFYSDILKLRAKTDYVDGSEMFDGPNTTPIPASYIKSRVSRKKETRRVKFQCPLILD 267

Query: 258 KTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKYKTVDNEKYIRDADR-SS 316
              +  +S+ GY   +HE+PGTRYK + +++   K     R+Y  +D    +  +D+ + 
Sbjct: 268 DRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRY--LDASTGVDVSDKVAK 325

Query: 317 VYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPYYSNIGRAYYILPRELP 376
           ++  G   IE++  ++ K+ +    Y SFL+I+GFR+ +    YY+N+ +  +++P E  
Sbjct: 326 IFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQCLFYYNNVDKTAFVVPDEYT 385

Query: 377 FSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPS--DGETCALRLVRIPFIE 434
           + GS + +ASL R++  KGK+A+VWG+LK   +P ++ + PS  +       L RIPFI+
Sbjct: 386 YEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTENDPNEGFYLTRIPFID 445

Query: 435 EVRCFPTLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSDIRNPLLRNFYSTLYHE 494
           E+R FP++     +  +++Y  +   ++ +I +F+LR  Y+PS+ +NP L++++S L H+
Sbjct: 446 EIRRFPSVPQYGDVLSSQDYGHMCQATETIIAYFNLRNGYKPSEFKNPGLQHYFSLL-HD 504

Query: 495 QSQDAKRKMP---ELQYLPESDSTLHKVQLVRDRIENSIIHDEP--PIISEYINCWNIYY 549
           Q  +AK +     E + L   D TL K+  +RD+I  S   DEP    +S+Y   WN  Y
Sbjct: 505 QLLEAKEESSADEEQESL--KDDTLLKLSQIRDKIIESSKSDEPGRQRLSKYFKGWNTLY 562

Query: 550 N 550
           N
Sbjct: 563 N 563

>Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  278 bits (710), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 163/562 (29%), Positives = 314/562 (55%), Gaps = 46/562 (8%)

Query: 24  IDRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFRN 83
            D ++ I+ C+ELS+T+   +  L   +P+LE++ +L  ++ +L+I +P +A+GC  +  
Sbjct: 26  FDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNELMSQLVITRPGTAIGCYFYYC 85

Query: 84  GRR-AEDGIVEAFPLRPLDANYVRNISDCVADLE-ETGMVGQHFPFTAT-----VP-ASL 135
            R  A++GI E FPLR ++  +++ ++D + DL  E   + ++F F  T     +P ASL
Sbjct: 86  YRDDAKEGIYELFPLRDINVRFMKKLNDLLEDLSSERVTLYEYFNFQKTENQKQMPLASL 145

Query: 136 DVMLAASDRYFTEDT----QNADNRIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRID 191
              +  +   F +D+    Q  + R+FL TD D P E  +     +++   + L+  +I+
Sbjct: 146 FTFILDT---FLQDSSGQKQLNNKRVFLFTDNDKPQEAQNADDRARLRRLTVDLFDNKIN 202

Query: 192 ITTFFLHTEHAAFNDSSYAEIL-----KTREWGIPGAPQ--STSPLSICKLREKMLSQKD 244
            TTFF+   + +F++  Y++IL     K +  G+       +T P+    ++ ++L +++
Sbjct: 203 FTTFFIGYVNNSFDNEFYSDILQLGSHKNKTIGLNSEFDGPNTKPIDAKYIKSRILRKRE 262

Query: 245 LNRAYFSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKYKTVD 304
           + R  F C L+ ++  D ++ + GY   +HE+ G RYK + +H+   +  +  RK+    
Sbjct: 263 VKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNFM 322

Query: 305 NEKYIRDADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPYYSNI 364
           + + + D +   VY  G   I +++ + + +    ++ ++FL+I GFR+ + +  Y++NI
Sbjct: 323 SGEDVTD-NTVKVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYFNNI 381

Query: 365 GRAYYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPSDGETC- 423
            ++ +I+P E  + GS + L SL + + +K K AI+WG+LK+  HP+LF L PS+ +   
Sbjct: 382 EKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSPSNIKEYN 441

Query: 424 -ALRLVRIPFIEEVRCFPTL----DGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSD 478
               L R+PF++E+R FP+L    DG D   H  +Y+ +K V+Q++I +F+LR  Y PSD
Sbjct: 442 EGFYLYRVPFLDEIRKFPSLLSYDDGSD---HEIDYDNMKKVTQSIIGYFNLRDGYNPSD 498

Query: 479 IRNPLLRNFYSTLY---------HEQSQDAKRKMPELQYLPESDSTLHKVQLVRDRIENS 529
            +NPLL+  Y  L+          E+++ +  KM  + +    D +L K+  +R++I  S
Sbjct: 499 FKNPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVH---EDDSLRKLYHIRNKILES 555

Query: 530 IIHDEPPI--ISEYINCWNIYY 549
              ++P I  +++Y+  WN++Y
Sbjct: 556 EKSEDPAIQRLNKYVKIWNMFY 577

>KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 578

 Score =  276 bits (705), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 169/541 (31%), Positives = 283/541 (52%), Gaps = 19/541 (3%)

Query: 27  NQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFRNGRR 86
           ++ I+ C+ELS+ +      L     +  +   L  M + +II+ P + +GC  F+    
Sbjct: 22  HEGIIFCVELSEAMFKEPFDLNKVQLLEILETLLELMTQ-VIIILPGTGIGCFFFQCSHE 80

Query: 87  -AEDGIVEAFPLRPLDANYVRNISDCVADLE-ETGMVGQHFPFTATVPASLDVMLAASDR 144
            A+ GI E  PL  ++A  ++ ++D + DL+     + + FPF      SL+ +      
Sbjct: 81  GAKGGIYEFLPLLDVNARSMKKLNDLLDDLKMNITTLNEQFPFNDKQNTSLEAVFVLLQE 140

Query: 145 YFTEDTQNA----DNRIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRIDITTFFLHTE 200
            F+   Q      + +IFL TD D P E  D     +++  +  L    I+I  FF+ +E
Sbjct: 141 QFSRSVQGQKAYNNKKIFLFTDNDRPKESDDREAKNRLRKVIDDLDDSFINIIPFFVGSE 200

Query: 201 HAAFNDSSYAEILK--TREWGIPGAPQ----STSPLSICKLREKMLSQKDLNRAYFSCPL 254
              F+ S Y++ILK   ++    G  +    +T+P+S   ++ ++L +K++ R  F C L
Sbjct: 201 QRPFDQSFYSDILKLGAKKKASDGPFKYEGPNTTPISAKLIKSRVLRKKEIKRVRFQCSL 260

Query: 255 VINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKYKTVDNEKYIRDADR 314
           ++N+ +D  VS+ GY   +HER G++YK +  HDG  K     RKY   +  + + +   
Sbjct: 261 ILNEASDFQVSIKGYTTISHERAGSKYKQVYDHDGLRKEALSHRKYLDANTGEDVTER-V 319

Query: 315 SSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPYYSNIGRAYYILPRE 374
             V+      IE+++ E+ KM R  S Y+SFL+++GFR  N    Y++NI  + +++P +
Sbjct: 320 VKVFKFAEVDIELSEDEIAKMNRDYSSYDSFLKLVGFRDTNRCVFYFNNISNSSFVVPDD 379

Query: 375 LPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPS--DGETCALRLVRIPF 432
             F GS K +ASL R + EK K+A+VWG+LK+  +P+L+ L PS  +       L R+PF
Sbjct: 380 SVFKGSIKTMASLFRKLREKQKSAVVWGKLKSNSNPSLYTLTPSNFNDHNEGFYLTRVPF 439

Query: 433 IEEVRCFPTLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSDIRNPLLRNFYSTLY 492
           I+E+R FP       L  T+ +E +  +++ LI +FSLR SYRPSD  NP L+  +  L+
Sbjct: 440 IDEIRKFPPTAYHGNLSKTKTFEQMCKITETLISYFSLRHSYRPSDFENPTLQKHFELLH 499

Query: 493 HEQSQ-DAKRKMPELQYLPESDSTLHKVQLVRDRIENSIIHDEP--PIISEYINCWNIYY 549
               Q +        ++L + D TL K+  VR +I  S   D+P    +S Y+  WN  Y
Sbjct: 500 DYLLQVEVDPTSGSKEHLLKKDDTLLKLHQVRAKILESAESDDPVQARLSNYVKAWNSMY 559

Query: 550 N 550
           N
Sbjct: 560 N 560

>Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  275 bits (702), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 167/581 (28%), Positives = 308/581 (53%), Gaps = 49/581 (8%)

Query: 24  IDRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFRN 83
            D ++ I+ C+ELS+T+   +  L   +P+LE++ +L  ++ +L+I +P +A+GC  +  
Sbjct: 26  FDIHEGILFCVELSETMFKESQELDYKSPLLEILESLNELMSQLVITRPGTAIGCYFYYC 85

Query: 84  GRR-AEDGIVEAFPLRPLDANYVRNISDCVADLEETGM-VGQHFPFTATVPAS---LDVM 138
            R  A+ GI E  PLR ++A +++ ++D + DL    M + ++F F  T       L V+
Sbjct: 86  SRDDAKQGIFEFSPLRDINATFMKRLNDLLEDLSSGRMTLYEYFNFQPTEKQRQMPLGVL 145

Query: 139 LAASDRYFTEDT----QNADNRIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRIDITT 194
                  F +D     Q +  ++FL TD D P E  D     ++++  + L+  +++ +T
Sbjct: 146 FTFMLDTFLQDIPGQRQLSSKKVFLFTDNDIPQEAQDTDDRARLRSLTIDLFDNKVNFST 205

Query: 195 FFLHTEHAAFNDSSYAEILKTREWGIPGAP-------QSTSPLSICKLREKMLSQKDLNR 247
           FF+   + +F++  Y++IL+       G          +T P++   ++ K+L +K++ R
Sbjct: 206 FFIGYANKSFDNEFYSDILQLGSHTNKGVGLNSEFDGPNTKPINAKYIKSKILRKKEIKR 265

Query: 248 AYFSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKYKTVDNEK 307
             F CPL+  +  D  V V GY   +HE+ G RYK + +H+   +     RK+    N  
Sbjct: 266 IMFQCPLMFGENEDFTVGVKGYTMYSHEKAGVRYKLVYEHEDVRREAFSKRKFL---NPM 322

Query: 308 YIRDADRSSV--YWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPYYSNIG 365
              D   S+V  Y  G   I  ++ + + +    ++ ++FL I+GFR+ + A  Y++NI 
Sbjct: 323 TGEDVTSSTVKVYPYGDLDINFSENQNQIVMEAYTQKDAFLRIIGFRSSSKAIHYFNNIE 382

Query: 366 RAYYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPSDGETC-- 423
           ++ +I+P E  + GS + L SL +++ +K K AI+WG+LK   H +LF L PS  +    
Sbjct: 383 KSAFIVPDEAKYEGSVRTLTSLFKTLRKKDKIAILWGKLKTNSHASLFVLSPSSIKEYNE 442

Query: 424 ALRLVRIPFIEEVRCFPTL----DGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSDI 479
              L R+PF++E+R FP+L    +GE    +  +YE +K ++QN++ +F+L+  Y PSD 
Sbjct: 443 GFYLYRVPFLDEIRKFPSLLSYDNGEK---YKLDYENMKKITQNIMGYFNLKDGYNPSDF 499

Query: 480 RNPLLRNFYSTLYH-----------EQSQDAKRKMPELQYLPESDSTLHKVQLVRDRIEN 528
           RNP L+  +  L+             ++ DAK     L  +   D +L K+  +R++I +
Sbjct: 500 RNPSLQKHFKVLHDYLLQIETTPEGNETPDAK-----LNRIIHEDDSLRKLYHIRNKILD 554

Query: 529 SIIHDEPPI--ISEYINCWNIYYNHIIDKAVYEYGAPKRPL 567
           S   ++P I  +++Y+  WN++YN   D ++      K+PL
Sbjct: 555 SEKSEDPAIQRLNKYVKIWNVFYNKFNDDSI-SVKEEKKPL 594

>Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284W
           (YKU70) - DNA binding protein [contig 39] FULL
          Length = 572

 Score =  273 bits (699), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 173/562 (30%), Positives = 291/562 (51%), Gaps = 27/562 (4%)

Query: 18  PVTHDY--IDRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSA 75
           P   DY   + ++ I+ CIELS+ +   +  +     ++E++  LL ++ ++II  P + 
Sbjct: 5   PTVIDYQKFEVHEGIIFCIELSKGMFEKSSDM-NKVQLVEILETLLELMSQVIISLPGTG 63

Query: 76  VGCLTFRNG-RRAEDGIVEAFPLRPLDANYVRNISDCVADLEETGM-VGQHFPFTATVPA 133
           +GC  F  G   A  GI E  PL  ++A  ++ ++D + D+      + + FP    +  
Sbjct: 64  IGCYFFHCGHENATGGIYELLPLLDVNARSMKKLNDLLDDITAANTTLEKQFPLDEQLST 123

Query: 134 SLDVMLAASDRYFTEDT--QNADN--RIFLVTDVDTPVEFTDP---IRLEKVQARLLSLY 186
            L+ +       F      Q A N  +IFL TD D+P E  D    +RL KV   L   +
Sbjct: 124 PLETVFILLQEQFLNQVPGQKAYNNKKIFLFTDNDSPKEAHDSDTRLRLRKVVDDLDDCH 183

Query: 187 RRRIDITTFFLHTEHAAFNDSSYAEILK------TREWGIPGAPQSTSPLSICKLREKML 240
              I+ TTFF+ TE   F+ S Y++ILK        + G      ST+P++   ++ + L
Sbjct: 184 ---INFTTFFIGTEQKPFDQSFYSDILKLGAKKTASQGGSTFNGPSTAPINANLIKARAL 240

Query: 241 SQKDLNRAYFSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKY 300
            +K++ R  F C L +N+  D  VS+ GY   +HER GT+YK +  H+G  K V   RKY
Sbjct: 241 RKKEIKRIRFQCFLELNEATDFKVSIKGYTVVSHERTGTKYKQVYDHNGLRKEVISHRKY 300

Query: 301 KTVDNEKYIRDADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPY 360
              +  + + D+  + V+      IE ++ EL K+++  S  +SFL+++GFR  +    +
Sbjct: 301 LNANTGEDVTDS-IARVFRFAEIDIEFSEEELAKISKDYSPNDSFLKLIGFRDTSKCLFF 359

Query: 361 YSNIGRAYYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPSDG 420
           Y NIG + +++P E    GS K ++SL RS+ +K K+A+VWG+LK+  +P ++ L PS  
Sbjct: 360 YDNIGNSSFVVPDESVLEGSIKTMSSLFRSLSKKQKSAVVWGKLKSNSNPAVYILSPSTS 419

Query: 421 ETC--ALRLVRIPFIEEVRCFPTLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSD 478
           +       L R+PF++EVR FP +   D     + +E +  +++ LI +FSLR  Y+PSD
Sbjct: 420 KDLNEGFYLTRVPFVDEVRKFPPIPRYDEELGGKNFEQMCKITETLISYFSLRRPYKPSD 479

Query: 479 IRNPLLRNFYSTLYHEQSQ-DAKRKMPELQYLPESDSTLHKVQLVRDRIENSIIHDEPPI 537
            +NP L+  +  LY    Q +       +    + D TL K+  VR +I+ S+   +P  
Sbjct: 480 FKNPTLQKHFKLLYDYLLQVEVDCSSESVDGALKHDDTLLKLYQVRRKIQESLSSKDPEE 539

Query: 538 --ISEYINCWNIYYNHIIDKAV 557
             +  Y+  WN  YN I ++ +
Sbjct: 540 ERLGTYVKAWNSLYNKISNQEL 561

>Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  272 bits (695), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 164/585 (28%), Positives = 313/585 (53%), Gaps = 44/585 (7%)

Query: 8   SGGQSGHFVKPVTHDYIDRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEEL 67
           S G      +  ++   D ++ I+ CIELS ++   +  L   +P+LE++ +L  ++ +L
Sbjct: 10  SIGSFNDITEDASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQL 69

Query: 68  IIVQPNSAVGCLTFRNGRR-AEDGIVEAFPLRPLDANYVRNISDCVADLEETGM-VGQHF 125
           +I +P +++GC  +  GR  A++GI E FPLR ++A +++ ++D + D+    + + ++F
Sbjct: 70  VITRPGTSIGCYFYYCGRDDAKEGIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYF 129

Query: 126 PFTAT---VPASLDVMLAASDRYFTED----TQNADNRIFLVTDVDTPVEFTDPIRLEKV 178
            F  +   +   L  +       F +D     Q +  +IFL TD D P E  D     ++
Sbjct: 130 NFQHSEKQMQMPLGKLFTFMLDTFLQDIPGQKQLSSKKIFLFTDNDKPQESQDADERARL 189

Query: 179 QARLLSLYRRRIDITTFFLHTEHAAFNDSSYAEILKTREWGIPGAP-------QSTSPLS 231
           +   + L+  +++  TFF+   + +F++  Y++IL+       G          +T P+ 
Sbjct: 190 RRLTIDLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKGVDLDSEFDGPNTKPID 249

Query: 232 ICKLREKMLSQKDLNRAYFSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRT 291
              ++ K+L +K++ R  F CPL+ ++  + ++ V GY   +HE+ G RYK + +H+   
Sbjct: 250 AKYIKSKILRKKEVKRIAFQCPLIFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIR 309

Query: 292 KSVHQCRKYKTVDNEKYIRDADRSSV--YWIGGAGIEVTDAELRKMTRGCSKYESFLEIL 349
           +  +  RK+    N     D   S+V  Y  G   I +++ + + +    ++ + FL I+
Sbjct: 310 QEAYSKRKFL---NPTTGADVTGSTVKVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRII 366

Query: 350 GFRAINTAAPYYSNIGRAYYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFH 409
           GFR+  ++  Y++NI ++ +I+P E  + GS + LASL +++ +K K AIVWG+LK+  H
Sbjct: 367 GFRSPTSSIHYFNNIEKSTFIVPDEAKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSH 426

Query: 410 PTLFALIPSDGETC--ALRLVRIPFIEEVRCFPTL----DGEDRLFHTREYELVKTVSQN 463
           P+LF L PS  E       L RIPF++E+R FP+L     GE    H  EY+ +K +SQ+
Sbjct: 427 PSLFVLSPSSIEEYNEGFYLYRIPFLDEIRKFPSLLSYDSGEK---HELEYDNMKRISQS 483

Query: 464 LIRHFSLRTSYRPSDIRNPLLRNFYSTLYH---------EQSQDAKRKMPELQYLPESDS 514
           ++ +F+LR  Y PSD +NP L+  +  L+          E+++ ++ ++  + +    D 
Sbjct: 484 IMGYFNLRDGYNPSDFKNPSLQRHFKVLHDYLLQIEVNIEENETSEARINRVIH---EDD 540

Query: 515 TLHKVQLVRDRIENSIIHDEPPI--ISEYINCWNIYYNHIIDKAV 557
           +L K+  +R++I  S   ++P I  +++Y+  WN +YN   D  +
Sbjct: 541 SLRKLYHIRNKILESEKSEDPAIQRLNKYVKIWNTFYNKFNDDNI 585

>NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}
           Anc_8.849
          Length = 608

 Score =  269 bits (688), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 166/567 (29%), Positives = 301/567 (53%), Gaps = 44/567 (7%)

Query: 25  DRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFRNG 84
           D ++ I+ CIELS+++      L     +LE++ +L  ++ +L+I++P++ +GC      
Sbjct: 18  DIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVIIRPSTGIGCYFHYCD 77

Query: 85  RR---AEDGIVEAFPLRPLDANYVRNISDCVADLEETGM-VGQHFPFTATVPAS------ 134
           R+   +++GI E FPLR ++A  ++ +SD + DL    + + ++F F  T+         
Sbjct: 78  RKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEYFNFDPTLDNDSQKRVP 137

Query: 135 LDVMLAASDRYFTEDTQNADN----RIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRI 190
           L+ +       FT+ T +++     +IFL TD D+P E  D     +++  +  +    I
Sbjct: 138 LETLFNFLLDQFTKLTADSNKYHSKKIFLFTDNDSPHEVNDKDATLRIRRIVDDMNDNYI 197

Query: 191 DITTFFLHTEHAAFNDSSYAEILK-----------------TREWGIPGAPQSTSPLSIC 233
           +  TFF+  E   F +S Y+ ILK                   E+     P +T+P+   
Sbjct: 198 NFVTFFIGREGKPFKNSFYSNILKLGSKVNKENLAQSDGTGDEEYSEYDGP-NTTPIPAS 256

Query: 234 KLREKMLSQKDLNRAYFSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKS 293
            ++ K+L +K++ R  F CPL++ +  + +VSV GY   T E+P TRYK + +H+   K 
Sbjct: 257 YIKSKILRKKEIKRTMFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKLVYEHENIRKE 316

Query: 294 VHQCRKYKTVDNEKYIRDADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRA 353
               RK+   +  + I+  +   V+  G   IE+ D E+ K+    SK+ESFL+++GFR+
Sbjct: 317 ASSRRKFLNPNTGEEIKPDELCKVFPYGDQDIELNDKEVAKINDDYSKHESFLKVIGFRS 376

Query: 354 INTAAPYYSNIGRAYYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLF 413
              +  Y++NI +A +++P E  + G+ K +ASL R + ++ K  IVWG++K+  +  L+
Sbjct: 377 TKNSIRYFNNIDKALFVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKSNSNLRLY 436

Query: 414 ALIPSDG--ETCALRLVRIPFIEEVRCFPTLDGEDRLFHTREYELVKTVSQNLIRHFSLR 471
            L P+          L RIPF++E+R FP L   + +  + +Y  +  +++N+I +F+L+
Sbjct: 437 ILSPTTNIDRNEGFYLYRIPFLDEIRKFPKLLDYNHITTSEDYLNLVRITENIIGYFNLK 496

Query: 472 TSYRPSDIRNPLLRNFYSTLYH-----EQ--SQDAKRKMPELQYLPESDSTLHKVQLVRD 524
             YRPSD +NP L+  Y TL+      EQ   +D        ++L E D TL+K+  +R+
Sbjct: 497 KGYRPSDFKNPSLQRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKE-DDTLNKILHIRE 555

Query: 525 RIENSIIHDE--PPIISEYINCWNIYY 549
           +I  S   D+     +S+Y++ WN +Y
Sbjct: 556 KIIASKESDDVTQQRLSKYVSLWNTFY 582

>NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849
          Length = 620

 Score =  260 bits (664), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 178/577 (30%), Positives = 298/577 (51%), Gaps = 60/577 (10%)

Query: 25  DRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCL----- 79
           D ++ I+ CIELS+ +      L     +LE++ +LL ++  L+I++P++ VGC      
Sbjct: 29  DIHEGIIFCIELSKEMFQEVPELNYTVQLLEILESLLELMSHLVIIRPSTGVGCYIHYCN 88

Query: 80  ------TFRNGRRAEDGIVEAFPLRPLDANYVRNISDCVADLE-ETGMVGQHFPF----- 127
                 T  N +   DGI E FPLR ++A+ ++ +SD   DL+ E   + ++F F     
Sbjct: 89  KPDNNATEVNAKHI-DGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMKYFQFDNDEN 147

Query: 128 -TATVPAS------LD-VMLAASDRYFTEDTQNADNRIFLVTDVDTPVEFTDPIRLEKVQ 179
               VP        LD   LA  DR           +IFL TD D+P+E  +     +++
Sbjct: 148 FKKQVPLEKLFGFLLDKFTLANVDR-----NSYHSRKIFLFTDNDSPIESEEHEAKLRIR 202

Query: 180 ARLLSLYRRRIDITTFFLHTEHAAFNDSSYAEILK----TRE-------------WGIPG 222
             +  +    I+ TTFF+ T    F+DS Y+++LK    TRE             +    
Sbjct: 203 RLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKLGAKTRETSDQDYIDAVDDEYSEFD 262

Query: 223 APQSTSPLSICKLREKMLSQKDLNRAYFSCPLVINKTADLVVSVAGYVATTHERPGTRYK 282
            P +T P+    ++ ++L +K++ R  F  PL++N+ A+ ++ + GY+  +HE+P TRYK
Sbjct: 263 GP-NTKPIPAKYIKSRILRKKEIKRITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYK 321

Query: 283 YIVKHDGRTKSVHQCRKYKTVDNEKYIRDADRSSVYWIGGAGIEVTDAELRKMTRGCSKY 342
            + + +   K     RKY   +  + +++ +   ++  G   IE+ D E+ K+    S  
Sbjct: 322 LVYEQENVRKEAFSSRKYLNPNTGEELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCP 381

Query: 343 ESFLEILGFRAINTAAPYYSNIGRAYYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWG 402
           E+FL+I+GFR+ N    Y++NI    +++P E  + GS + +ASL R++ +K K AI+WG
Sbjct: 382 EAFLKIIGFRSKNQCLYYFNNITATTFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWG 441

Query: 403 QLKAGFHPTLFALIPSDGE--TCALRLVRIPFIEEVRCFPT-LDGEDRLFHTREYELVKT 459
           ++K    P L+ L P+          L R+PF+EE+R FP  LD +DR  +     L+K 
Sbjct: 442 KMKTNSKPCLYLLCPTSNSDRNEGFYLYRMPFLEEIRKFPKLLDYKDRSSNPDYTNLIKI 501

Query: 460 VSQNLIRHFSLRTSYRPSDIRNPLLRNFYSTLYH-----EQSQDAKRKMPELQYLPESDS 514
            S+ ++ +F LR  Y PS+  NP L+ FY  L+      EQS     +  ++Q L E D 
Sbjct: 502 TSK-IVEYFHLRNGYIPSEFENPSLQRFYRVLHDYLLQVEQSMAEGDEQHQIQKLLEEDD 560

Query: 515 TLHKVQLVRDRIENSIIHDEPPI--ISEYINCWNIYY 549
           TL K+  +RD+I +S   D+P    + +Y+N WN YY
Sbjct: 561 TLRKISQIRDKILSSKKSDDPTQQRLDKYMNLWNTYY 597

>KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8.849
           YMR284W
          Length = 588

 Score =  256 bits (655), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 153/562 (27%), Positives = 296/562 (52%), Gaps = 31/562 (5%)

Query: 20  THDYIDRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCL 79
           ++   + ++ ++  +ELS  +      L     ++E++ +L  ++ +LI+V+PN+A+GC 
Sbjct: 16  SYKKFESHEAMIFSVELSDGMFETVPEL-NKIQLIEILESLEELMSQLIVVRPNAAIGCY 74

Query: 80  TFRNGRRAED-GIVEAFPLRPLDANYVRNISDCVADL--EETGMVGQHFPFTATVPASLD 136
               G+   D GI E FPL  ++A  ++ +SD + DL  +   ++   F +      S++
Sbjct: 75  FHYCGKEGNDYGIYEFFPLSDINAKNMKKLSDLLEDLRLDRINLI-DFFQYNNAKKTSME 133

Query: 137 VMLAASDRYFTEDTQNAD----NRIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRIDI 192
            +       F+ +          RIFL TD D+P++  D      ++  +  L    ++ 
Sbjct: 134 KLFTFYLNQFSMEVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKIVDDLDESHVNF 193

Query: 193 TTFFLHTEHAAFNDSSYAEILK-------TREWGIPGAPQSTSPLSICKLREKMLSQKDL 245
             FF+    A FN + Y+EILK       + E+  P    +T+P+    ++ K+L ++++
Sbjct: 194 VPFFIGRPDAPFNSALYSEILKLGARKDSSTEYDGP----NTTPIQASYIKSKVLRKREI 249

Query: 246 NRAYFSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKYKTVDN 305
            R  F CPL++N+  + +V + GY+  +HE+  TRYK + +++   +     RK+ + + 
Sbjct: 250 KRVAFRCPLILNEKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAFSRRKFLSSET 309

Query: 306 EKYIRDADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPYYSNIG 365
            + I+  + + ++ +G   IEV +    ++ +      SFL+++GFR+I +   Y +NI 
Sbjct: 310 AEEIKGKELTKIFTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIKSCVKYINNID 369

Query: 366 RAYYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPSDGE---T 422
           +  +++P E+ +  S K+L SL +++  KGKAAI+WG+LKA  +P+LF L PS GE    
Sbjct: 370 KVMFVVPDEMQYVNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVLEPS-GEKDPN 428

Query: 423 CALRLVRIPFIEEVRCFPTLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSDIRNP 482
               L R+PF++E+R  PT+   +   +T +YE +  V++ ++ +F+L+  Y P D++NP
Sbjct: 429 EGFYLHRVPFLDEIRKLPTMITYECGENTSDYENLIKVTEYIMAYFNLKGGYNPMDLKNP 488

Query: 483 LLRNFYSTLYH-----EQSQDAKRKMPELQYLPESDSTLHKVQLVRDRIENSIIHDEPPI 537
            ++ ++  L+      E     +      Q L   D TL KV  +R++I +S   ++   
Sbjct: 489 CIQKYFKILHDYLLQIEDKTSDESSTERKQRLLREDDTLRKVSHIREKIISSSRSEDAGA 548

Query: 538 --ISEYINCWNIYYNHIIDKAV 557
             +S+YI  WN +Y  I  ++V
Sbjct: 549 QKLSKYIKVWNNFYAKIEKESV 570

>TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849
           YMR284W
          Length = 608

 Score =  254 bits (648), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 156/549 (28%), Positives = 282/549 (51%), Gaps = 29/549 (5%)

Query: 31  VLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFR-NGRRAED 89
           + CIELS+ + S    L     ++EV+ +L+ ++ +L+I +P++ VGC  F  + + ++ 
Sbjct: 45  MFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTGVGCFFFNCDNKESKK 104

Query: 90  GIVEAFPLRPLDANYVRNISDCVADLEETGM-VGQHFPFTATVPA--SLDVMLAASDRYF 146
            I E  PLR ++ + ++ + D + D++E  + +   F F        SL+ +       F
Sbjct: 105 RIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEINDKGNSLESLFLLIQDRF 164

Query: 147 TEDTQN----ADNRIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRIDITTFFLHTEHA 202
           + +        + ++FL TD D P E  D  +  +++     +    I   TFF++   +
Sbjct: 165 SNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDISDNYIQFVTFFINKIDS 224

Query: 203 A--FNDSSYAEILKTREWG-IPGAPQSTSPLSICKLREKMLSQKDLNRAYFSCPLVINKT 259
           +  F+DS Y++ILK R    I     ST P+S+  ++ K+L +K++ R  F CPL++N  
Sbjct: 225 SDNFDDSFYSDILKLRNSNSIEFDGPSTKPISVAYIKNKVLRKKEIKRIMFQCPLILNAD 284

Query: 260 ADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKYKTVDNEKYIRDADRSSVYW 319
           +D  V+V GY   +HE+PG+RYK + +H+   +     RK         +   D   ++ 
Sbjct: 285 SDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLLNGKTGTVVTKDDTEKIFQ 344

Query: 320 IGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPYYSNIGRAYYILPRELPFSG 379
           +G   I   + E  K        E FL+++GFR+   +   ++NIG+A +I+P E    G
Sbjct: 345 LGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSLHLFNNIGKALFIVPDESRCVG 404

Query: 380 SAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPSD---GETCALRLVRIPFIEEV 436
           S + L+S+ R+M  K + AIVWG+LK+  +P ++ L PSD    +     L ++PF++E+
Sbjct: 405 SIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDPTKDQNEGFYLYKVPFLDEI 464

Query: 437 RCFP---TLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSDIRNPLLRNFYSTLYH 493
           R  P   T    D L   ++YE +K V++N++ +F+L   Y P + +NPLL+ +Y  L+ 
Sbjct: 465 RKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTNGYSPLEFKNPLLQKYYKLLHD 524

Query: 494 --------EQSQDAKRKMPELQYLPESDSTLHKVQLVRDRIENSIIHDEP--PIISEYIN 543
                    +++ +K ++   Q + E D T+ K   +RD+I  S    E     +S   N
Sbjct: 525 YLLQVETVPETEMSKEQLK--QKILEEDDTIRKTFSIRDKIIKSASSTESHKQRLSANFN 582

Query: 544 CWNIYYNHI 552
            WN  Y+ +
Sbjct: 583 IWNDIYSKL 591

>TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.849
           YMR284W
          Length = 648

 Score =  243 bits (620), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 162/599 (27%), Positives = 297/599 (49%), Gaps = 74/599 (12%)

Query: 28  QNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFRNG--- 84
           + I+ C+ELS  +      LKG + +LE++ +L  + E+LII +PN+A+G   F +    
Sbjct: 30  EGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRPNTAIGFYLFHHTSDS 89

Query: 85  -RRAEDGIVEAFPLRPLDANYVRNISDCVADL-EETGMVGQHFPFTATVPASL-DVMLAA 141
             + + GI E F L  ++   ++ ++D + DL  +   +   F F  + P  L D+    
Sbjct: 90  VEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFKFDNSRPTKLEDIFNVV 149

Query: 142 SDRYFTEDTQNADN-----RIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRIDITTFF 196
            +++   D+ +        ++FL T+ D P+E  +    +K++  +  L    I  +TFF
Sbjct: 150 QEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRRMVNDLNESEIFFSTFF 209

Query: 197 LHTEHAAFNDSSYAEILK------TREWGI------------------------------ 220
           ++   + F+D+ Y++ILK      T E  +                              
Sbjct: 210 INKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGNHYLLINDLKDTSKSKTTD 269

Query: 221 ----PGAPQ----STSPLSICKLREKMLSQKDLNRAYFSCPLVINKTADLVVSVAGYVAT 272
               P   +    +T P+    +++++L ++++ R  F CPL++++ ++ ++ + GY   
Sbjct: 270 RKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPLILDEASNFIIGITGYNIF 329

Query: 273 THERPGTRYKYIVKHDGRTKSVHQCRKYKTVDNEKYIRDADRSSVYWIGGAGIEVTDAEL 332
           + E+PGTRYK + +H+   K     RK+   +  + ++D D   VY  G   IE++D   
Sbjct: 330 SIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDFQKVYKYGDINIELSDEAT 389

Query: 333 RKMTRGCSKYESFLEILGFRAINTAAPYYSNIGRAYYILPRELPFSGSAKVLASLNRSMF 392
           + +     +   F+++LGFR+ + +  YY+NI +A +++P E  + GS K +ASL R++ 
Sbjct: 390 QNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDESSYEGSIKTMASLFRTLH 449

Query: 393 EKGKAAIVWGQLKAGFHPTLFALIPSDGE--TCALRLVRIPFIEEVRCFPTLD----GED 446
           +K K AIVWG   +G HPT+  L PS+       L L ++PF++E+R FP L     G +
Sbjct: 450 KKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLYLFQVPFLDEIRRFPALTSYSPGTN 509

Query: 447 RLFHTREYELVKTVSQNLIRHFSLRTSYRPSDIRNPLLRNFYSTL--YHEQSQDAK-RKM 503
           +  +  EYE +K +++ ++    LR  YRPS  RNP L+ +Y  L  Y  Q +D      
Sbjct: 510 K--NISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPALQKYYKILHDYLLQIEDTSLTDT 567

Query: 504 PE--LQYLPESDSTLHKVQLVRDRIENSIIHDEPPI----ISEYINCWNIYYNHIIDKA 556
           P+  L+     D TL+++  +R RI  S     P +    +S++I  WN  +  I + A
Sbjct: 568 PQEVLEREVYEDDTLYRLDKLRKRIIQS--SQAPELYNQRLSKFIEHWNRVFKKINEDA 624

>CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284w HDF1
           high-affinity DNA-binding protein
          Length = 606

 Score =  232 bits (591), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 156/570 (27%), Positives = 280/570 (49%), Gaps = 34/570 (5%)

Query: 8   SGGQSGHFVKPVTHDYIDRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEEL 67
           SG + G   K  +    + ++ I+ CIELS+ +      L G + I  ++ +L  ++E L
Sbjct: 18  SGKEDGEVNKQASFKRFEIHEGIMFCIELSEHMFEVQDELDGKSQIEVILTSLSELMELL 77

Query: 68  IIVQPNSAVGCLTFRNGRR-AEDGIVEAFPLRPLDANYVRNISDCVADLEETGMVGQHF- 125
           I+ +P++A+GC  +   R  +++ I E  PL  L+  +++ ++D + D+    +  + + 
Sbjct: 78  IVTRPSTAIGCYFYNCEREDSKESIFEFIPLVDLNVQWMKKVNDLLEDVSNQRITFKEYL 137

Query: 126 ------PFTATVPASLD----VMLAASDRYFTEDTQNADNRIFLVTDVDTPVEFTDPIRL 175
                      +P  L+    ++L   +R      +    ++FL TD D P   +    +
Sbjct: 138 NYNIDQNKKLNIPILLEKLFSLILETFNRNIEGQKEFNSKKVFLFTDNDLPNVESQQRSI 197

Query: 176 EKVQARLLSLYRRRIDITTFFLHTEHAAFNDSSYAEILKT-REWGIPGAPQ----STSPL 230
           + ++  L  +    I+ T FF+  +   FN + Y+++L+  R++   G+      ST P+
Sbjct: 198 DVLKGILKDIDDNMINFTNFFISKKDKPFNPAFYSKVLRNDRDYNSLGSQAYFGPSTKPI 257

Query: 231 SICKLREKMLSQKDLNRAYFSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGR 290
            +  ++E++  +K++ R  F CPLV+++  + V+S+ GY    HE+   RYK + ++   
Sbjct: 258 GVNDIKERIFQRKEIRRVVFQCPLVLDEGTNFVISIKGYSIFNHEKGSVRYKLVYENQEI 317

Query: 291 TKSVHQCRKYKTVDNEKYIRDADRSSVYWI--GGAGIEVTDAELRKMTRGCSKYESFLEI 348
            K     RK+    N K   D  + +V  I  G   IE+ D  +           + L +
Sbjct: 318 RKEAFSKRKFI---NPKTGEDVSKQTVKIIPYGEKEIEMEDKNIANALNVYGNTSASLTV 374

Query: 349 LGFRAINTAAPYYSNIGRAYYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGF 408
           +GF   + +  +Y+NI +  +I P E    GS    ASL R++ +  K  +VWG  K+  
Sbjct: 375 IGFLNEDNSLVFYNNIDKTLFITPDENVIEGSFTAFASLFRTLKKLKKVGVVWGSTKSNS 434

Query: 409 HPTLFALIPS--DGETCALRLVRIPFIEEVRCFPTLDGEDRLFHTREYELVKTVSQNLIR 466
            P+L+ L PS  D       L ++PFI+E+R +PTL   +      EY+ VK ++Q +I 
Sbjct: 435 SPSLYLLWPSKDDDNNQGFYLTKVPFIDEIRKYPTLSNININEEWEEYKNVKELTQGIIS 494

Query: 467 HFSLRTSYRPSDIRNPLLRNFYSTLYH-----EQSQDAKRKMPELQYLPESDSTLHKVQL 521
           HF+L++ Y   + RNP L   Y  L+      E  QD        +YL E D TL K+  
Sbjct: 495 HFNLKSGYHAEEFRNPALNRHYKLLHDYLLQVEIPQDDNDIRD--RYLRE-DDTLLKITK 551

Query: 522 VRDRI-ENSIIHD-EPPIISEYINCWNIYY 549
           +R+RI +++ I D E   +S+Y+  WNIYY
Sbjct: 552 IRERIMKDTTIDDVEKRRLSKYLEVWNIYY 581

>AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 576

 Score =  218 bits (556), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 169/566 (29%), Positives = 289/566 (51%), Gaps = 46/566 (8%)

Query: 27  NQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFR-NGR 85
           ++ IV C+ELS  +  P+  L+G   +LE++ ALL ++E+L+ V P++ VGC  F+   R
Sbjct: 31  HEGIVFCVELSHNMYKPSPELEGKKQLLEILEALLELMEQLVAVMPDTGVGCYFFQCRHR 90

Query: 86  RAEDGIVEAFPLRPLDANYVRNISDCVADLEETGM--VGQHFPFTATVPASLDVMLAASD 143
            A+ GI E FPLR ++  +++ +   +  +  TG   + +  P+    P SLDV+  +  
Sbjct: 91  EAKQGIYELFPLRDVNVAHMKKVFLLLEGIR-TGKRSLEEELPYDGRHPTSLDVVFTSIQ 149

Query: 144 RYFTEDTQNA----DNRIFLVTDVDTPVE---FTDPIRLEKVQARLLSLYRRRIDITTFF 196
             F ++        + +IFL TD D+P E        RL KV   L   Y   I+ +TFF
Sbjct: 150 DQFLQEVPEQRLYNNKKIFLFTDNDSPPEKESLGSRTRLRKVVDDLNDYY---INFSTFF 206

Query: 197 LHTEHAAFNDSSYAEILKT-REWGIPGAPQ------STSPLSICKLREKMLSQKDLNRAY 249
           + TE   F++S Y++ILK   +    G+ +      ST P+S+  +R ++L +K++ R  
Sbjct: 207 IGTEQRPFDESFYSDILKLGAQVAAEGSSKPLYDGPSTKPISVSYIRSRVLRKKEVRRLR 266

Query: 250 FSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKYKTVDNEKYI 309
           +SCPL +N+   LVVSV GY ATT+ERPG RY+ + +H+   +     R+Y   D  +  
Sbjct: 267 YSCPLFLNEEQGLVVSVKGYAATTYERPGARYRMVYQHEDVQREAFSHRRYLDPDTGEEA 326

Query: 310 RDADRSSVYWIGGAGIEVTDAELRKMTR-GCSKYESFLEILGFRAINTAAPYYSNIGRAY 368
            + D   VY IG   +++ D     +T       +SFL +LG R      PYY+NI    
Sbjct: 327 TE-DLCKVYQIGDDCLDLPDDLENLITNFAAPTSDSFLRMLGSRTAVAVLPYYNNIHHVT 385

Query: 369 YILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKA--GFHPTLFALIPSDGETCALR 426
           +++P +  ++GSA VLASL+R++    +A +++G+L+A         A   +        
Sbjct: 386 FLVPDDSVYAGSAAVLASLHRTLRASQRAVVLYGKLRATSLPALYALAPAAAPLPDAVFI 445

Query: 427 LVRIPFIEEVRCFPTLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPSDIRNPLLRN 486
           L R+PF EEVR FP L        + +Y +++ ++  +I    L + Y P+D +NP++  
Sbjct: 446 LARLPFQEEVRKFPALSPPQASLASPDYAVLQKITSRIIDLLVLSSPYAPADFKNPVIAT 505

Query: 487 FYSTL---YHEQSQDAKRKMPELQYLPESDSTLHKVQLVRDRIENSIIHDEPPIISEYIN 543
            +  L     E +QD           P +D T+ ++  +R R+ +    D    +++Y+ 
Sbjct: 506 HFRLLSDHLFETAQD-----------PRTDDTIARLLRLRHRVLD----DPESRLAKYLR 550

Query: 544 CWNIYY---NHIIDKAVYEYGAPKRP 566
            WN +Y     +   +  +Y   +RP
Sbjct: 551 HWNAFYARHQQVASPSPTKYSKRRRP 576

>Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON}
           complement(1..1542) [1542 nt, 514 aa]
          Length = 514

 Score =  209 bits (531), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 132/475 (27%), Positives = 252/475 (53%), Gaps = 27/475 (5%)

Query: 25  DRNQNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFR-N 83
           D ++ I+ C+ELS+ +      L     +LE++ +LL ++ +L+I +P + VGC  +  +
Sbjct: 45  DVHEGIMFCVELSEQMFQQLPELNYKVQLLEILESLLELMSQLVITRPGTGVGCYIYNCH 104

Query: 84  GRRAEDGIVEAFPLRPLDANYVRNISDCVADL-EETGMVGQHFPFTATVPASLDVMLAAS 142
              + + I    PL  ++   ++ ++D + DL  E   + ++FP+  T    L+ +L  +
Sbjct: 105 KDNSNNNIFNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKTQRTPLESLLELT 164

Query: 143 DRYFTEDTQNA----DNRIFLVTDVDTPVEFTDPIRLEKVQARLLSLY----RRRIDITT 194
                ++        + ++FL TD D+P E +D    +  +ARL  L+       I    
Sbjct: 165 QDELVKNVSTPKPFNNKKVFLFTDNDSPTEASD----KAGKARLRRLFDDNNENFITFVP 220

Query: 195 FFLHTEHAAFNDSSYAEILK-------TREWGIPGAPQSTSPLSICKLREKMLSQKDLNR 247
           FF++ E+  F+ S Y++I K       + ++ I     ST P+S   ++ ++L ++++ R
Sbjct: 221 FFINRENKPFDSSFYSDIFKLGNSENPSSDYEIEFDGPSTRPISASYIKSRVLRKQEIKR 280

Query: 248 AYFSCPLVINKTADLVVSVAGYVATTHERPGTRYKYIVKHDGRTKSVHQCRKYKTVDNEK 307
             F C L++NK  +  V++ GY   + E+ G+RYK + +H+   K     RK       +
Sbjct: 281 VLFQCSLILNKEMNFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCITAE 340

Query: 308 YIRDADRSSVYWIGGAGIEVTDAELRKMTRGCSKYESFLEILGFRAINTAAPYYSNIGRA 367
            +++   + V+  G   IE+++ +++K+     +   FL++LGFR++  +  YY+NI + 
Sbjct: 341 EVKEG-LTKVFPYGDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNITKP 399

Query: 368 YYILPRELPFSGSAKVLASLNRSMFEKGKAAIVWGQLKAGFHPTLFALIPSDGE--TCAL 425
            +++P E    GS ++LASL R+M +K K A++WG+LK   HP L+ L  S+        
Sbjct: 400 SFVVPDESKIDGSIRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNEGF 459

Query: 426 RLVRIPFIEEVRCFP---TLDGEDRLFHTREYELVKTVSQNLIRHFSLRTSYRPS 477
            L RIPF++E+R FP   T   ++   +T EYE +K  ++N++ +F+L+  Y PS
Sbjct: 460 FLYRIPFLDEIRKFPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514

>TBLA0H00600 Chr8 complement(122446..126195) [3750 bp, 1249 aa] {ON}
            Anc_8.434 YLR223C
          Length = 1249

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 146  FTEDTQN--ADNRIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRR 189
             T + QN  +D  I L TD D     T P+RLE       S++RRR
Sbjct: 1151 MTNNNQNGSSDAEIMLSTDADILASLTAPVRLEDFDEENGSMWRRR 1196

>NDAI0J00960 Chr10 complement(214481..221710) [7230 bp, 2409 aa] {ON}
            Anc_8.331 YDR150W
          Length = 2409

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 504  PELQYLPESDSTLHKVQLVRDRIENSIIHDEPPIISEYINCWNIYYNHIIDKAVYEYGAP 563
            P L+YL +  ++L    + +D   N +   E P +   ++  N Y   +ID+A  EY   
Sbjct: 1004 PSLEYLTDKANSLDMTLINKDEKNNLLDQQENPTLDYLVSKCNSYNKTVIDEA--EYTDL 1061

Query: 564  KRPLKYFTGDTLH 576
             R L+Y T + LH
Sbjct: 1062 VRRLQYPTFEELH 1074

>Ecym_4460 Chr4 (939029..941224) [2196 bp, 731 aa] {ON} similar to
           Ashbya gossypii ADR023C
          Length = 731

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 23/107 (21%), Positives = 47/107 (43%)

Query: 451 TREYELVKTVSQNLIRHFSLRTSYRPSDIRNPLLRNFYSTLYHEQSQDAKRKMPELQYLP 510
           T E+     +   LI   +       S +R  L     +T +        +K+P L+ L 
Sbjct: 455 TAEFNFSMKILDKLISSITSNIPREASTVRLMLKTKMLTTKFTHNDTLTMKKVPVLKVLV 514

Query: 511 ESDSTLHKVQLVRDRIENSIIHDEPPIISEYINCWNIYYNHIIDKAV 557
              S+    ++ R  +E  ++H +   +S++IN   I+YN + D+++
Sbjct: 515 NVLSSKQVERMERFALERVLLHGDHETLSKHINDIRIFYNELRDESM 561

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,219,576
Number of extensions: 2791845
Number of successful extensions: 6640
Number of sequences better than 10.0: 28
Number of HSP's gapped: 6668
Number of HSP's successfully gapped: 29
Length of query: 602
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 487
Effective length of database: 40,294,809
Effective search space: 19623571983
Effective search space used: 19623571983
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)