Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ABL019W3.454ON43143123310.0
Ecym_24653.454ON43839214480.0
SAKL0B06116g3.454ON43138912731e-174
KLTH0E13948g3.454ON43838812651e-172
Kpol_1035.93.454ON42742912401e-169
YGR110W (CLD1)3.454ON44541812261e-166
KNAG0B009503.454ON41841912061e-164
Skud_7.4153.454ON45243512001e-162
Kwal_27.123173.454ON43538811951e-162
NCAS0E008603.454ON44039111691e-158
Suva_7.3953.454ON45141111701e-158
Smik_6.2003.454ON44542011691e-158
TDEL0F033903.454ON42439511631e-157
ZYRO0C06270g3.454ON43039711541e-156
NDAI0G010903.454ON45639511501e-155
KAFR0I019703.454ON41138911141e-150
TPHA0O013103.454ON43844411041e-148
CAGL0L04686g3.454ON45142210721e-143
KLLA0B12914g3.454ON4264299911e-131
TBLA0F034603.454ON4414059161e-119
SAKL0G19074gna 1ON4324184572e-51
Kwal_14.985na 1ON4354134432e-49
KLTH0C01254gna 1ON4344244328e-48
Ecym_5577singletonON4334213645e-38
TDEL0F041008.284ON4343401774e-13
KAFR0B053808.284ON4113321755e-13
Skud_12.1678.284ON3943441747e-13
Kwal_56.237028.284ON4163411666e-12
YLR099C (ICT1)8.284ON3943341658e-12
KLLA0F19624g8.284ON4093291641e-11
Suva_10.1838.284ON3943441595e-11
KNAG0G021408.284ON4082731596e-11
Skud_4.3868.284ON4463461587e-11
Smik_12.1588.284ON3943461542e-10
YDR125C (ECM18)8.284ON4533551542e-10
AGR062C8.284ON3843201515e-10
Kpol_543.498.284ON4293521462e-09
Suva_2.2888.284ON4353911463e-09
ZYRO0D06666g8.284ON3803741453e-09
CAGL0B01969g8.284ON4233321444e-09
KLTH0G13178g8.284ON4153411435e-09
KNAG0H031208.284ON4343641411e-08
TPHA0A016908.284ON4053731401e-08
Smik_4.3718.284ON4353891382e-08
NCAS0B037108.284ON4303341373e-08
Ecym_42858.284ON4053371363e-08
NDAI0J012108.284ON4163411338e-08
CAGL0M11462g8.284ON3863611321e-07
KAFR0B028308.284ON3913401258e-07
NCAS0B051208.284ON3962571241e-06
SAKL0H16500g8.284ON4193371222e-06
NDAI0J01200singletonON4273901213e-06
TBLA0H014008.284ON4211581178e-06
KNAG0A037708.524ON3561161052e-04
Kwal_27.119758.524ON3361541042e-04
ZYRO0F09064g8.524ON3491991034e-04
SAKL0H10450g8.524ON3921181025e-04
KAFR0E03110singletonON3561081016e-04
TPHA0L016008.524ON3721141009e-04
NDAI0C054308.524ON362114990.001
CAGL0M05467g8.524ON354130920.008
NCAS0B022608.524ON363151860.041
KLTH0E12188g8.524ON336141850.055
TBLA0H035408.524ON378116810.20
TDEL0B032508.524ON34899750.93
Skud_2.3318.524ON376115751.00
Kwal_27.97308.867ON70349751.3
KLTH0E16258g8.867ON70849713.3
KLLA0A10395gna 2ON29461703.9
Skud_14.400na 3ON29365686.1
YNR064Cna 3ON29065686.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ABL019W
         (431 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-synteni...   902   0.0  
Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}...   562   0.0  
SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {...   494   e-174
KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]...   491   e-172
Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON...   482   e-169
YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}  CLD1Mitoch...   476   e-166
KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.4...   469   e-164
Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W ...   466   e-162
Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]...   464   e-162
NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454    454   e-158
Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W ...   455   e-158
Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W ...   454   e-158
TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.4...   452   e-157
ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} simila...   449   e-156
NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454    447   e-155
KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON}              433   e-150
TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {...   429   e-148
CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} simil...   417   e-143
KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} simi...   386   e-131
TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON}              357   e-119
SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON} cons...   180   2e-51
Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON...   175   2e-49
KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {...   171   8e-48
Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar...   144   5e-38
TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {O...    73   4e-13
KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON} Anc_8...    72   5e-13
Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {...    72   7e-13
Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {...    69   6e-12
YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON} ...    68   8e-12
KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]...    68   1e-11
Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {...    66   5e-11
KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {O...    66   6e-11
Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON...    65   7e-11
Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {...    64   2e-10
YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}  ...    64   2e-10
AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON} S...    63   5e-10
Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {O...    61   2e-09
Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON...    61   3e-09
ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} simila...    60   3e-09
CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {...    60   4e-09
KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} simi...    60   5e-09
KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.2...    59   1e-08
TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.2...    59   1e-08
Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON...    58   2e-08
NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284     57   3e-08
Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar t...    57   3e-08
NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8....    56   8e-08
CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa...    55   1e-07
KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {O...    53   8e-07
NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {O...    52   1e-06
SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} simi...    52   2e-06
NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON}              51   3e-06
TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.2...    50   8e-06
KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {O...    45   2e-04
Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR2...    45   2e-04
ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} simila...    44   4e-04
SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {...    44   5e-04
KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON}               44   6e-04
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    43   9e-04
NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON} Anc_8...    43   0.001
CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa] ...    40   0.008
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    38   0.041
KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} simi...    37   0.055
TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.5...    36   0.20 
TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {O...    33   0.93 
Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON...    33   1.00 
Kwal_27.9730 s27 complement(37595..39706) [2112 bp, 703 aa] {ON}...    33   1.3  
KLTH0E16258g Chr5 (1444885..1447011) [2127 bp, 708 aa] {ON} simi...    32   3.3  
KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {O...    32   3.9  
Skud_14.400 Chr14 complement(717609..718490) [882 bp, 293 aa] {O...    31   6.1  
YNR064C Chr14 complement(749136..750008) [873 bp, 290 aa] {ON} E...    31   6.8  

>ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR110W
          Length = 431

 Score =  902 bits (2331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/431 (100%), Positives = 431/431 (100%)

Query: 1   MRSHRTGTHLLNTLKALHRRNFGDQVQAPRKDGRHIHTVRKPTPPTAVPLYEIIRNLPNL 60
           MRSHRTGTHLLNTLKALHRRNFGDQVQAPRKDGRHIHTVRKPTPPTAVPLYEIIRNLPNL
Sbjct: 1   MRSHRTGTHLLNTLKALHRRNFGDQVQAPRKDGRHIHTVRKPTPPTAVPLYEIIRNLPNL 60

Query: 61  FPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERAREGKIGKIIRTPVDDEGNYINEFC 120
           FPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERAREGKIGKIIRTPVDDEGNYINEFC
Sbjct: 61  FPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERAREGKIGKIIRTPVDDEGNYINEFC 120

Query: 121 IRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRC 180
           IRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRC
Sbjct: 121 IRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRC 180

Query: 181 QFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNH 240
           QFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNH
Sbjct: 181 QFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNH 240

Query: 241 FKKLIMCSPAGISPSKSMKKQPPWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFR 300
           FKKLIMCSPAGISPSKSMKKQPPWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFR
Sbjct: 241 FKKLIMCSPAGISPSKSMKKQPPWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFR 300

Query: 301 HLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHG 360
           HLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHG
Sbjct: 301 HLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHG 360

Query: 361 FKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKI 420
           FKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKI
Sbjct: 361 FKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKI 420

Query: 421 LLREMQSIMQT 431
           LLREMQSIMQT
Sbjct: 421 LLREMQSIMQT 431

>Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}
           similar to Ashbya gossypii ABL019W
          Length = 438

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/392 (65%), Positives = 310/392 (79%), Gaps = 1/392 (0%)

Query: 38  TVRKPTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERAR 97
           T  KPTPPTA+PL EI+ N+P+LFP+P  +SW+DYK F  D + FQ GLLSTLPFF  A 
Sbjct: 39  TSPKPTPPTAIPLMEILLNIPSLFPMPLKESWKDYKIFHDDVDKFQTGLLSTLPFFPSAA 98

Query: 98  EGKIGKIIRTPVDDEGNYINEFCIRPASMEEN-HGAATNHLIFIHGYGAGLGFFIKNFEH 156
           +GKIG+IIRTPVD+EGNYINEFCIRP S   N   +  +HLIF+HGYGAGLGFF+KNFE+
Sbjct: 99  DGKIGEIIRTPVDEEGNYINEFCIRPNSPPVNPKDSKMHHLIFVHGYGAGLGFFLKNFEN 158

Query: 157 LPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPH 216
           + LL++ W IHAID PGYG+S+R +FPF +N ++  EVE WFH+R E WL KRGLL+   
Sbjct: 159 IKLLNNSWTIHAIDFPGYGFSSRPKFPFSINKNTASEVENWFHDRFEIWLQKRGLLEDQE 218

Query: 217 RNMVMAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPSKSMKKQPPWWFIKLWDRNVSP 276
           RN+V+AHS+GAYL A YAQSR  H KKLIMCSPAGI PS  + KQPPWWF+KLWDRN+SP
Sbjct: 219 RNLVLAHSLGAYLIALYAQSRPKHLKKLIMCSPAGICPSNKVIKQPPWWFVKLWDRNLSP 278

Query: 277 FSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSF 336
           FSLVRNSG  GSKLTSGWSFRRF+  LNEG +G  QF+ALH+Y+YAIFN PGSGEYLLSF
Sbjct: 279 FSLVRNSGIFGSKLTSGWSFRRFKQFLNEGTMGESQFQALHRYAYAIFNKPGSGEYLLSF 338

Query: 337 VLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGK 396
           VLKCGGDPR PLL  +F+ +    FKAQC+WLW+YGD  WMD +GG++AS +I   IG +
Sbjct: 339 VLKCGGDPRSPLLSRLFNSQAADSFKAQCDWLWMYGDQDWMDCKGGEQASDFIVRHIGKE 398

Query: 397 SRVEIVPNSGHHLYFDNYSYFNKILLREMQSI 428
           S V ++P SGHHLY DNYS FN++L  EM  +
Sbjct: 399 SNVHVIPQSGHHLYLDNYSVFNELLQAEMAKM 430

>SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {ON}
           similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 431

 Score =  494 bits (1273), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 231/389 (59%), Positives = 294/389 (75%), Gaps = 5/389 (1%)

Query: 40  RKPTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERAREG 99
           +K TPPTA+PL +I   LPNLFPL    S  DY  F+ + E+FQ  LLSTLPF+     G
Sbjct: 46  QKSTPPTAMPLIQIATQLPNLFPLSFEASIRDYSMFQENAESFQSQLLSTLPFYPSPANG 105

Query: 100 KIGKIIRTPVDDEGNYINEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPL 159
           +  +I++TPVDDEGNYINEF I+P  M  +  ++  HLIF+HGYGAGLGFF+KNFE++PL
Sbjct: 106 RSSEILKTPVDDEGNYINEFTIKP--MNPSSSSSMKHLIFVHGYGAGLGFFLKNFENIPL 163

Query: 160 LDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNM 219
           L++ W IHAIDLPGYG+S+R +FPF+   H+   VE WFH+R++ WL KRGLL  P  N+
Sbjct: 164 LNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQRIKGWLHKRGLLANPKNNL 223

Query: 220 VMAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPSKSMKKQPPWWFIKLWDRNVSPFSL 279
           ++AHS+GAY++A YA    NHF KLIMCSPAGI PS  + + PP WF+KLWDRN+SPFSL
Sbjct: 224 LVAHSLGAYISALYANKFPNHFSKLIMCSPAGICPSPKLGQAPPQWFVKLWDRNISPFSL 283

Query: 280 VRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLK 339
           VRNS  LGSKLTSGW++RRFR  L EG+ G  Q +A+HKY+YAIFN PGSGEYLLSF LK
Sbjct: 284 VRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALK 343

Query: 340 CGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSRV 399
           CGGDPR+PL   +F  +    FKA C+WLWLYGD  WMD  GGQRAS ++  +IG KS V
Sbjct: 344 CGGDPRLPLEKRLF--DNTSSFKANCDWLWLYGDEDWMDLRGGQRASEFL-KKIGMKSDV 400

Query: 400 EIVPNSGHHLYFDNYSYFNKILLREMQSI 428
           ++VP++GHHLY DNY +FN ++++EM+ +
Sbjct: 401 KVVPSAGHHLYLDNYKHFNNVVIKEMEKM 429

>KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]
           {ON} similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 438

 Score =  491 bits (1265), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 236/388 (60%), Positives = 291/388 (75%), Gaps = 5/388 (1%)

Query: 41  KPTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERAREGK 100
           +P+ P+A+PL E++ NLP LFP    +S  DY AF+ D    Q  LLSTLPFF  A + K
Sbjct: 50  RPSSPSAIPLRELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDK 109

Query: 101 IGKIIRTPVDDEGNYINEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLL 160
           + ++++TPVD++ NYINEFC+RPA M    G    HLI +HGYGAGLGFF+KN E L L+
Sbjct: 110 VAEVVQTPVDEQANYINEFCVRPA-MPHPSGT-LRHLIIVHGYGAGLGFFLKNLEKLNLI 167

Query: 161 DDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMV 220
           D++WVIHAIDLPGYG+S+R +FP+   +    +VE WFH R +TWL KRGLLQ P +NM+
Sbjct: 168 DNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGLLQHPEQNML 227

Query: 221 MAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGI--SPSKSMKKQPPWWFIKLWDRNVSPFS 278
           +AHSMGAYL A YA    NHFKKL+MCSPAGI  +PS   ++ PPWWF KLWDRN+SPFS
Sbjct: 228 VAHSMGAYLAALYANKYPNHFKKLVMCSPAGICNTPSNKQRRLPPWWFAKLWDRNISPFS 287

Query: 279 LVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVL 338
           LVRNS  LGSKLTSGWS+RRF  LL+EG  G +QFEA+HKY+YAIFN PGSGEYLLSF L
Sbjct: 288 LVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFAL 347

Query: 339 KCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSR 398
           KCGGDPR  L   +F   K + FKA+CEWLWLYGD  WMD  GG+R S ++   +G KS+
Sbjct: 348 KCGGDPRDALERRLFH-NKMNQFKAKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSK 406

Query: 399 VEIVPNSGHHLYFDNYSYFNKILLREMQ 426
           VE+V +SGHHLYFDNY  FN+IL +EM+
Sbjct: 407 VEVVHDSGHHLYFDNYEQFNRILEKEMK 434

>Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON}
           complement(19721..21004) [1284 nt, 428 aa]
          Length = 427

 Score =  482 bits (1240), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 235/429 (54%), Positives = 296/429 (68%), Gaps = 15/429 (3%)

Query: 9   HLLNTLKALHRRNFGDQVQA----PRKDGRHIHTVRKPTPPTAVPLYEIIRNLPNLFPLP 64
           +L+ T K+    NF  +  A    P +D + + TV  P  P A+PLYEII  LPNLFP  
Sbjct: 5   NLIRTSKSFISNNFNFRRVATSGVPSRDEK-LPTV--PAAPAAIPLYEIILKLPNLFPRT 61

Query: 65  TSQSWEDYKAFKSDREAFQVGLLSTLPFFERAREGKIGKIIRTPVDDEGNYINEFCIRPA 124
             +S  DY  F  D + FQ  LLSTLP++  A +GK  ++I T VDDEGNYINEFCI P 
Sbjct: 62  LKESLNDYHDFHKDIDKFQTELLSTLPYYPMANDGKKAELITTKVDDEGNYINEFCISPI 121

Query: 125 SMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPF 184
             E +      HLIFIHGYGAGLGFF+KNFEHLPLLD++W IHAIDLPGYGYS RC+FPF
Sbjct: 122 GAEADQ-RDLKHLIFIHGYGAGLGFFLKNFEHLPLLDNKWCIHAIDLPGYGYSKRCEFPF 180

Query: 185 DVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNHFKKL 244
               H + +V+ WFH+R+ TW   R LL  P  NM+MAHS+GAYL A Y     N FKK+
Sbjct: 181 KYPEHDISDVQDWFHKRIRTWFKARSLLTTPENNMIMAHSLGAYLMALYIDKFPNDFKKI 240

Query: 245 IMCSPAGISPSKSMKK----QPPWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFR 300
           +MCSPAGI  S + ++    + PWWF KLWD+NVSPF+LVRN+  LGSKLTSGWS+RRF+
Sbjct: 241 VMCSPAGICQSSTSEEIGNIKTPWWFNKLWDQNVSPFTLVRNTYYLGSKLTSGWSYRRFK 300

Query: 301 HLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHG 360
            L   G   + QFE LH+Y+Y+IFN  GSGEY+L F LKCGGDPRIPL  ++F   K  G
Sbjct: 301 QLKQSGH--LMQFEKLHRYAYSIFNQKGSGEYILGFALKCGGDPRIPLEDNLFKSPKTEG 358

Query: 361 F-KAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNK 419
             K+ CEWLW+YG+  WMD  GG+R +  +  R G KS   +VP+SGHHLYFDNY +FN+
Sbjct: 359 IPKSDCEWLWVYGEKDWMDIGGGKRVTDELVTRFGKKSSTTVVPDSGHHLYFDNYKFFNE 418

Query: 420 ILLREMQSI 428
           +L++EM+++
Sbjct: 419 LLVKEMKNM 427

>YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}
           CLD1Mitochondrial cardiolipin-specific phospholipase;
           functions upstream of Taz1p to generate
           monolyso-cardiolipin; transcription increases upon
           genotoxic stress; involved in restricting Ty1
           transposition; has homology to mammalian CGI-58
          Length = 445

 Score =  476 bits (1226), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 234/418 (55%), Positives = 296/418 (70%), Gaps = 19/418 (4%)

Query: 27  QAPRKDGRHI---HTVRKPTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQ 83
           Q+PR   R +     +R P+ PTA+PL EII  +P+LFP P   S +D++ F  + +AFQ
Sbjct: 31  QSPRASARDVTEKQILRTPSAPTAIPLREIIYRVPSLFPRPLEDSVKDFRDFIKNEDAFQ 90

Query: 84  VGLLSTLPFFERAREGKIGKIIRTPVDDEGNYINEFCIRP--ASMEENHGAATNHLIFIH 141
             LL TLPF+    E K  ++IRT VDDEGNYINEFCIRP   S+ E   A   HL+FIH
Sbjct: 91  TELLKTLPFYPTPSESKTARLIRTVVDDEGNYINEFCIRPRKTSVPE---ADLKHLVFIH 147

Query: 142 GYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHER 201
           GYGAGLGFFIKNFE +PLLD++W IHAIDLPGYG+S+R +FPF+    ++  V+ WFHER
Sbjct: 148 GYGAGLGFFIKNFEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPRDNIHSVQDWFHER 207

Query: 202 LETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQN--HFKKLIMCSPAGIS------ 253
           + TW SKR LL  P +N+VMAHS+G+YL A Y Q  +    FKKLI+CSPAG+S      
Sbjct: 208 IHTWFSKRNLLNRPEKNIVMAHSLGSYLMALYLQKYKESPSFKKLILCSPAGVSYRDFNN 267

Query: 254 -PSKSMK-KQPPWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMR 311
             S+  K K PPWW++KLWDRN+SPF+LVRN   LGSK+TSGWS+RRF+H+LN      +
Sbjct: 268 TASEVEKWKPPPWWYVKLWDRNISPFTLVRNFRQLGSKITSGWSYRRFKHILNGDPEQSK 327

Query: 312 QFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFK-AQCEWLWL 370
           +FEALH+Y+YAIFN  GSGEYLLSF LKCGG+PR+ L   +F  +K    K + C+WLWL
Sbjct: 328 RFEALHRYAYAIFNKRGSGEYLLSFALKCGGEPRLSLEQQLFDGKKSDILKNSNCDWLWL 387

Query: 371 YGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILLREMQSI 428
           YGD  WMD  GG R S ++ +++  KS V IVP+SGHHLY DNY +FN IL +EMQ I
Sbjct: 388 YGDDDWMDVNGGLRVSRFLKEKLKQKSNVIIVPHSGHHLYLDNYKFFNNILTKEMQKI 445

>KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.454
           YGR110W
          Length = 418

 Score =  469 bits (1206), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 231/419 (55%), Positives = 298/419 (71%), Gaps = 13/419 (3%)

Query: 10  LLNTLKALHRRNFGDQVQAPRKDGRHIHTVRKPTPPTAVPLYEIIRNLPNLFPLPTSQSW 69
           +LN LK    +N    V+  ++    ++ V+ PT PTA+PL EII  LP LFP   +QS 
Sbjct: 13  VLNRLKVFDLKN----VRFRKQSDSRVY-VKTPTAPTAIPLTEIIVKLPYLFPRGVAQSL 67

Query: 70  EDYKAFKSDREAFQVGLLSTLPFFERAREGKIGKIIRTPVDDEGNYINEFCIRPASMEEN 129
           EDYK F ++ +  Q  LLSTLPFF  A++GK  +I+RT +D++ N+INEF I+PA++ E 
Sbjct: 68  EDYKVFSNNADKIQYDLLSTLPFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQPANVTE- 126

Query: 130 HGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTH 189
             +   HLIFIHGYGAGLGFF+KNFE++ L D+ W IHAIDLPG+G+S+R +FPF     
Sbjct: 127 -PSKLKHLIFIHGYGAGLGFFLKNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPFKYPED 185

Query: 190 SVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNHFKKLIMCSP 249
            V +V+ WFHERL+ W  KR LL+ P  NMV+AHS+GAYL A Y ++   HFKKLIMCSP
Sbjct: 186 DVSKVQTWFHERLKIWFEKRDLLKNPGNNMVVAHSLGAYLMALYKRNNPLHFKKLIMCSP 245

Query: 250 AGISPSKSMKKQPPWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIG 309
           AG+  S  +KKQPPWW+  LWD N+SPFSLVRNSG LGSKLTSGWS+RRFR L ++    
Sbjct: 246 AGMCNSTVVKKQPPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSLHSK---- 301

Query: 310 MRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLW 369
             QFE LH YSYAIFN PG GEYLL+F L+CGGDPR+ L  ++F+ +  + + +  EW+W
Sbjct: 302 -IQFENLHLYSYAIFNRPGCGEYLLAFALRCGGDPRVSLEATLFN-DVVNKWDSDSEWVW 359

Query: 370 LYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILLREMQSI 428
           LYGD  WMD +GG+R S  I +   GKS VE++PN+GHHLYFDN S FN IL +EM  +
Sbjct: 360 LYGDRDWMDVKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTKL 418

>Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W
           (REAL)
          Length = 452

 Score =  466 bits (1200), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 226/435 (51%), Positives = 302/435 (69%), Gaps = 18/435 (4%)

Query: 7   GTHLLNTLKALHRRNFGDQVQAPRKDGRHIHTVRKPTPPTAVPLYEIIRNLPNLFPLPTS 66
           G  LL    +   R+  D+  +P +DG     +R P+ PTA+PL EII  +P LFP P  
Sbjct: 22  GLQLLTGANSSITRSESDE--SPERDGTEERILRTPSAPTAIPLREIIYKVPGLFPRPLE 79

Query: 67  QSWEDYKAFKSDREAFQVGLLSTLPFFERAREGKIGKIIRTPVDDEGNYINEFCIRPA-- 124
            S +D++ F  + + FQ  LL TLPF+    + K  K+I+T VDD+GNYINEFCI P   
Sbjct: 80  DSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKKSKLIKTVVDDDGNYINEFCIYPQKP 139

Query: 125 SMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPF 184
           S+ E       HL+FIHGYGAGLGFFIKN E +PLLD++W IHAIDLPGYG+S+R +FPF
Sbjct: 140 SVPE---TELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYGFSSRPKFPF 196

Query: 185 DVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNH--FK 242
           +    ++  V+ WFHER+ TW +KR LL  P +N+V+AHS+G+YL A Y Q  +    FK
Sbjct: 197 EYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQKYKESPSFK 256

Query: 243 KLIMCSPAGIS--------PSKSMKKQPPWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGW 294
           KL++CSPAG+S              K PPWW++KLWDRN+SPF+LVRN+  LGSK+TSGW
Sbjct: 257 KLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFTLVRNARQLGSKITSGW 316

Query: 295 SFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFS 354
           S+RRF+H+LN      R+FEALH+Y+Y+IFN  GSGEYLLSF L+CGG+PR+PL   +F+
Sbjct: 317 SYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFALRCGGEPRLPLEEQLFN 376

Query: 355 PEKEHGFK-AQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDN 413
            E     K +  EW+WLYG+  WMD +GG R S Y+ +++G KS V IVP++GHHLY DN
Sbjct: 377 GENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQKSNVFIVPHAGHHLYLDN 436

Query: 414 YSYFNKILLREMQSI 428
           Y++FNKIL++EMQ++
Sbjct: 437 YTFFNKILVKEMQNV 451

>Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]
           {ON} YGR110W - Hypothetical ORF [contig 20] FULL
          Length = 435

 Score =  464 bits (1195), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 223/388 (57%), Positives = 278/388 (71%), Gaps = 5/388 (1%)

Query: 41  KPTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERAREGK 100
           KP+ P+A+PL EII  LPNLFP    QS  D+K FK +  A Q  LL+TLPFF      +
Sbjct: 50  KPSSPSAIPLNEIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRR 109

Query: 101 IGKIIRTPVDDEGNYINEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLL 160
             +IIRT VD +GNYINEF IRP +++ +      HLI +HGYGAGLGFF+K FE+L L+
Sbjct: 110 TAEIIRTTVDAQGNYINEFNIRPTAVDTS--KTMKHLILVHGYGAGLGFFLKTFENLNLI 167

Query: 161 DDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMV 220
           ++ W+IHAIDLPGYG+S+R  FPF V   +  +VE WFH R   W+ +RGLL+ P  NMV
Sbjct: 168 NENWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMV 227

Query: 221 MAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGI--SPSKSMKKQPPWWFIKLWDRNVSPFS 278
           +AHSMGAYLTA YA     HFKKL+MCSPAG+  S  +  K+ PPWWF KLWD+N+SPFS
Sbjct: 228 VAHSMGAYLTALYANKHPGHFKKLVMCSPAGVCHSAPEMRKRPPPWWFAKLWDKNISPFS 287

Query: 279 LVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVL 338
           LVRN+  LGSKLTSGWS+RR   LL +  +  RQ EALH+Y+YAIFN  GSGEYLLSF L
Sbjct: 288 LVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEYLLSFAL 347

Query: 339 KCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSR 398
           +CGG+PR+PL   +F   +   FKA CEWLWLYGD  W+D+ GG+R S ++T  +G +S 
Sbjct: 348 QCGGEPRVPLERRLFH-NRGQQFKANCEWLWLYGDQDWIDRRGGERVSQFLTAEMGHESC 406

Query: 399 VEIVPNSGHHLYFDNYSYFNKILLREMQ 426
           V+IV NSGHHLY DN+  FNKIL  EM+
Sbjct: 407 VKIVKNSGHHLYLDNHRMFNKILEDEMR 434

>NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454
          Length = 440

 Score =  454 bits (1169), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 216/391 (55%), Positives = 279/391 (71%), Gaps = 8/391 (2%)

Query: 43  TPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERAREGKIG 102
           TPP A+P+ +II +LP+LFP     S  DY  F +D ++ Q+ LL TLPFF      K+ 
Sbjct: 52  TPPVAIPITDIITSLPSLFPRSLHDSRRDYNTFTTDIDSLQLNLLKTLPFFPMGSSQKVA 111

Query: 103 KIIRTPVDDEGNYINEFCIRPASMEENHGAAT-NHLIFIHGYGAGLGFFIKNFEHLPLLD 161
           K+IRTP+DDEGNYINEFCI PA  + ++ +    HLIFIHGYGAGLGFF+KN E++PLLD
Sbjct: 112 KLIRTPIDDEGNYINEFCIMPAVKDGDYSSPDLKHLIFIHGYGAGLGFFLKNLENIPLLD 171

Query: 162 DQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVM 221
           ++W IHAIDLPGYG+S+R +FPF     S  +V+ WFH+R+  W  +R LLQ P  N+VM
Sbjct: 172 NKWCIHAIDLPGYGFSSRFKFPFHYPNDSQTKVQKWFHDRIYRWFRERNLLQNPQNNLVM 231

Query: 222 AHSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPSKSMK--KQPPWWFIKLWDRNVSPFSL 279
           AHS+GAYL AHYA    NHFKK+IMCSPAG+S     K  KQPPWW+ KLWD N SPFSL
Sbjct: 232 AHSLGAYLMAHYAFHFSNHFKKIIMCSPAGVSQFAVGKQNKQPPWWYNKLWDLNYSPFSL 291

Query: 280 VRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLK 339
           VRNSG  GSK+TSGWS+RRF+     G +   QFEALHKY+Y IFN  GSGEYLLSF+L 
Sbjct: 292 VRNSGIYGSKITSGWSYRRFKPTSFNG-LNESQFEALHKYTYGIFNKNGSGEYLLSFILS 350

Query: 340 CGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIG--GKS 397
           CGGDPR  L  ++F  ++E+  +  C+W+W+YGD  WMD  G  R S  +  + G   KS
Sbjct: 351 CGGDPRFALEDNLF--KEENPPEDLCDWVWVYGDRDWMDINGAHRISRRLVKKAGDTSKS 408

Query: 398 RVEIVPNSGHHLYFDNYSYFNKILLREMQSI 428
           +V ++P++GHHLY DNY  FN ++++EM+++
Sbjct: 409 KVHVIPSAGHHLYLDNYKAFNNLIIKEMETM 439

>Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W
           (REAL)
          Length = 451

 Score =  455 bits (1170), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 218/411 (53%), Positives = 284/411 (69%), Gaps = 16/411 (3%)

Query: 31  KDGRHIHTVRKPTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTL 90
           KD      +R P+ PTA+PL EII  +P LFP P   S +D++ F  + ++FQ  LL+TL
Sbjct: 44  KDAAEKRILRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATL 103

Query: 91  PFFERAREGKIGKIIRTPVDDEGNYINEFCIRPA--SMEENHGAATNHLIFIHGYGAGLG 148
           PF+      K  K+I+T VDD+GNYINEFCI P   S+ E   A   HL+FIHGYGAGLG
Sbjct: 104 PFYPNPSTTKKSKLIKTIVDDDGNYINEFCIYPQVPSVPE---ADLKHLVFIHGYGAGLG 160

Query: 149 FFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSK 208
           FFIKNFE +PLL+++W +HAIDLPGYG+S+R +FPF      +  V+ WFHER+ TW  K
Sbjct: 161 FFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEK 220

Query: 209 RGLLQAPHRNMVMAHSMGAYLTAHYAQSRQN--HFKKLIMCSPAGIS--------PSKSM 258
           R LL  P +N+VMAHS+G+YL A Y Q  +    FKKLI+CSPAG+S             
Sbjct: 221 RNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEK 280

Query: 259 KKQPPWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHK 318
            K PPWW++KLWD+N+SPF+LVRNS   GSK+TSGWS+RRF+H+LN      ++FEALH+
Sbjct: 281 WKPPPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHR 340

Query: 319 YSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFK-AQCEWLWLYGDHVWM 377
           Y+Y+IFN  GSGEYLLSF LKCGG+PR+PL   +F+ +  +  K A+ EW+WLYGD  WM
Sbjct: 341 YAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWM 400

Query: 378 DKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILLREMQSI 428
           D  GG R S  + D++  KS V  VPN+GHHLY DN+ +FN I++ EMQ +
Sbjct: 401 DVNGGLRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQKV 451

>Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W
           (REAL)
          Length = 445

 Score =  454 bits (1169), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 223/420 (53%), Positives = 289/420 (68%), Gaps = 19/420 (4%)

Query: 25  QVQAPRKDGRHI---HTVRKPTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREA 81
           Q Q PR   R I      R P+ PTA+PL EII  +P LFP P   S +D++ F    + 
Sbjct: 29  QPQCPRASVRDITEKQISRTPSAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDV 88

Query: 82  FQVGLLSTLPFFERAREGKIGKIIRTPVDDEGNYINEFCIRPA--SMEENHGAATNHLIF 139
           FQ  LL TLPF+    + K  ++IRT VDD+GNYINEFCIRP   S+ E       HLIF
Sbjct: 89  FQTELLKTLPFYPNPSKLKKSRVIRTVVDDDGNYINEFCIRPINPSVPE---TELKHLIF 145

Query: 140 IHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFH 199
           IHGYGAGLGFFIKNFE +PLL+++W +HAIDLPGYG+S+R +FPF+    ++ +V+ WFH
Sbjct: 146 IHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDWFH 205

Query: 200 ERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNH--FKKLIMCSPAGISPSKS 257
           +RL TW +KR LL  P +N+VMAHS+G+YL A Y Q  +    FKKLI+CSPAG+S   S
Sbjct: 206 KRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRDS 265

Query: 258 MK--------KQPPWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIG 309
                     K PPWW++KLWDRN+SPF+LVRNS   GSK+TSGWS+RRF+H+LN     
Sbjct: 266 NNTTSEAEKWKPPPWWYVKLWDRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQ 325

Query: 310 MRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFK-AQCEWL 368
             +FEALH+Y+Y+IFN  GSGEYLLSF LKCGG+PR+PL   +F+    +  + +  EWL
Sbjct: 326 SSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWL 385

Query: 369 WLYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILLREMQSI 428
           WLYGD  WMD  GG R S ++ +++  KS V IVP++GHHLY DN  +FN IL++EM+ +
Sbjct: 386 WLYGDDDWMDVNGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMRKV 445

>TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.454
           YGR110W
          Length = 424

 Score =  452 bits (1163), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 223/395 (56%), Positives = 278/395 (70%), Gaps = 12/395 (3%)

Query: 42  PTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAF-KSDREAFQVGLLSTLPFFERAREGK 100
           P  PTA+PL EII  LP+LFP     S  DY+   +   E FQ  LL+TLPF+      +
Sbjct: 34  PAAPTAIPLREIIVKLPSLFPRSFGDSVRDYRDLCRHTDEKFQRDLLATLPFYGEGDLHR 93

Query: 101 IGKIIRTPVDDEGNYINEFCIRP--ASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLP 158
             ++IRT VDDEGNYINEF I P  AS+  +      HL+FIHGYGAGLGFF+KNFE++P
Sbjct: 94  RSEVIRTKVDDEGNYINEFYIMPKNASVPRDR---LKHLVFIHGYGAGLGFFLKNFENIP 150

Query: 159 LLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRN 218
           LL+++W IHAIDLPGYG+S+RC+FPF     +V +V  WFH+RL  W ++R LL+ P  N
Sbjct: 151 LLNNEWCIHAIDLPGYGFSSRCKFPFQYPKDTVTDVHEWFHKRLNRWFAERNLLRNPENN 210

Query: 219 MVMAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPSKSMK----KQPPWWFIKLWDRNV 274
           +VMAHS+GAYL A YA    +HFKKL+MCSPAGI  S + K    ++PPWW+ KLWDRN+
Sbjct: 211 IVMAHSLGAYLMALYASKNSSHFKKLVMCSPAGICESTTTKAIGNRKPPWWYSKLWDRNI 270

Query: 275 SPFSLVRNSGPLGSKLTSGWSFRRFRHLL-NEGEIGMRQFEALHKYSYAIFNMPGSGEYL 333
           SPFSLVR S  LGSKLTSGWS++RF  LL ++     +QFEALHKY Y+IFN PG GEYL
Sbjct: 271 SPFSLVRVSSRLGSKLTSGWSYKRFGKLLRSKSRKSEQQFEALHKYCYSIFNKPGCGEYL 330

Query: 334 LSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRI 393
           LSF L+CGGDPRIPL   +F            EWLWLYG+  WMD  GG+R S ++  + 
Sbjct: 331 LSFALRCGGDPRIPLEDMLFKTNDSGIMNGNLEWLWLYGERDWMDFNGGKRVSEHLK-KS 389

Query: 394 GGKSRVEIVPNSGHHLYFDNYSYFNKILLREMQSI 428
           G KS V IVPN+GHHLYFDNY YFN +++REM+S+
Sbjct: 390 GQKSEVCIVPNAGHHLYFDNYDYFNSLIIREMKSM 424

>ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
           Hypothetical ORF
          Length = 430

 Score =  449 bits (1154), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 211/397 (53%), Positives = 267/397 (67%), Gaps = 8/397 (2%)

Query: 39  VRKPTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERARE 98
            R P  PTA+PL++II  LP LFP     S  DYK F       Q  LL TLPF+    E
Sbjct: 35  TRVPAAPTAIPLHKIIMRLPKLFPRSVDASTRDYKDFCYHTGQLQEELLRTLPFYPYCAE 94

Query: 99  GKIGKIIRTPVDDEGNYINEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLP 158
            K  ++++T VDD+GNYINEFCI P            HLI IHGYGAGLGFF+KN E +P
Sbjct: 95  SKKAEVVKTTVDDQGNYINEFCITPVK-PSVPSHKMKHLICIHGYGAGLGFFLKNLEGIP 153

Query: 159 LLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRN 218
           LLD+ WVIHAIDLPGYG+S+R +FPF     S+ +V +WFH+R+ TW  KRGLL     N
Sbjct: 154 LLDNSWVIHAIDLPGYGFSSRPKFPFKYPKDSLSQVHSWFHDRIHTWFKKRGLLVNSQNN 213

Query: 219 MVMAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPSKSMKK----QPPWWFIKLWDRNV 274
           +VMAHS+GAYL A Y      HFKKL+MCSPAG+  S + K      PPWW+ KLWD N+
Sbjct: 214 LVMAHSLGAYLMALYTTKYTTHFKKLVMCSPAGVCKSTTAKNIGNTTPPWWYTKLWDLNI 273

Query: 275 SPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGE---IGMRQFEALHKYSYAIFNMPGSGE 331
           SPF LVRN+  LGS +TSGWS+RRF  LL       +   QFEALH+Y+YAIFN  GSGE
Sbjct: 274 SPFCLVRNAAALGSMVTSGWSYRRFNKLLQSNSNTNLDRLQFEALHRYAYAIFNRRGSGE 333

Query: 332 YLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITD 391
           YLLSF L CGGDPR+PL  ++F  +    F++ CEW+W+YG+  WMD  GG+R S +I +
Sbjct: 334 YLLSFALSCGGDPRLPLEDTIFKDKTSGIFRSNCEWIWIYGERDWMDVNGGERVSRFIEN 393

Query: 392 RIGGKSRVEIVPNSGHHLYFDNYSYFNKILLREMQSI 428
           + G KS+V + PNSGHHLYFDN+ +FN  ++++M+ +
Sbjct: 394 QGGRKSQVHVAPNSGHHLYFDNHKFFNSFIVKQMKDM 430

>NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454
          Length = 456

 Score =  447 bits (1150), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 214/395 (54%), Positives = 281/395 (71%), Gaps = 11/395 (2%)

Query: 36  IHTVRKPTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFER 95
           I+T+  PTPPTA+PL  II +LP LFP    QS +DYK F+ D E  Q+ LL TLPFF  
Sbjct: 64  INTI-APTPPTAIPLLRIITSLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSN 122

Query: 96  AREGKIGKIIRTPVDDEGNY-INEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIKNF 154
             + K GKI++T ++D  +Y INEFCI P +    + A   HLIFIHGYGAGLGFFIKN 
Sbjct: 123 GAKFKTGKILKTQIEDNDDYYINEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNL 182

Query: 155 EHLPLLDDQWVIHAIDLPGYGYSTRC-QFPFDVNTHSVREVEAWFHERLETWLSKRGLLQ 213
           E++PLL+++W IHAIDLPGYGYSTR  +FPF     S  +V+ WFH+++  WL KR LL 
Sbjct: 183 ENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLN 242

Query: 214 APHRNMVMAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPS--KSMKKQPPWWFIKLWD 271
            P  N+++AHS+GAYL A YA    +HF+KLIMCSPAG++ S  K +   PPWW+ KLWD
Sbjct: 243 YPKNNLIVAHSLGAYLMAQYAFKFPSHFQKLIMCSPAGVTKSSIKKLNNSPPWWYEKLWD 302

Query: 272 RNVSPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGE 331
            N SPFS+VRNSG  GSK+TS WS+RRF+ L    ++  +QFEALH+Y+Y+IFN PG GE
Sbjct: 303 LNFSPFSIVRNSGIYGSKITSAWSYRRFKPL----DLDHKQFEALHRYAYSIFNRPGCGE 358

Query: 332 YLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITD 391
           YLLSF+L CGG+PR  L  ++F  ++E+     C+W W+YGD+ WMD  G +R S  I +
Sbjct: 359 YLLSFILSCGGNPRFSLEDTLF--QRENLSTELCDWGWIYGDNDWMDINGAKRVSRLINE 416

Query: 392 RIGGKSRVEIVPNSGHHLYFDNYSYFNKILLREMQ 426
           +  GKS V ++P++GHHLY DNY  FNK+L++EM+
Sbjct: 417 QQKGKSDVHVIPSAGHHLYLDNYKDFNKLLIKEME 451

>KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON} 
          Length = 411

 Score =  433 bits (1114), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 205/389 (52%), Positives = 269/389 (69%), Gaps = 12/389 (3%)

Query: 43  TPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERAREGKIG 102
           + P A+PL +II  LP LFP    +S++DY+ +K   E  Q  LLSTLPF+    + K+ 
Sbjct: 32  SAPVAIPLVKIIAQLPRLFPRSIDESFKDYRVYKEGPERMQEDLLSTLPFYPNVSKDKVA 91

Query: 103 KIIRTPVDDEGNYINEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDD 162
           +II+T VD+EGNYINEFCI P +   +      HLIFIHGYGAG GFF+KN E +PLLD+
Sbjct: 92  RIIKTVVDEEGNYINEFCITPKNTVNSQ--KLKHLIFIHGYGAGFGFFLKNLESIPLLDN 149

Query: 163 QWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMA 222
            W IHAIDLPG+G+S+R  FPF   T +  EV AWFHER+  WL +R LL  P  N+++A
Sbjct: 150 NWCIHAIDLPGFGFSSRKNFPFKYPTSNTSEVTAWFHERIRRWLEERTLLDNPKNNVIVA 209

Query: 223 HSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPSKSMKK---QPPWWFIKLWDRNVSPFSL 279
           HS+GAYL A Y Q    H +KLIMCSPAG+S S++  K   QPPWW+ KLWD N+SPF+L
Sbjct: 210 HSLGAYLMALYTQVYPAHLRKLIMCSPAGVSKSQNNSKAVLQPPWWYAKLWDMNLSPFTL 269

Query: 280 VRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLK 339
           VR S  LGSKLTSGWS+RRF+ + N       QFE LH+YSYAIFN PGSGEYLL F+L+
Sbjct: 270 VRLSKHLGSKLTSGWSYRRFKLIENR-----MQFEMLHRYSYAIFNQPGSGEYLLGFILE 324

Query: 340 CGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSRV 399
           CGG+PR  L  ++FS        ++ EW W+YG++ WMD EGG+R  + + ++    S+ 
Sbjct: 325 CGGNPRCSLEDTLFS--NNFNVSSKVEWAWIYGENDWMDIEGGRRVHNLLLEKFNRDSKF 382

Query: 400 EIVPNSGHHLYFDNYSYFNKILLREMQSI 428
            +VPN+GHHLY DN  YFN I+++ M+++
Sbjct: 383 YMVPNAGHHLYLDNIRYFNNIIVQHMENV 411

>TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {ON}
           
          Length = 438

 Score =  429 bits (1104), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 211/444 (47%), Positives = 288/444 (64%), Gaps = 27/444 (6%)

Query: 4   HRTGTHLLNTLKALHRRNFGDQVQAPRKDGRHIHTVRKPTPPTA---------------- 47
           HR    LL+ L+ +  R      +     G +++ + KP+  T+                
Sbjct: 2   HRYLKELLDNLRTIKLRE-----KVIDFSGSNLNLIEKPSRLTSPSIPNAAAAPTASTAP 56

Query: 48  --VPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERAREGKIGKII 105
             + L+E+I+  P LFP    +S++DYK F SD E FQV LL TLP+F     G   KI 
Sbjct: 57  TALSLFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKIT 116

Query: 106 RTPVDDEGNYINEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWV 165
            T VDDEG+ INEF + P+++         HLIF+HGYGAGLGFF+KN E++ LL+D+W 
Sbjct: 117 NTIVDDEGSSINEFVVYPSNISV-PSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWC 175

Query: 166 IHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSM 225
           +HAIDLPGYG+STR +FPF V  H   +V  WFH R+  W+ +R LLQ    N ++AHS+
Sbjct: 176 VHAIDLPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSL 235

Query: 226 GAYLTAHYAQSRQNHFKKLIMCSPAGISPSKSMKKQ-PPWWFIKLWDRNVSPFSLVRNSG 284
           GAYL A Y     N  +K++MCSPAGI  S ++KK+ P WWF KLW+RN+SPF+LVR+S 
Sbjct: 236 GAYLMALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWWFEKLWERNISPFTLVRSSS 295

Query: 285 PLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDP 344
            +GSKLTSGW++RRF  LL++    ++QFEALHKY+Y+IFN  GSGEYLL+F LKCGG P
Sbjct: 296 YIGSKLTSGWTYRRFSSLLSQN--NLKQFEALHKYTYSIFNQRGSGEYLLNFALKCGGGP 353

Query: 345 RIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPN 404
           R PL  ++F    +   K+  EW+W YGD+ WMDK GG R S  +T ++  +S V IVP 
Sbjct: 354 RYPLEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGIRVSEILTKQLKKRSEVYIVPR 413

Query: 405 SGHHLYFDNYSYFNKILLREMQSI 428
           +GHHLYFDN+ +FN ++L+EM+ +
Sbjct: 414 AGHHLYFDNHQFFNDLILKEMECM 437

>CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110w
          Length = 451

 Score =  417 bits (1072), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 213/422 (50%), Positives = 267/422 (63%), Gaps = 30/422 (7%)

Query: 33  GRHIHTVRKPTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPF 92
           G+    +   T PTA PLYEI+R+LP LFP   ++S  DY  F S+ +  Q+ LL TLPF
Sbjct: 33  GKDGSAIIHATAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPF 92

Query: 93  FERAREGKIGKIIRTPVDDEGNYINEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIK 152
           FER    K   + +T +D +GNYINE  I PA+++ N       LIF+HGYGAGLGF++K
Sbjct: 93  FERTGYNKRAYLRKTEIDSDGNYINELVIEPANVDPNK--KRKRLIFVHGYGAGLGFYLK 150

Query: 153 NFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLL 212
           N+EHLPLLDD W IHAIDLPGYG+S+R  FPF         V  WF  RL T   KRG  
Sbjct: 151 NYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLRTLFEKRGFD 210

Query: 213 QAPHRNMVMAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPSK---------------- 256
           ++   N+VMAHSMGAYL A Y     +  KK++MCSPAGIS S+                
Sbjct: 211 KSD--NIVMAHSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGKE 268

Query: 257 ---SMKKQPPWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQF 313
                 K+ PWW+ KLWDRN+SPF LVR +G LGSK+TSGW++RRF+ +L   E    QF
Sbjct: 269 EIKLKIKKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQF 328

Query: 314 EALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEH------GFK-AQCE 366
           E LH+YS+AIFNM GSGEYLLSFVL+CGGDPR PL  S+FS +         G K + CE
Sbjct: 329 EKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCE 388

Query: 367 WLWLYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILLREMQ 426
           W+W+YG + WMD  G +R +         KSRV  +P SGHHLYFDNY  FN +L+ EM+
Sbjct: 389 WVWVYGANDWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMK 448

Query: 427 SI 428
           S+
Sbjct: 449 SL 450

>KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
          Length = 426

 Score =  386 bits (991), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 201/429 (46%), Positives = 271/429 (63%), Gaps = 20/429 (4%)

Query: 2   RSHRTGTHLLNTLKALHRRNFG-----DQVQAPRKDGRHIHTVRKPTPPTAVPLYEIIRN 56
           R  R    ++     L R + G       V +  K    ++TVRK T P  +PL +I+ N
Sbjct: 12  RLARRYREVIGVFNKLQREHVGVTAGTGNVGSTNKKSVRVNTVRKSTAPIGLPLLQIVTN 71

Query: 57  LPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERAREGKIGKIIRTPVDDEGNYI 116
           L  LFPL  ++S +DYK +  ++E FQ  LLS LP++         KII+TP+D  GNYI
Sbjct: 72  LHKLFPLSFAESLKDYKQYNINKEQFQEDLLSVLPYYPEPSARFSSKIIKTPIDAAGNYI 131

Query: 117 NEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGY 176
           NEF I P   E + G    H+I +HGYGAGLGF++KNF    LL +  V+HAIDLPGYG+
Sbjct: 132 NEFQITPIRPESD-GKPLKHIILVHGYGAGLGFYLKNFN--ALLSENVVVHAIDLPGYGF 188

Query: 177 STRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQS 236
           S+R  FPF     S   VE +FH+ L  W  K+GL+     N V+AHSMGAY+ + YA +
Sbjct: 189 SSRPMFPFHYPKDSYLAVEDYFHDALHKWFDKKGLISCWENNYVIAHSMGAYIFSLYA-N 247

Query: 237 RQNHFKKLIMCSPAGISPSKSMKKQPPWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSF 296
           +  HFKKL MCSP GIS +K M   PPWWF+KLWD+N+SPFSLVRN+G +GSKL SGW+ 
Sbjct: 248 KYKHFKKLFMCSPGGISRNKDM-PPPPWWFLKLWDQNISPFSLVRNAGHVGSKLVSGWTA 306

Query: 297 RRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPE 356
           RRF        +    F+ LH Y+Y IFN PGSGEY+LSF+L CGG PR+PL   +F+ E
Sbjct: 307 RRF-------GLHHPNFDKLHHYTYGIFNQPGSGEYMLSFMLGCGGWPRVPLETRLFTEE 359

Query: 357 KEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSY 416
             +   +  +W+WLYGD  WMD  G +R + ++  +    +++EIVPN+GHHLY+DN S+
Sbjct: 360 NFNS--SHLDWVWLYGDSDWMDINGARRINDFLRKKC-INTKLEIVPNAGHHLYWDNDSF 416

Query: 417 FNKILLREM 425
           FN +L +E+
Sbjct: 417 FNNVLRKEL 425

>TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score =  357 bits (916), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 193/405 (47%), Positives = 251/405 (61%), Gaps = 25/405 (6%)

Query: 38  TVRKPTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERA- 96
           T++  T P A  L +I+RNLP LFP   + S  DY  FK++ E FQ  LLS L F+    
Sbjct: 41  TLKPSTAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLY 100

Query: 97  ----------REGKIGKIIRTPVDDEGNYINEFCIRPASMEENHGAATNHLIFIHGYGAG 146
                      + + G+II+T V+ E  YINEF I P +          HLI IHGYGAG
Sbjct: 101 NNNSNDTSGNDDPRQGQIIKTYVN-ENEYINEFQILPNTSTPYD--RLKHLILIHGYGAG 157

Query: 147 LGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDV---NTHSVREVEAWFHERLE 203
           LGF+I   +HL +  D W IHA+DLPGYG+S+R +FP+       +S ++V  WF +RL+
Sbjct: 158 LGFYINTLQHLSM--DNWCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLK 215

Query: 204 TWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPSKSMKKQPP 263
           TW  K+GLL  P  N+V AHSMGAY+  HY  +  + F+K+IMCSPAG  P+ +     P
Sbjct: 216 TWFHKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSDFRKIIMCSPAGFYPASNPLTNIP 275

Query: 264 WWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAI 323
            W+  LWDRN SPFSLVR SGPLGSKLTSGWS+ RF H  +   I      ALH Y+Y+I
Sbjct: 276 LWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFH--SNQTISNELSLALHTYAYSI 333

Query: 324 FNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEK--EHGF-KAQCEWLWLYGDHVWMDKE 380
           FN+PGSGEY LS +LK GGDPR PL    F+ +    +G  ++  E+ WLYG   W++K 
Sbjct: 334 FNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDWINKT 393

Query: 381 GGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILLREM 425
           GG + S ++ + +  KS V I PNSGHHLYFDNY +FN  L +EM
Sbjct: 394 GGFKISQFL-NSLNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437

>SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON}
           conserved hypothetical protein
          Length = 432

 Score =  180 bits (457), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 130/418 (31%), Positives = 192/418 (45%), Gaps = 86/418 (20%)

Query: 68  SWEDYKAFKSDREAFQVGLLSTLPFFERAREGKIGKIIRTPVDDEGNYINEFCIRPASME 127
           S++ +K   S RE+ +  +LS L F+    E +  + +   +   GN I+EFCI   + +
Sbjct: 31  SFKTWKHASSLRES-EENILSMLDFYPEGDESRRCETMDVDIG-TGNSIHEFCIE--NTK 86

Query: 128 ENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPF--- 184
           E+       ++ +HGYGA LG FI+NF+ L  +     +HAID+ GYG S+R +FP    
Sbjct: 87  ESDRDYCRDMVLVHGYGAALGLFIRNFDGLSQIP-GIRLHAIDMLGYGLSSRPKFPDTGF 145

Query: 185 --------DVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQS 236
                   +V    V   E +F + +ETW  KR L     + +++ HS+G YL+  YA  
Sbjct: 146 LTSFWKKREVTKEDVLLAEDFFIDSIETWRHKRHL----DKFVLVGHSLGGYLSCRYALK 201

Query: 237 RQNHFKKLIMCSPAGIS-------------------------------PSKSMKKQP--- 262
                +KLI+ SP G+                                P  S   +P   
Sbjct: 202 YPERVEKLILVSPVGVETSIFDLTKEHTATHEHAAELGPDIAQELKVVPENSTTDKPVQP 261

Query: 263 -------------------PWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFRHLL 303
                              P     +W+ N+SPF ++R+ GP G  L S WSFRRF H  
Sbjct: 262 SSSFHVPNESGHVERIPNLPKIVRIIWENNISPFGILRSLGPWGPLLCSRWSFRRFSHCG 321

Query: 304 NEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKA 363
           ++      Q    H Y+Y  FN  GSGEY L+ +L  G   RIPLL    +P+       
Sbjct: 322 DK-----EQVMKFHDYAYNTFNARGSGEYALTRILAPGVLARIPLLSC--APK-----NL 369

Query: 364 QCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKIL 421
           +CE LW+YG H WM KE G      + ++ G  +   +V ++GHHLY DN   FN+ L
Sbjct: 370 KCESLWMYGSHDWMSKEAGSVIVKEL-NKAGNTADYSVVSDAGHHLYLDNPHEFNQKL 426

>Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 244] FULL
          Length = 435

 Score =  175 bits (443), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 122/413 (29%), Positives = 187/413 (45%), Gaps = 85/413 (20%)

Query: 76  KSDREAFQVGLLSTLPFFERAREGKIGKIIRTPVDDEGNYINEFCIRPASMEENHGAATN 135
           KS+    +  LLSTL FF +    +  KI+   + D+   I+E  I   +++ +  +  N
Sbjct: 37  KSNARENEKQLLSTLEFFPQGDSTRKCKILDVDIGDK-QTIHELEIE--NLKTSSRSYAN 93

Query: 136 HLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPF----------- 184
            L+ +HGYGA LG F++NF+ L  +     +HAID+ G G S+R +FP            
Sbjct: 94  DLVLVHGYGAALGLFVRNFDGLSSVPG-IKLHAIDMLGCGLSSRPKFPGTGLISSLIKRG 152

Query: 185 DVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNHFKKL 244
           +V    V E E +F + +E W  KR +     + +++ HS+G YL++ YA       +KL
Sbjct: 153 NVTKEEVYEAEDFFVDSMEKWRKKRQV----EKFVLVGHSLGGYLSSCYALKYPERVEKL 208

Query: 245 IMCSPAGI-------------------------------SPSKSMKKQP----------- 262
           ++ SP G+                               +P K     P           
Sbjct: 209 VLVSPVGVEKSIFDLTHEHTESHKGAAELGPDVAKEITNNPDKPTTDNPVKNSSSFHVPD 268

Query: 263 -----------PWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMR 311
                         F  +W  N+SPF ++R  GP+G  ++S WSFRRF    +      +
Sbjct: 269 EHGMVERVPNMSRIFSYMWTYNISPFGILRTLGPVGPLISSNWSFRRFSFTDDP-----K 323

Query: 312 QFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLY 371
           Q    H+Y Y +F+  GSGEY L+ +L  G   R+PLL  M           +C+  W+Y
Sbjct: 324 QLLTFHEYCYGVFSGAGSGEYALTRILAPGVLARLPLLSRMPG-------NLKCDSFWMY 376

Query: 372 GDHVWMDKEGGQRASSYITDRIG-GKSRVEIVPNSGHHLYFDNYSYFNKILLR 423
           G   WM KE G      + +  G GK+   IV ++GHHLY DN   FN+ LL+
Sbjct: 377 GSQDWMSKEAGSVMVKKLNESPGLGKADFSIVSDAGHHLYLDNPEEFNRKLLK 429

>KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {ON}
           conserved hypothetical protein
          Length = 434

 Score =  171 bits (432), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 128/424 (30%), Positives = 194/424 (45%), Gaps = 90/424 (21%)

Query: 73  KAFKS-----DREAFQVGLLSTLPFFERAREGKIGKIIRTPVDDEGNYINEFCIRPASME 127
           KAFK+     D +  +  LLSTL FF      +  +++   + ++  +I+EF I+  ++E
Sbjct: 28  KAFKTWWSRADAKENEKKLLSTLEFFPGGDSIRNCELLDVDIGNK-QHIHEFSIQ--NIE 84

Query: 128 ENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFD-- 185
                    L+ +HGYGA LG F++NF+ L  +     +HA+D+ G G S+R +FP    
Sbjct: 85  SCSRDYCKDLVMVHGYGAALGLFVRNFDGLSRIPG-INLHALDMLGCGLSSRPRFPGTGL 143

Query: 186 ---------VNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQS 236
                    V    V E E +F + LE W  +R L     + +++ HS+G YL+  YA  
Sbjct: 144 ISSVIKRGRVTKEEVYEAENFFIDSLEKWRQQRKL----DKFVLVGHSLGGYLSCCYALK 199

Query: 237 RQNHFKKLIMCS---------------------------------------PAGISPSKS 257
                +KL++ S                                       P    P K+
Sbjct: 200 FPERVEKLVLVSPVGVEKSVFDLTKEHTPSHNNASELGPDLSKEVTNSSGRPTTDDPVKT 259

Query: 258 ------------MKKQP--PWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFRHLL 303
                       +++ P  PW F  +W  N+SPF L+R++GP G  L+S WSFRRF    
Sbjct: 260 SSSFHVPDEAGNVERVPNMPWIFSSMWTYNISPFGLLRSAGPAGPLLSSRWSFRRFSFAE 319

Query: 304 NEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKA 363
           N       Q    H+Y Y+IF+  GSGEY L+ +L  G   R+PLL  +  PE       
Sbjct: 320 N-----TEQLLTFHEYCYSIFSGSGSGEYALTRILAPGVLARVPLLSRV--PE-----NL 367

Query: 364 QCEWLWLYGDHVWMDKEGGQRASSYITDRIGG-KSRVEIVPNSGHHLYFDNYSYFNKILL 422
           +C+  W+YG H WM KE G      I    G  K+   +V ++GHHLY DN   FN+ L 
Sbjct: 368 KCDSFWMYGSHDWMSKEAGSVIVRQINKTKGSVKADYSVVSDAGHHLYLDNPEEFNQKLA 427

Query: 423 REMQ 426
           + ++
Sbjct: 428 KFLK 431

>Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar to
           Saccharomyces cerevisiae YGR110W
          Length = 433

 Score =  144 bits (364), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 119/421 (28%), Positives = 183/421 (43%), Gaps = 88/421 (20%)

Query: 70  EDYKAFKSDREAFQV--GLLSTLPFFERAREGKIGKIIRTPVDDEGNYINEFCIR---PA 124
           E +K +KS     +    +L  L F+      +  +++   +   G+Y++EFCI    P 
Sbjct: 26  ESFKTWKSSARLHEAEDNVLRMLSFYPDGDSERTCEVLHVDIGG-GDYMHEFCIENKLPM 84

Query: 125 SMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPF 184
           + +         ++ +HGYG  LG FI+NF+ L  +     +HAID+ GYG S+R +FP 
Sbjct: 85  TRD-----TCKDIVLVHGYGTALGVFIRNFDELSQIPGV-RLHAIDMLGYGLSSRPRFPR 138

Query: 185 D-----------VNTHSVREVEAWFHERLETWLSKRGL-------------------LQA 214
                       V    V E  A+F + LE W  KR +                   L+ 
Sbjct: 139 SGFWDYYVKGKVVTKEQVEEALAFFVDSLEAWREKRNVDSFVLVGHSLGGYLSSFYALRH 198

Query: 215 PHR-----------------NMVMAHS--------MGAYLTAHYAQSRQNHFKKLIMCSP 249
           P R                 ++   H+        +G  + + + +    H   L + S 
Sbjct: 199 PERIDKLVLVSPVGVETSIYDLTAEHTPEHQHAGQLGPEVASEFKEDATEHTTDLSIDSN 258

Query: 250 AGISPSKSMKKQP---------PWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFR 300
           +  S S  +  +          PW    LW+ NVSPFSL+R  GPLG K+ + WSFRRF 
Sbjct: 259 SPQSSSLHIPNEKGFVEHVPNIPWLVKMLWNTNVSPFSLLRLLGPLGPKICANWSFRRFG 318

Query: 301 HLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHG 360
              +  E+        H+Y+Y  F   GSGEY +  +L  G   R+PLL  +    K   
Sbjct: 319 ACKDTNEL-----MNFHQYAYNNFKAKGSGEYAMMKILAPGALARVPLLSQLPGALK--- 370

Query: 361 FKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKI 420
               C+ LW+YG + WM KE G      + ++   ++  +IV N+GHHLY DN   FN+ 
Sbjct: 371 ----CDSLWMYGSNDWMSKEAGCIIVEELQEKSDYRAEYKIVNNAGHHLYLDNPEEFNRE 426

Query: 421 L 421
           L
Sbjct: 427 L 427

>TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {ON}
           Anc_8.284 YDR125C
          Length = 434

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 83/340 (24%), Positives = 139/340 (40%), Gaps = 72/340 (21%)

Query: 132 AATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWV--IHAIDLPGYGYSTRCQFPFDVN-- 187
           A T   + IHGY A    + +NF  L     Q V  ++AIDLP  G S   + PF +N  
Sbjct: 110 AITTPTLLIHGYAASSMAYYRNFTGL----SQTVTDLYAIDLPANGLS--AEQPFKLNGD 163

Query: 188 --------------------------THSVREVEAWFHERLETWLSKRGLLQAPHRNMVM 221
                                        +++ E+++ +++E W   R + +    N+V 
Sbjct: 164 KPRSLKVKYLDNDKFSVQHVIDESGTKQMIQQCESYYLDKIEEW---RKVNKLEKINLV- 219

Query: 222 AHSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPS----KSMKKQPPWWFIKLWD------ 271
            HS G YL+  YA    N  +KL + SP G+  S     +  ++   + + L D      
Sbjct: 220 GHSFGGYLSFKYALKYPNSIEKLCLVSPLGVETSIYSVNNKLEKNTKYALDLEDPTSNFY 279

Query: 272 ---RNVSPF------SLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYA 322
              R +  F       ++R  GPLG+K+   +    +   + E E     FE L    Y 
Sbjct: 280 TRRREIPKFIFKNQSEILRWMGPLGAKMCWNYILSAYSR-IPEMEYKSYIFELL----YG 334

Query: 323 IFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGG 382
              +  +   + + +       + P++ S+       G     + L +YGDH WM+K  G
Sbjct: 335 KGGIAPTARQIFTNLFTRNLLAKDPIMDSL-------GQLQAKKVLLVYGDHDWMNKYAG 387

Query: 383 QRASSYI-TDRIGGKSRVEIVPNSGHHLYFDNYSYFNKIL 421
            +    + T R    ++   VP SGH+L+ DN ++FN  L
Sbjct: 388 YKLVERLNTIRNNTSAQYIEVPESGHNLFLDNPTFFNASL 427

>KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON}
           Anc_8.284 YDR125C
          Length = 411

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 80/332 (24%), Positives = 133/332 (40%), Gaps = 69/332 (20%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPF------------- 184
           + +HG+ +    F +NF  L    D   ++AIDLP  G S      F             
Sbjct: 91  LLLHGFASSSMSFFRNFTGLS--QDIMDLYAIDLPANGLSRSLSTKFYRVSPKETRKFDM 148

Query: 185 --DV--------NTHSVREV----EAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLT 230
             D+        N H+ +E+    E ++ + +E W     L    H+  ++AHS G YL+
Sbjct: 149 LDDIHFQLLSHGNYHAEKELIQKCEDYYIDTIERWRRSNEL----HKINIVAHSFGGYLS 204

Query: 231 AHYAQSRQNHFKKLIMCSPAGISP-------------SKSMKKQPPWWFIKLWDRNV--- 274
             YA        KL + SP G+               + ++ +  P     + +  +   
Sbjct: 205 FKYALKYPESINKLCLVSPLGVEANIYSINNNFNVGETYTVNRLDPSSCCYINENEIPKY 264

Query: 275 ---SPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGE 331
              + F ++R SGP+G+KL   +    +  + +  +     FE L    Y    M  +  
Sbjct: 265 VFDNLFKILRLSGPIGAKLCWNYVLSSYSRI-SSLDFKRYVFELL----YGKGGMTATAI 319

Query: 332 YLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCE-WLWLYGDHVWMDKEGGQRA-SSYI 389
            L + +       R PL+ S  S          C   L LYG++ WM K  G+   ++  
Sbjct: 320 NLFTQLFTTRLLARDPLMDSAHS--------LSCNGILLLYGEYDWMAKNAGKSLLTNCK 371

Query: 390 TDRIGGKSRVEI--VPNSGHHLYFDNYSYFNK 419
            D  G  S+ +   VP SGH+L+ DN ++FNK
Sbjct: 372 ADNKGSASKTKYLEVPKSGHNLFLDNPAFFNK 403

>Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 87/344 (25%), Positives = 138/344 (40%), Gaps = 87/344 (25%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYS---------TRCQFPF---- 184
           + IHGY A    F + FE L   D+   ++AIDLP  G S         T+   P     
Sbjct: 74  VLIHGYAASSMAFYRTFESLS--DNIKDLYAIDLPANGASQAPALQVDKTKKIKPLRFKH 131

Query: 185 -----------------DVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGA 227
                            D+ +H + + E +F +R+E W     L     R  V+ HS G 
Sbjct: 132 IEDDVVVPVLDKHPPAEDIKSH-LEQYENYFVDRIEQWRKDNKL----RRINVVGHSFGG 186

Query: 228 YLTAHYAQSRQNHFKKLIMCSPAGISPSK---SMKKQP----PWWFIKLWDR------NV 274
           Y++  YA    N   KL + SP G+  S    + K +P    P  F     R      NV
Sbjct: 187 YISFKYALKYPNSIDKLCLISPLGVENSIHAIAHKWEPNTTYPLTFTDPSSRYYTRKLNV 246

Query: 275 SPF------SLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPG 328
             F      ++++  GP+GSKL S +    +          ++  + L+K  Y + +  G
Sbjct: 247 PQFIFENQLNVLKWMGPIGSKLCSNYISTAY----------VKVPDQLYK-DYLLHSFVG 295

Query: 329 SGEYLLSFVLKC----------GGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMD 378
             + +    +K             DP I  +G + +P            +++YG+H WMD
Sbjct: 296 KNQTVQPQTIKVFTHLFERNLIARDPIINNVG-LLNPA--------THVMFMYGEHDWMD 346

Query: 379 KEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILL 422
           K  G   +  +       S VE VP++GH+L+ DN  +F   L+
Sbjct: 347 KYAGYLTTESMLKNKAKASYVE-VPDAGHNLFLDNPHHFTSSLV 389

>Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 174] FULL
          Length = 416

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 83/341 (24%), Positives = 140/341 (41%), Gaps = 77/341 (22%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPL-LDDQWVIHAIDLPGYGYS------TRCQFPFDVNTHS 190
           + +HGY A    F +NF  L   + D   ++AIDLP  G S       RC  P D+  + 
Sbjct: 100 LLVHGYAASSMGFHRNFPGLSQSIKD---LYAIDLPASGLSPALPLEMRCTQPLDLKINM 156

Query: 191 VREV-------------------EAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTA 231
            ++                    E ++ + +E W     L   P    ++AHS G YL+ 
Sbjct: 157 SKDTFSLPYTINYLHHKSLIQNYEDYYLDAIEQWRHDNKL--GPIN--IVAHSFGGYLSF 212

Query: 232 HYAQSRQNHFKKLIMCSPAGIS-----------------------PSKSMKKQPPWWFIK 268
            YA    +  +KL + SP G+                         SK   K+ P     
Sbjct: 213 KYAVKFPHAVEKLCLVSPLGVERNIFSVNNQWRSNTSYNLDFENPASKFYIKKGPAIPRL 272

Query: 269 LWDRNVSPFSLVRNSGPLGSKLTSGW---SFRRFRHLLNEGEIGMRQFEALHKYSYAIFN 325
           ++++      L+RN GPLG+KL+  +   ++ R   L  +  +    FE L    Y    
Sbjct: 273 VFEQQT---QLLRNLGPLGAKLSWNYINAAYSRVPSLDYKKYV----FELL----YGKNG 321

Query: 326 MPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRA 385
           +  + + L   +       R PLL S+        F    + + +YGDH WM++  G   
Sbjct: 322 LNQTSKDLFIGLFNNRVLARDPLLDSI------QFFGKSAKLMCIYGDHDWMNRRAGMEM 375

Query: 386 SSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILLREMQ 426
            +   +++G +++   V +SGH+L+ DN   FN  L+R ++
Sbjct: 376 VNE-ANQLGIEAKYNEVSSSGHNLFLDNPEEFNDKLVRFLK 415

>YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON}
           ICT1Lysophosphatidic acid acyltransferase, responsible
           for enhanced phospholipid synthesis during organic
           solvent stress; null displays increased sensitivity to
           Calcofluor white; highly expressed during organic
           solvent stress
          Length = 394

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 77/334 (23%), Positives = 135/334 (40%), Gaps = 67/334 (20%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPF------------- 184
           + IHGY A    F + FE+L   D+   ++AIDLP  G S                    
Sbjct: 74  VLIHGYAASSMAFYRTFENLS--DNIKDLYAIDLPANGASEAPALQVNKTKKIKSLRFKH 131

Query: 185 -----------------DVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGA 227
                            D+ +H + + E++F +R+E W     L     +  V+ HS G 
Sbjct: 132 IEDDVVIPVIEKRPPAEDIKSH-LEQYESYFVDRIEQWRKDNKL----RKINVVGHSFGG 186

Query: 228 YLTAHYAQSRQNHFKKLIMCSPAGISPSK---SMKKQP----PWWFIKLWDR------NV 274
           Y++  YA    +  +KL + SP G+  S    + K +P    P  F     R      NV
Sbjct: 187 YISFKYALKYPDSIEKLCLISPLGVENSIHAITHKWEPNTTYPLTFTDPSSRYYTRKLNV 246

Query: 275 SPF------SLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPG 328
             F      ++++  GP+GSKL S +    +  + ++    + +   LH +      +  
Sbjct: 247 PRFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQ----IYKDYLLHSFVGKNQTVQP 302

Query: 329 SGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSY 388
               + + + +     R P++ ++               +++YG+H WMDK  G   +  
Sbjct: 303 QTIKVFTHLFERNLIARDPIINNV------RFLNPATPVMFMYGEHDWMDKYAGYLTTES 356

Query: 389 ITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILL 422
           +       S VE VP++GH+L+ DN  +F   L+
Sbjct: 357 MLKNKAKASYVE-VPDAGHNLFLDNPQHFASSLV 389

>KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]
           {ON} similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125C ECM18 Protein of unknown function, similar to
           Rlp24p
          Length = 409

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 89/329 (27%), Positives = 132/329 (40%), Gaps = 58/329 (17%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPL-LDDQWVIHAIDLPGYGYST------------------ 178
           + IHGY A    F +NFE L L L D   ++A+DLPG G S                   
Sbjct: 90  LMIHGYAASSMTFFRNFEQLSLSLKD---VYAVDLPGNGLSKELPLSVDSMQKPDRVEFN 146

Query: 179 --------RCQFPFDVNTHS--VREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAY 228
                   R Q P D   +   +   E ++ + LE W  +  L +    N+V  HS G Y
Sbjct: 147 ETVKGQYFRLQNPVDEEKYKKHLAHYEDYYVDALEKWRKENKLSKI---NLV-GHSYGGY 202

Query: 229 LTAHYAQSRQNHFKKLIMCSPAGISPS----KSMKKQPPWWFIKLWDRNVSPFSLVRNSG 284
           LT  Y+    ++  KL + SP G+  S     +  +    + I+  D + S +S  RN  
Sbjct: 203 LTFKYSLKYPDNVHKLCLVSPLGVERSIFSIHNHLEPERDYEIQSEDPSKSNYSNKRNI- 261

Query: 285 PLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLKCG--G 342
               KL   +  +  R +   G +G +        SY         EY+   V   G   
Sbjct: 262 ---PKLILQYQNKALRWM---GPLGAKACWGYVNSSYGRVPSVPYREYVFQLVFGKGIMT 315

Query: 343 DPRIPLLGSMFS-------PEKEHGFKAQCEWLWL-YGDHVWMDKEGGQRA-SSYITDRI 393
           D  I +   +FS       P  +   K +   L L YG+H WM+K  G+ A   + + R 
Sbjct: 316 DTSIRIFNQLFSRSLLAYDPIMDSLDKVKVSKLMLVYGEHDWMNKVAGRLAIEEFNSIRK 375

Query: 394 GGKSRVEIVPNSGHHLYFDNYSYFNKILL 422
                 +IV  +GH+L  DN S FN  L+
Sbjct: 376 SYDGTFDIVSRAGHNLVLDNPSEFNSKLV 404

>Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 79/344 (22%), Positives = 134/344 (38%), Gaps = 87/344 (25%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFD------------ 185
           + IHGY A    F + F++L   D+   ++AIDLP  G S       +            
Sbjct: 74  VLIHGYAASSMAFYRTFKNLS--DNIKDLYAIDLPANGASEAPALQVEGVKKIKSLRFKH 131

Query: 186 ------------------VNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGA 227
                             + +H + + E++F +R+E W     L     +  V+ HS G 
Sbjct: 132 VEDDMVTPVLDKRPPAEEIKSH-LEQYESYFVDRIEQWRKDNNL----RKINVVGHSFGG 186

Query: 228 YLTAHYAQSRQNHFKKLIMCSPAGISPSK-------SMKKQPPWWFIKLWDR------NV 274
           Y++  YA    N   KL + SP G+  S              P  F     R      NV
Sbjct: 187 YISFKYALKYPNSIDKLCLISPLGVENSIHAINHKWEANTTYPVTFTDPSSRYYTRKLNV 246

Query: 275 SPF------SLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPG 328
             F      ++++  GP+GSKL S +    +          ++  + L+K  Y + +  G
Sbjct: 247 PQFIFENQLNVLKWMGPIGSKLCSSYISTAY----------VKVPDQLYK-DYLLHSFVG 295

Query: 329 SGEYLLSFVLKC----------GGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMD 378
             + +    +K             DP I  +G + +P            +++YG+H WMD
Sbjct: 296 KNQSVQPQTIKVFTQLFERNLIARDPIINNVG-LLNPA--------THVMFMYGEHDWMD 346

Query: 379 KEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILL 422
           K  G   +  +       S +E VP++GH+L+ DN ++F   L+
Sbjct: 347 KYAGYLTTESMLKNKAKASYME-VPDAGHNLFLDNPNHFTSSLV 389

>KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {ON} 
          Length = 408

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 112/273 (41%), Gaps = 45/273 (16%)

Query: 177 STRCQFPFDVNTHSVRE----VEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAH 232
           +  C+ P  +++  V +     E +F +R+E W    G         V+ HS G Y++  
Sbjct: 149 TVVCEPPSKMSSSGVLDDPGVYEDYFVDRIEKWRLAHGF----DNINVVGHSFGGYMSFK 204

Query: 233 YAQSRQNHFKKLIMCSPAGISPSKSMKKQPPWWFI----KLWDRNVS------PFS---- 278
           YA     H  KL++ SP G+   +++      W +     L D + +      PF+    
Sbjct: 205 YAIKYSKHVDKLVLLSPLGV--ERNIDSVSNKWDVGKTYDLTDIDATSPLYYRPFTVPGY 262

Query: 279 -------LVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGE 331
                  ++R  GPLG+ +       R+ ++      G      LH   Y     P +  
Sbjct: 263 LFNNQLNVLRKMGPLGNHMAKRAIASRYSNV-----PGTAYHAYLHHVFYGAHTFPSANI 317

Query: 332 YLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITD 391
              + +       R PLL ++         K   + + +YGDH WM+KE G      I  
Sbjct: 318 TAFTHLFTRQLLARDPLLDNI------QRLKVN-KLMMVYGDHDWMNKEAGYGMVQEINK 370

Query: 392 R--IGGKSRVEIVPNSGHHLYFDNYSYFNKILL 422
              +  K+    +P++GH+L+ DN S FNK+L+
Sbjct: 371 ERYVPAKAVYAELPSAGHNLFLDNPSGFNKLLI 403

>Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON}
           YDR125C (REAL)
          Length = 446

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 79/346 (22%), Positives = 141/346 (40%), Gaps = 71/346 (20%)

Query: 128 ENHGAAT--NHLIFIHGYGAGLGFFIKNFEHLPL-LDDQWVIHAIDLPGYGYST------ 178
           +N  A+T     + IHGY A    + +N+  L   + D   +++IDLP  G S+      
Sbjct: 111 QNEKASTVLTPTLLIHGYAASSMSYFRNYPGLSKHIRD---LYSIDLPASGLSSIPSLEI 167

Query: 179 ----------------RCQFPFDVNTH----SVREVEAWFHERLETWLSKRGLLQAPHRN 218
                           + + P+ +N +     ++  E ++ +R+E W     L     + 
Sbjct: 168 NATTPLPLDIKFIGKNKFKIPYTINANHHKFVIQMFEDFYLDRIEQWRIDNKL----GKM 223

Query: 219 MVMAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGI-----SPSKSMKKQPPWWF------I 267
            ++ HS GAYL+  YA    N  +KL + SP G+     S + + +   P+         
Sbjct: 224 NIVGHSFGAYLSFKYAVKYPNSVEKLCLVSPLGVERNIWSVNNNFRSNSPYTIDFENPSS 283

Query: 268 KLWD-RNVSP-------FSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKY 319
           K +  RN+ P       F ++R  GPLG+KL   +    +  +       +   E + + 
Sbjct: 284 KFYSKRNIIPRYLFQQQFQILRMMGPLGAKLCWNYILAAYSRV-----PSLAYKEYIFEL 338

Query: 320 SYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDK 379
            Y    +P     +   +       R PL+ S+ S           + L +YG + WM+K
Sbjct: 339 FYGKGGIPAVTTEIFEGLFSRSILARDPLMDSLNSLNVR-------KLLVVYGQYDWMNK 391

Query: 380 EGGQ---RASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILL 422
             G    +  + + D     +  EI P SGH+L+ DN   FN+ ++
Sbjct: 392 NAGMLMVKELNNLGDHFEKATYTEI-PFSGHNLFLDNPESFNQSIV 436

>Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 83/346 (23%), Positives = 137/346 (39%), Gaps = 89/346 (25%)

Query: 129 NHGA--ATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYS--------- 177
           N+GA   +   + IHGY A    F + FE L   ++   ++AIDLP  G S         
Sbjct: 63  NNGANKVSTPTVLIHGYAASSMAFYRTFESLS--NNIKDLYAIDLPANGASEAPVLQVDK 120

Query: 178 -------------TRCQFPF--------DVNTHSVREVEAWFHERLETWLSKRGLLQAPH 216
                             P         D+ +H + + E +F +R+E W     L +   
Sbjct: 121 TKKVKSLRFKHIEDDVVIPVLDRRPPAEDIKSH-LEQYENYFVDRIEQWRKDNKLRKIN- 178

Query: 217 RNMVMAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPSK---SMKKQP----PWWFIKL 269
              V+ HS G Y++  YA    N   KL + SP G+  S    + K +P    P  F   
Sbjct: 179 ---VVGHSFGGYISFKYALKYPNSIDKLCLISPLGVENSIHAITHKWEPNTTYPLTFTDP 235

Query: 270 WDR------NVSPF------SLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALH 317
             R      NV  F      ++++  GP+GSKL S +    +          ++  + ++
Sbjct: 236 SSRYYTRKLNVPRFIFENQLNVLKWMGPIGSKLCSNYISTAY----------VKVPDQIY 285

Query: 318 KYSYAIFNMPGSGEYLLSFVLKC----------GGDPRIPLLGSMFSPEKEHGFKAQCEW 367
           K  Y + +  G  + +    +K             DP I  +G + +P            
Sbjct: 286 K-DYLLHSFVGKNQTVQPQTIKVFTHLFERNLIARDPIINNVG-LLNP--------TMHV 335

Query: 368 LWLYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDN 413
           +++YG+H WMDK  G   +  +       S +E VP++GH+L+ DN
Sbjct: 336 MFMYGEHDWMDKYAGYLTTESMLKNKAKASYIE-VPDAGHNLFLDN 380

>YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}
           ECM18Protein of unknown function, similar to Rlp24p
          Length = 453

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 84/355 (23%), Positives = 138/355 (38%), Gaps = 91/355 (25%)

Query: 128 ENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYS--------TR 179
           EN        + IHGY A    F +N+  L        +++ID+P  G S        T 
Sbjct: 120 ENTSTVRTPTLLIHGYAASSMSFFRNYPGLS--KHIRNLYSIDMPASGLSSVPSLEINTT 177

Query: 180 CQFPFDV------------------NTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVM 221
              P D+                  N   ++  E ++ +R+E W     L +      V+
Sbjct: 178 TPLPLDIKFIGENKFKVPYTINANHNKFVIQMYEDFYLDRIEQWRIDNKLGKMN----VV 233

Query: 222 AHSMGAYLTAHYAQSRQNHFKKLIMCSPAGISP----------SKSMK----KQPPWWFI 267
            HS G YL+  YA    N   KL + SP G+            S ++     K P   F 
Sbjct: 234 GHSFGGYLSFKYAVKYPNSVNKLCLVSPLGVERNIWSVNNNFHSNTLYTIDFKNPNSKFY 293

Query: 268 KLWDRNVSP-------FSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYS 320
               RN+ P       F ++R  GPLG+KL   W++             M  +  +   +
Sbjct: 294 S--KRNMIPKYLFEQQFHILRMMGPLGAKLC--WNY------------IMAAYSRVPSLA 337

Query: 321 YAIFNMPGSGEYLLSFVLKCGGDPRIP--LLGSMFS-------PEKEH-GFKAQCEWLWL 370
           Y         EY+       GG P +   +  ++FS       P  +   +    + L +
Sbjct: 338 YK--------EYIFELFYGKGGIPEVTTDIFKALFSRCILAKDPLMDSLQYLNVKKLLIV 389

Query: 371 YGDHVWMDKEGGQ---RASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILL 422
           YG + WM+K+ G    +  + + + + G S +EI P+SGH+L+ DN   FN+ ++
Sbjct: 390 YGQYDWMNKKAGMFMVKELNNLKNCLEGASYLEI-PSSGHNLFLDNPESFNQSIV 443

>AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR099C
           (ICT1) and YDR125C (ECM18)
          Length = 384

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 77/320 (24%), Positives = 125/320 (39%), Gaps = 61/320 (19%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQF---------PFDVNT 188
           + +HGY +    F +N   L    +Q  ++A+DLPG G S                    
Sbjct: 86  VLLHGYASSAVSFHRNLAALGAQVEQ--LYALDLPGNGMSQELPLGPAAARALARRCGAR 143

Query: 189 HSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNHFKKLIMCS 248
             +R +  ++ + LE W +  GL           HS G YL   YA       ++L + S
Sbjct: 144 ADIRALADYYLDALERWRAANGL----ETLNAAGHSFGGYLAFKYALRHPARVQRLCLVS 199

Query: 249 PAGISPSKSMKKQPPWWFIKL----------WDRNVS--------PFSLVRNSGPLGSKL 290
           P G+    + ++ P     +           + R  +           ++R  GPLG+ L
Sbjct: 200 PLGVEAQTAGRRMPGRATRRRTRPPTPASPHYTRAAALPPLLFEQQLRVLRWLGPLGAHL 259

Query: 291 TSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFN------MPGSGEYLLSFVLKCGGDP 344
              +    F        +  R+F   H+Y++A+ +      +P     L + +       
Sbjct: 260 LWQYVNASF------SRVPGREF---HRYTFALLHRLALRPLP---RKLFTGLFTNALLA 307

Query: 345 RIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGK--SRVEIV 402
           R PLL S+         K     L LYGDH WMD   G RA     + + G+  + + IV
Sbjct: 308 RDPLLDSLAE------LKVPNVQL-LYGDHDWMDARAG-RALVAELNALRGRPDASLAIV 359

Query: 403 PNSGHHLYFDNYSYFNKILL 422
           P +GH+L+ DN   F+  LL
Sbjct: 360 PAAGHNLFLDNPEDFHSWLL 379

>Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {ON}
           complement(108945..110234) [1290 nt, 430 aa]
          Length = 429

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 80/352 (22%), Positives = 133/352 (37%), Gaps = 98/352 (27%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVR----- 192
           + IHGY A    + + F  L   D    ++AIDLP +G S      F      ++     
Sbjct: 103 LLIHGYAASSLAYFRTFSGLS--DKIKNLYAIDLPSFGLSNAPPLDFKEKVSDIKIKLSD 160

Query: 193 -----------------------EVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYL 229
                                  + E ++ E++E W     L     +  ++ HS G Y+
Sbjct: 161 DNTKFKISDSNRVDSLDLKKLIGKYEDYYVEKIEDWRKANKL----EKINLVGHSFGGYI 216

Query: 230 TAHYAQSRQNHFKKLIMCSPAG-------ISPSKSMKKQPPW--------WFIKLWDRNV 274
           +  YA    +   +L + SP G       ++ +   KK+ P         ++ K  +R +
Sbjct: 217 SFKYAIKYPDAINRLCLVSPLGMESNIHSVNNNFETKKEYPLDLEDPSSRFYAK--ERRI 274

Query: 275 SPF------SLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPG 328
             F      +++R  GP+GSKL   +    +R + N                      P 
Sbjct: 275 PNFLFKNQLNVLRWMGPIGSKLCWNYINASYRRVPN----------------------PL 312

Query: 329 SGEYLLSFVLKCGGDPR--IPLLGSMFS-------PEKEHGFKAQCE-WLWLYGDHVWMD 378
             EYL   +   GG P   I +  ++F+       P  +   K + E  L LYG+H WM+
Sbjct: 313 FKEYLFELLYGKGGMPSVTIDIFTNLFTRSLLARDPIMDSISKLKAEKVLLLYGEHDWMN 372

Query: 379 KEGG--------QRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILL 422
              G        Q   +     I   + VE VP++GH+L+ DN  +FN  +L
Sbjct: 373 NLAGYNMVESLNQLKPNNNISTIDYANYVE-VPDAGHNLFLDNPQFFNSAVL 423

>Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 82/391 (20%), Positives = 144/391 (36%), Gaps = 92/391 (23%)

Query: 93  FERAREGKIGKIIRTPVDDEGNYINEFC---IRPASMEENHGAATNHLIFIHGYGAGLGF 149
           +ER RE  +   I   V+ EG+  N+     I     +    +     + IHGY A    
Sbjct: 66  YERLRE--LQNCIMDQVNVEGSKKNDKLFDEINQWHFQNTKASIRTPTLLIHGYAASSMS 123

Query: 150 FIKNFEHLPLLDDQWVIHAIDLPGYGYST----------------------RCQFPFDVN 187
           + +N+  L        +++IDLP  G S+                      + + P+ +N
Sbjct: 124 YFRNYSGLSKHFQN--LYSIDLPASGLSSIPPLEVNTTTPLPLDIKFIGKNKFKIPYTIN 181

Query: 188 TH----SVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNHFKK 243
                  ++  E ++ +R+E W     L     +  ++ HS G YL+  YA    N  +K
Sbjct: 182 ASHHKFVIQMFEDFYIDRIEQWRIDNKL----DKMNIVGHSFGGYLSFKYAVKYPNSVEK 237

Query: 244 LIMCSPAGI----------------------SPSKSMKKQ----PPWWFIKLWDRNVSPF 277
           L + SP G+                       PS     +    P + F +        F
Sbjct: 238 LCLVSPLGVERNIWSVNNNLSSNTLYTTDFKDPSSKFYSKGHLIPKYLFEE-------QF 290

Query: 278 SLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIF----NMPGSGEYL 333
            L+R  GPLG+K+   +    +  + +          A  +Y + +F     +P     +
Sbjct: 291 KLLRLMGPLGAKVCWNYIMAAYSRVTS---------LAFKEYIFELFYGKGGIPEVTTDI 341

Query: 334 LSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRI 393
              +       R P+L S+        +    + L +YG + WM+K  G      +    
Sbjct: 342 FKGLFSRSILARDPILDSL-------NYLNVKKLLVVYGQYDWMNKNAGMLLVENVNKLG 394

Query: 394 GGKSRVEI--VPNSGHHLYFDNYSYFNKILL 422
            G  R     VP+SGH+L+ DN   FN+ ++
Sbjct: 395 NGLERASYLEVPSSGHNLFLDNPESFNQSIV 425

>ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 380

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 80/374 (21%), Positives = 137/374 (36%), Gaps = 67/374 (17%)

Query: 98  EGKIGKIIRTPVDDEGNYINEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHL 157
           + KI  +++   + E   +N    +      N    T   + IHGY A    + + F+ L
Sbjct: 22  QDKIMNLVKVGGNMENTMVNGQVNQWHFHNSNASEVTTPTLLIHGYAASSMAYYRTFQGL 81

Query: 158 PLLDDQWVIHAIDLPGYGYSTRCQF--------PFDVNTHS------------------- 190
              D    ++ IDLP  G S             P  V  H                    
Sbjct: 82  T--DKISDLYTIDLPSNGLSKELPLILDGQTPPPLKVEIHKDGSKFKIIERVDAEHCRSV 139

Query: 191 VREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNHFKKLIMCSPA 250
           V++ E ++ + +E W    G+     R  ++ HS G Y+   YA       ++L + SP 
Sbjct: 140 VKQYEDYYLDSIELWRKHNGI----GRFNLVGHSFGGYIAFKYAVKYPKAVEQLGLISPL 195

Query: 251 GISPSKSMKKQPPWWFIKLWD-RNVSPFS-------------------LVRNSGPLGSKL 290
           G+  S        W    +++  +  P S                   L+R  GP+G+KL
Sbjct: 196 GVE-SNIYSVNNDWKLDTVYEMESTDPASRMYGKNWEIPKVLFERQTELLRWMGPIGAKL 254

Query: 291 TSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLG 350
              +    +  L       M   + + +  Y    +P +   +   +       R P++ 
Sbjct: 255 CWNYITAAYNKLPT-----MEYKDYVFELLYGNGGIPKTARKVFGGLFTRSLLARDPIMD 309

Query: 351 SMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIG-GKSRVEIVPNSGHHL 409
           SM   +K    K     L LYGD  WM+   G R    +  + G G +  + VP++ H+L
Sbjct: 310 SM---DKLGARKV----LLLYGDSDWMNNYAGYRMVELLNQKRGKGYATYDEVPDARHNL 362

Query: 410 YFDNYSYFNKILLR 423
           + DN   FN  L++
Sbjct: 363 FLDNPDSFNDKLIQ 376

>CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {ON}
           similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125c ECM18 or uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 423

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 77/332 (23%), Positives = 140/332 (42%), Gaps = 80/332 (24%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPLLD-DQWVIHAIDLPGYGYS------------------- 177
           + IHGY A    F   F  +P L+ D   ++ IDLPG G S                   
Sbjct: 110 VLIHGYAATSTAF---FRSIPYLNRDIKDLYTIDLPGNGLSFTPSLDLEVSKPLPLKIEN 166

Query: 178 ----TRCQFPFDVNT----HSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYL 229
                  Q P+ +++    + ++++  ++ +R+E W     L +      V+AHS G YL
Sbjct: 167 IDDGNEFQLPYVIDSAHHRYVLQKLLDYYVDRIEQWRLDNKLGKIN----VVAHSYGGYL 222

Query: 230 TAHYAQSRQNHFKKLIMCSPAGISP----------SKSMKKQP-----PWWFIK------ 268
           + +YA     +   L + SP G+            S+++ K+        ++ +      
Sbjct: 223 SFNYALKYPANINTLGLISPLGVERNIYSINNEFHSRTIYKREWNDCNSMFYDRKFKLND 282

Query: 269 -LWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFRHL-LNEGEIGMRQFEALHKYSYAIFNM 326
            L+ + + P   +R  GP+G+KL   W++ R  +  +   +     FE      Y    +
Sbjct: 283 YLFQKQLKP---LRWLGPIGAKLC--WNYIRSAYARVPSIDYKDYTFETF----YGRGGL 333

Query: 327 PGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQC-EWLWLYGDHVWMDKEGGQRA 385
           P     + + +L      R PLL        +H  + Q  + + +YG + WM+K GG+  
Sbjct: 334 PEQTSQIFTSLLTSSLLARDPLL--------DHVSQLQVPKLIMMYGQYDWMNKNGGK-- 383

Query: 386 SSYITDRIGGKSRVEIVPNSGHHLYFDNYSYF 417
              +T    G+++   +PN+GH+L+ DN S F
Sbjct: 384 --LMTQIFNGETKYIDIPNAGHNLFLDNPSDF 413

>KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 415

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 82/341 (24%), Positives = 139/341 (40%), Gaps = 86/341 (25%)

Query: 138 IFIHGYGAGLGFFIKNFEHLP-LLDDQWVIHAIDLPGYGYS------TRC---------- 180
           + +HGY A    F +NFE L   + D   ++AIDLP  G S       RC          
Sbjct: 100 LLLHGYAASSMAFHRNFEGLSKCIRD---LYAIDLPANGLSPPQPLEIRCTEPQPLKIEI 156

Query: 181 -----QFPFDVNT----HSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTA 231
                + P+ +N+     +++  E ++ + LE W     L   P    ++AHS G Y++ 
Sbjct: 157 SNDTFKLPYTINSLHHKSAIQNFEDYYLDALEQWRLDNKL--GPIN--IVAHSFGGYISF 212

Query: 232 HYAQSRQNHFKKLIMCSPAGI--------------SPSKSMKKQPPWWFIKLWDRNVSP- 276
            YA    +  K+L + SP G+              +  K   + P   F       + P 
Sbjct: 213 RYAVKYPHAVKRLCLLSPLGVERNIFSVNNNWRSNTQYKLDFENPASKFYIRKGPAIPPA 272

Query: 277 -FSL----VRNSGPLGSKLTSGWSF----------RRFRHLLNEGEIGMRQFEALHKYSY 321
            F L    +R  GPLG++L   W++           +++  + E   G     AL + S 
Sbjct: 273 IFELQTKVLRGLGPLGARLC--WNYITAAYARVPSLKYKQYIFEMFYGK---NALTQTSK 327

Query: 322 AIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEG 381
            IF    +   L           R PLL S+     +       + L +YGDH WM+++ 
Sbjct: 328 DIFTGLFTNRLL----------ARDPLLDSLCHVRSK-------KLLLMYGDHDWMNRKA 370

Query: 382 GQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILL 422
           G    +    ++G  ++   V +SGH+L+ DN    N++++
Sbjct: 371 GLEMVTE-AKKLGIDAQYGEVSSSGHNLFLDNPEESNELIV 410

>KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.284
           YDR125C
          Length = 434

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/364 (20%), Positives = 143/364 (39%), Gaps = 89/364 (24%)

Query: 116 INEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYG 175
           IN++     S+  +  A    ++ IHGY +    + +NF  L        ++AIDLP  G
Sbjct: 90  INQWHFHNPSLVGSEAAVKPPVLLIHGYASSSMSYFRNFRGLS--SQCKDVYAIDLPANG 147

Query: 176 YSTRCQFPFDVN-------------------------------THSVREVEAWFHERLET 204
            S       D +                                  +R +E ++ + +E 
Sbjct: 148 LSREISLSEDADLKDLVKYSLQVKGLDSPGQVKVTKPYNNKLCATQLRILEDYYVDEIER 207

Query: 205 WLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGI------------ 252
           W  +  + Q      ++ HS G Y++  YA     +  KL + SP G+            
Sbjct: 208 WRVENQIDQL----HLVGHSFGGYISYKYALKYPQNVMKLALISPLGVERNLYSVNNHLP 263

Query: 253 -------------SPSKSMKKQPPWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRF 299
                        SPS   K + P +  +      +   ++R  GP+G++L   W++   
Sbjct: 264 QDSIVQGTFEDPSSPSYLRKLEVPRYIFE------NQLKILRWGGPMGARLC--WNYITS 315

Query: 300 RHLLNEGEIGMRQFEALHKYSYAIFNMPG--SGEYLLSFVLKCGGD--PRIPLLGSMFSP 355
            +     ++  R+F+   +Y + +F   G  +   L +F+L    +   R P++ S+   
Sbjct: 316 AY----AKVPSREFK---EYLFELFYGDGGITKTALTTFILLFTRNLLARDPIMDSIAEL 368

Query: 356 EKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRIGGKSRVEI-VPNSGHHLYFDNY 414
           + +       + ++ YG + WM+K  G RA+  +  +    S + + +P SGH+L+ D+ 
Sbjct: 369 KVK-------DVMFQYGQYDWMNKNAGARAAELLRKQPYNNSALYLEIPESGHNLFLDSP 421

Query: 415 SYFN 418
             FN
Sbjct: 422 QSFN 425

>TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.284
           YDR125C
          Length = 405

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 83/373 (22%), Positives = 143/373 (38%), Gaps = 120/373 (32%)

Query: 130 HGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFP------ 183
           HG AT+ L +   + AGL  +IK+            +++IDLP +G S   + P      
Sbjct: 68  HGYATSSLAYYRNF-AGLSSYIKD------------LYSIDLPTFGLSKTPELPTRKVTK 114

Query: 184 ---------------------FDVNTHSVREVEAWFHE--------------RLETWLSK 208
                                F ++   ++  E +++E              R+E W  +
Sbjct: 115 NLKVTLSNSNDKSDDPKKITSFQLSKDDIKHNEKYYNETKKELEINENYYIDRIEKWRIE 174

Query: 209 RGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPS------------- 255
             L +    N+V  HS G YL+  YA    +  +KL + SP G+  +             
Sbjct: 175 NKLDKI---NLV-GHSFGGYLSYKYATKYPDSIEKLCLVSPLGMESNIYSINNKFENDKI 230

Query: 256 KSMKKQPPWWFIKLWDRNVSPF------SLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIG 309
             ++++ P        R +  F      +++R  GP+GS LT  W + +  +        
Sbjct: 231 YEIEEEDPSSIFFTNTRTIPKFLFNNQLNVLRWLGPVGSTLT--WKYIKASY-------- 280

Query: 310 MRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGG--DPRIPLLGSMFSP---------EKE 358
            R  +AL+K            +Y+   +   GG  +  I    ++F+          +  
Sbjct: 281 RRVDDALYK------------DYIHELIYGKGGMEETTIKTFTNLFTTKLLAKDPITDTV 328

Query: 359 HGFKAQCEWLWLYGDHVWMDKEGGQRASS-------YITDRIGGKSRVEI--VPNSGHHL 409
              KA+   L LYG   WM+   G + +        Y T ++G  +      VP +GH+L
Sbjct: 329 DKLKAK-NVLLLYGQEDWMNNYAGYQMTKKLNELKGYNTSKVGELNYATYMEVPEAGHNL 387

Query: 410 YFDNYSYFNKILL 422
           + DN S+FNK LL
Sbjct: 388 FLDNPSFFNKALL 400

>Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 84/389 (21%), Positives = 149/389 (38%), Gaps = 93/389 (23%)

Query: 97  REGKIGKIIRTPVDDEGNYINEFCIRPASM----EENHGAATNHLIFIHGYGAGLGFFIK 152
           R  K+ K I   V  EG+  N+      +      E         + IHGY A    F +
Sbjct: 67  RLEKLQKCIMEQVHVEGSKNNDKLFDEINQWHFRNEKASTVLTPTLLIHGYAASSMSFFR 126

Query: 153 NFEHLPLLDDQWVIHAIDLPGYGYST----------------------RCQFPFDVNTH- 189
           N+  L        +++IDLP  G S+                      + + P+ +N + 
Sbjct: 127 NYPGLS--KHIQNLYSIDLPASGLSSIPPLEINATTPLPLDIEFTGKNKFKIPYTINLNH 184

Query: 190 ---SVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNHFKKLIM 246
               ++  E ++ +++E W     L +      ++ HS G YL+  YA    N  +KL +
Sbjct: 185 HKFVIQMYEDFYLDKIEQWRIDNKLGKVN----IVGHSFGGYLSFKYAAKYPNSVEKLCL 240

Query: 247 CSPAGISPS----KSMKKQPPWWFIKLWD--------RNVSP-------FSLVRNSGPLG 287
            SP G+  +     +  +    + I   D        RN+ P       F L+R  GP+G
Sbjct: 241 VSPLGVERNIWSINNNFRSNTLYTIGFEDPSSKFYSKRNMIPKYLFERQFQLLRMMGPVG 300

Query: 288 SKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIP 347
           +KL   W++             M  +  +   +Y         EY+       GG P + 
Sbjct: 301 AKLC--WNYI------------MAAYSRVPSLAYK--------EYIFELFYGKGGIPEVT 338

Query: 348 --LLGSMFS---------PEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYIT---DRI 393
             +   +FS          +  H    + + + +YG + WM+K+ G      +    + +
Sbjct: 339 TEIFKGLFSRCILAKDPLMDSLHYLNVR-KLMVVYGQYDWMNKKAGMLMVENLNSLGNCL 397

Query: 394 GGKSRVEIVPNSGHHLYFDNYSYFNKILL 422
              S +EI P+SGH+L+ DN   FN+ ++
Sbjct: 398 EKASYLEI-PSSGHNLFLDNPLSFNQSIV 425

>NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284
          Length = 430

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 78/334 (23%), Positives = 132/334 (39%), Gaps = 75/334 (22%)

Query: 132 AATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDV----- 186
           A T   + +HGY A    F + F  +PL      ++A DLPG G S    F F V     
Sbjct: 106 AVTTPTLLLHGYAASSLCFFRTF--VPLSRSIKNLYATDLPGNGLSKNKSF-FSVMYGNE 162

Query: 187 ----------------------NTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHS 224
                                  T+S++  E ++ + +  W     L   P  N+V  HS
Sbjct: 163 YMKVKYEENNKFSIKYLNSLKDQTNSIKHSEDYYIDAIREWQLSNNL---PKINLV-GHS 218

Query: 225 MGAYLTAHYAQSRQNHFKKLIMCSPAGI-----SPSKSMKKQPPWWF------IKLWDRN 273
            G YL+  YA    ++  KL + SP G+     S + S+K+   +           + RN
Sbjct: 219 FGGYLSFKYALRYPDNVNKLCLVSPLGVESNLYSVNNSLKENYLYDVDYSDPKSSYYSRN 278

Query: 274 VS--------PFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFN 325
            +         F ++R  GP+G+++   +    ++ + +             KY   +F+
Sbjct: 279 FAIPKSLFEGQFGILRWMGPIGARVCWNYILSSYKRVPS------------MKYKEYLFH 326

Query: 326 MP-GSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLW-LYGDHVWMDKEGG- 382
           +  G+ + L++            LL     P  +   K QCE L  +YG H WM+K  G 
Sbjct: 327 LLFGNAKKLVTSAKTFTNLFTRNLLAK--DPIMDSIEKLQCEKLMVMYGQHDWMNKYAGY 384

Query: 383 ---QRASSYITDRIGGKSRVEIVPNSGHHLYFDN 413
               + ++Y + +  G      +P +GH+L  DN
Sbjct: 385 CLIAKLNNYRSTKDAG--YFTEIPEAGHNLILDN 416

>Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar to
           Ashbya gossypii AGR062C
          Length = 405

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 73/337 (21%), Positives = 131/337 (38%), Gaps = 67/337 (19%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDV----------- 186
           + +HGY      + +N   L   +    ++ IDLP  G S       D+           
Sbjct: 87  LLLHGYATSSMCYHRNMPQLS--EGIKHLYTIDLPANGLSKELPLELDIAKPIVFKPEFN 144

Query: 187 ----------------NTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLT 230
                           +  +++++E ++ + +E W  K  L      N+V  HS G Y++
Sbjct: 145 SVKSEFHIPYTIDGLHHRCAIQKLEDYYIDSIELWRRKNSLGAI---NLV-GHSFGGYIS 200

Query: 231 AHYAQSRQNHFKKLIMCSPAGI-----SPSKSMKKQPPWWFIKLWDRNVSPFS------- 278
             Y+     + KKL + SP G+     S   + +   P+  I   D +   F+       
Sbjct: 201 FKYSIKYPQNVKKLCLISPIGVERNIYSVHNNWRSNCPY-SIDYEDPSSKHFANKTMIPE 259

Query: 279 --------LVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSG 330
                   L+R  GPLG+KL  GW   ++ + +          E +    Y    M  + 
Sbjct: 260 FVFNEQTKLLRLMGPLGAKL--GW---KYINAVYSKVPNFLYLEFIFTLIYGKNVMTDTS 314

Query: 331 EYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQR-ASSYI 389
             + +++       R P+L S+   E  H  K     L LYG+H W+  + G+     + 
Sbjct: 315 RNIFTYLFTNSLLARDPMLDSL---EHLHVDKL----LMLYGEHDWVRSQPGKMMVEEFN 367

Query: 390 TDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILLREMQ 426
             R      + +VP++ H+L+ DN  +FN  LL  ++
Sbjct: 368 KQRSHPSGTLTVVPDASHNLFLDNPVFFNVALLNFLK 404

>NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8.284
          Length = 416

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 71/341 (20%), Positives = 128/341 (37%), Gaps = 67/341 (19%)

Query: 129 NHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYG------------- 175
           N    T   + +HGY A    F + F   PL ++   ++AIDLP  G             
Sbjct: 89  NTSTVTIPTLLLHGYAASSMSFYRTFA--PLSNNFKNLYAIDLPANGLSVAIPLKITKQR 146

Query: 176 -------------YSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMA 222
                        +S     P +     + + E ++ + + +W     +     +  ++ 
Sbjct: 147 KRLYEVKYKENNKFSISYPVPIEEQKPLIEQYENYYLDAMRSWQVANNI----EKFNLVG 202

Query: 223 HSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPSKSMKKQPPWWFIKLWDRNV----SPF- 277
           HS G Y +  YA    +   KL + SP G+  S        +   K+++ N+    SPF 
Sbjct: 203 HSFGGYFSFKYALRFPDSINKLCLVSPLGME-SNIFSIHNKFEENKIYNVNLTDPTSPFY 261

Query: 278 ---------------SLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYA 322
                           ++R  GP G++L   +    ++ +       M   E L +  Y 
Sbjct: 262 GKKFQIPNYLFENQLDVIRKLGPFGARLCWNYILSAYKRV-----PSMEYKEYLFELFYG 316

Query: 323 IFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGG 382
              +      L + +L      R P+L S+   +  +        L +YG+H WM++  G
Sbjct: 317 NRQVSPILCELFTNLLTRNLLARDPILDSIDQLQLSNV-------LVMYGEHDWMNRYAG 369

Query: 383 QRASSYITD--RIGGKSRVEIVPNSGHHLYFDNYSYFNKIL 421
               S + +  R    ++   VP +GH+L+ DN  YF+  L
Sbjct: 370 YCMVSRLNNIRRTPNTAQYLQVPAAGHNLFLDNPEYFSSAL 410

>CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa]
           {ON} similar to uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 386

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 76/361 (21%), Positives = 137/361 (37%), Gaps = 101/361 (27%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYST-----------RCQFPFDV 186
           + +HGYGA    + + F   PL      ++AIDLP  G S            + +F  + 
Sbjct: 48  LLVHGYGASSMAYHRCFA--PLSRHIRDLYAIDLPANGLSEAPPLVAEGEAPKAKFKIEE 105

Query: 187 NTHSV--------------------------------REVEAWFHERLETWLSKRGLLQA 214
           N  +V                                ++ E ++ E +E W  +  L   
Sbjct: 106 NKFTVVQGARRAAEPVTDAQVDQELMLRTHREKRRYLQQYEDYYVESIEQWRKENNL--- 162

Query: 215 PHRNMVMAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPS-------------KSMKKQ 261
             +  ++ HS G YL+  YA        KL + SP G+  +               +++ 
Sbjct: 163 -DKFNLVGHSFGGYLSYKYALKYPESVNKLCLLSPLGMERNIHSINNTFEENVVYELQES 221

Query: 262 PPWWFIKLWDRNV------SPFSLVRNSGPLGSKLTSGW---SFRR-----FRHLLNEGE 307
            P  ++    R        + FS++R  GP+G KL   +   S+ +     ++  L E  
Sbjct: 222 DPSSYLYTRKRKAPKFLFENQFSVLRWMGPIGDKLCLSFINSSYAKVPSQAYKDYLFESF 281

Query: 308 IGMRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEW 367
           +G + F   + ++          ++L +  L    DP +  +  +  P+           
Sbjct: 282 LGKKHFAKQNVHAL---------KHLFTRSL-LARDPIMDTIDKLKVPDVS--------- 322

Query: 368 LWLYGDHVWMDKEGG----QRASSY-ITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILL 422
              YGDH WM+   G    +R   + +    GG +    VP++GH+L+ DN  YF+K L+
Sbjct: 323 -VFYGDHDWMNSYAGYLMVERLKKFRVASTSGGSASYLEVPDAGHNLFLDNPDYFSKKLV 381

Query: 423 R 423
           +
Sbjct: 382 Q 382

>KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {ON}
           Anc_8.284 YDR125C
          Length = 391

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 70/340 (20%), Positives = 133/340 (39%), Gaps = 86/340 (25%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYST------------------- 178
           + IHGY A    F + F  L    D   ++AIDLPG G S+                   
Sbjct: 72  LLIHGYAASSMAFHRTFNRLS--TDIKDLYAIDLPGNGLSSAPELSDVIKMKDLKITLNK 129

Query: 179 -------RCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTA 231
                  +     ++   ++ + E ++  R++ W    G+     +  V+ HS G +++ 
Sbjct: 130 SKDGFTLKKAIDLEIEKANLAKYENYYLSRIDEWRKFHGI----EKLNVIGHSFGGFISF 185

Query: 232 HYAQSRQNHFKKLIMCSPAGISPS-------------KSMKKQPPWWFIKLWDRNV---- 274
            YA +  N    LI+ SP G+  +              ++  + P         NV    
Sbjct: 186 KYAITHPNQVNDLILVSPLGMEKNIHSLNNNFELETKYTLDFENPASLYYARSFNVPSIL 245

Query: 275 --SPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEY 332
             +  +++R  GPLG ++   +    ++ + +          A   Y Y +F     G+ 
Sbjct: 246 FNNQLNILRWMGPLGGRMARQYIDMAYKKVPD---------VAYKNYLYYVF---YDGK- 292

Query: 333 LLSFVLKCGGDPRIPL--LGSMFS-------PEKEHGFKAQCEWLWL-YGDHVWMDKEGG 382
             SF       P++ +    +MFS       P  ++  K + + + L YG+H WMDK  G
Sbjct: 293 --SF-------PKVTINNFTNMFSKNLLARDPIMDNLLKLRAKKVMLVYGEHDWMDKYAG 343

Query: 383 QRASSYITD---RIGGKSRVEIVPNSGHHLYFDNYSYFNK 419
                 ++    ++        +P++GH+L+ DN + F++
Sbjct: 344 YNMVELLSKSNYKLKDTVHYVEIPDAGHNLFLDNPTDFSE 383

>NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {ON} 
          Length = 396

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 108/257 (42%), Gaps = 43/257 (16%)

Query: 191 VREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNHFKKLIMCSPA 250
           + ++E ++ + +E W  +R        N+V  HS G YL+  YA        KL + SP 
Sbjct: 156 IDKLENYYLDVIEKW--RRANYGLDKFNLV-GHSFGGYLSFKYAIKYPEVVDKLCLVSPL 212

Query: 251 GISPS-------------KSMKKQPPWWFIKLWDRNVSPF------SLVRNSGPLGSKLT 291
           G++ +               M  Q P   +    R +  F      ++++  GP+GSKLT
Sbjct: 213 GVASNIRSVNNVFDTKKEYVMDLQNPGSMLYNRQRMIPNFLFNNQLNVLKWMGPVGSKLT 272

Query: 292 SGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNM--PGSGEYLLSFVLKCGGDPRIPLL 349
                   R  +N   + +   +    Y Y  F M  P     + + +       R P++
Sbjct: 273 --------RKYINSAYVKVPTMD-YKDYLYEYFQMGVPQVNVDIFTKLFSRNLMARDPIM 323

Query: 350 GSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQ---RASSYITDRIGGKSRVEIVPNSG 406
            +M      +  K+   ++ +YGD+ WMDK  G    +  + I +    K+    +P++G
Sbjct: 324 DNM------NRLKS-TRFMMMYGDNDWMDKFSGYTLVQNINKIKNNFDRKATYVEIPDAG 376

Query: 407 HHLYFDNYSYFNKILLR 423
           H+L+ DN   F+  L++
Sbjct: 377 HNLFLDNPEDFSNNLIK 393

>SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 419

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 71/337 (21%), Positives = 130/337 (38%), Gaps = 73/337 (21%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHS------- 190
           + +HGY A    F +NF  L        ++AIDLP  G S     P  V+          
Sbjct: 100 LLLHGYAAASMGFHRNFAGLSSRIQN--LYAIDLPANGLSPGSSQPLVVSCGEPLPMKAE 157

Query: 191 --------------------VREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLT 230
                               ++++E ++   +E W     L    ++  ++AHS G YL+
Sbjct: 158 FSNDRFKIPYTLEYLHQKSFIQQLEDYYLNSIEQWRIDNKL----NKINIVAHSFGGYLS 213

Query: 231 AHYAQSRQNHFKKLIMCSPAGISPSKSMKKQPPWWFIKLW-DRNV--------------- 274
             YA    +  ++L + SP G+   +++      W    W D N                
Sbjct: 214 TKYAIKYPHAVERLCLVSPLGV--ERNIHSVNNHWCSNTWYDLNYEDPGSKYYMRRMRGI 271

Query: 275 ------SPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPG 328
                 S   L+R  GPLG+KL   +    +  + NE     +  E + +  Y    +  
Sbjct: 272 PSTVFQSQVKLLRLLGPLGAKLCWNYINAAYSRVKNE-----KYKEYVFELFYGKEGVTQ 326

Query: 329 SGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSY 388
           +   + + +       + PL+ S+     +H    +   +  YG+H WM+K  G   +  
Sbjct: 327 TAMDIFTNLFTRQLLAKDPLMDSL-----QHLHVGRL--MLAYGEHDWMNKYAGVLMTKE 379

Query: 389 ITDRIGGKSRV---EIVPNSGHHLYFDNYSYFNKILL 422
             + + GKS      ++ +SGH+++ DN   FN+ ++
Sbjct: 380 F-NHLRGKSDAATYTVISSSGHNMFLDNPDEFNEKVI 415

>NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 87/390 (22%), Positives = 140/390 (35%), Gaps = 74/390 (18%)

Query: 83  QVGLLSTLPFFERAREGKIGKIIRTPVDDEGNYINEFCIRPASMEENHGAATNHLIFIHG 142
           Q+  L TL       + K+   ++     E + +N    + +   EN    T   + +HG
Sbjct: 59  QIAKLETL-------QSKVMDQVQVEGTKENSMLNNELNQWSFHNENTSQITTPTLLLHG 111

Query: 143 YGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYS------------------------T 178
           Y      F + F   PL      ++AID P  G S                        T
Sbjct: 112 YATSSIAFFRTFG--PLSKQIRDLYAIDFPANGLSKAPPLNVNHLKKHTPYKVKFKDDNT 169

Query: 179 RCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQ 238
           + Q    V+    +E    +       + K  L     +  ++ HS G Y    YA    
Sbjct: 170 KFQISHTVDVQLQKETIEHYENYYLDAVRKWQLTNKIEKFNLVGHSFGGYFAYKYALRYP 229

Query: 239 NHFKKLIMCSPAGI-----SPSKSMKKQPPWWF------IKLWDRNVS--------PFSL 279
           +   KL + SP G+     S + + + +  +         K + R            F +
Sbjct: 230 DSVDKLCLVSPLGVERNIYSVNNNFEDKKVYNLELEDPTSKYYGRTFQIPKCLFEGQFDI 289

Query: 280 VRNSGPLGSKLTSGW---SFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSF 336
           +R  GPLG + T  +   S+RR   +    E     FE L+         P   E + S 
Sbjct: 290 LRKFGPLGPRFTWNYINSSYRRVPSM----EFKEYIFELLYGNRKT---SPILTE-VFSN 341

Query: 337 VLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQ---RASSYITDRI 393
           ++      R P+L S+         KA    L +YG   WM+ + G    +  + I +  
Sbjct: 342 IVSRNLLARDPILDSI------DELKASNVML-MYGQEDWMNSQAGYLMVKELNEIRENP 394

Query: 394 GGKSRVEIVPNSGHHLYFDNYSYFNKILLR 423
              S VE VPN+GH+L+ DN  +F   L R
Sbjct: 395 NAASYVE-VPNAGHNLFLDNPDFFCSSLTR 423

>TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.284
           YDR125C
          Length = 421

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 79/158 (50%), Gaps = 27/158 (17%)

Query: 277 FSLVRNSGPLGSKLTSGWSF--RRFRHLLNEGEIGMRQFEALHKYSYAIF-NMPGSGEYL 333
           F++++  GPLGSKLT  WSF  RR+ H+ +E         A   + + +F  +P      
Sbjct: 284 FNVLKCMGPLGSKLT--WSFISRRYEHIASE---------AYQNFLFKLFATVPNVTINN 332

Query: 334 LSFVLKCGGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHVWMDKEGGQRASSYITDRI 393
            S +       + P++ S+   + +       + L  YG++ WM+KE G   +  + + +
Sbjct: 333 FSNMFTRNLLAKDPIMDSINKLQSK-------KLLLFYGENDWMNKEAGFLMAEKL-NIL 384

Query: 394 GGKSR----VEIVPNSGHHLYFDNYSYFNKILLREMQS 427
            G S+    +E VPNSGH+L  D+  +F+K L+  + S
Sbjct: 385 KGDSKYANWIE-VPNSGHNLILDDPKFFSKNLIDFLSS 421

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 60/155 (38%), Gaps = 47/155 (30%)

Query: 138 IFIHGYGAGLGFFIKNFEHLP-LLDDQWVIHAIDLPGYGYS----------TRCQFPFDV 186
           + IHGY A    + K F +L   + D   ++ IDLPG+G S           R +  FD+
Sbjct: 54  VLIHGYAASSMAYYKTFRYLTGSIKD---LYTIDLPGFGLSASPKIIINDHNRKKSQFDI 110

Query: 187 ----------NTHSVRE-------------------VEAWFHERLETWLSKRGLLQAPHR 217
                     N  S+ +                    + ++ +R+E W     L +    
Sbjct: 111 KLIDSKDSNNNKFSISKKNLKLLENGNIEDKAFISAFDDYYIDRIEKWRKFNNLGKIN-- 168

Query: 218 NMVMAHSMGAYLTAHYAQSRQNHFKKLIMCSPAGI 252
             V+ HS G Y++  YA    +  + L + SP G+
Sbjct: 169 --VIGHSFGGYISFKYAIKYPDSIENLCLVSPFGM 201

>KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {ON}
           Anc_8.524 YBR204C
          Length = 356

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 55/116 (47%), Gaps = 16/116 (13%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTR-CQFPFDVNTHSVREVEA 196
           IFIHG G  L  F    + L L +  +V  AIDLPG+G S     +P       V+ ++A
Sbjct: 86  IFIHGLGGSLDQFFPLLKLLDLSEKYFV--AIDLPGFGKSDEHTDYPM---IQVVKHIDA 140

Query: 197 WFHERL-ETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQ--SRQNHFKKLIMCSP 249
              E L E  L       A     ++ HSMG YLT H+    S++    K+++ +P
Sbjct: 141 VISELLNEARL-------AFDTVRLIGHSMGCYLTLHFMTLFSKKYRIGKVVLLAP 189

>Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR204C
           - Hypothetical ORF [contig 26] FULL
          Length = 336

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 72/154 (46%), Gaps = 26/154 (16%)

Query: 98  EGKIGKIIRTPVDDEGNYI--NEFCIRPAS--MEENHGAATNH-----LIFIHGYGAGLG 148
           +G   KI+  P+D +  ++  NE  I   +  +   H  A  H      +FIHG G  L 
Sbjct: 33  KGLASKILSDPLDFQNRFLADNEHYITTGTTKLRICHNVAHQHGTGPVYVFIHGLGGTLT 92

Query: 149 FFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERL-ETWLS 207
            F      L +L++ ++   IDLPG+G+S       +++++S+ ++     E L ET  +
Sbjct: 93  QFEPLLRVLDVLNEGFL--TIDLPGFGHSD------ELDSYSMLDIAKIIREVLVETTKN 144

Query: 208 KRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNHF 241
           K+ +        V+ HSMG ++  H+ Q     F
Sbjct: 145 KKVI--------VVGHSMGCHIALHFGQLYNAEF 170

>ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 349

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 81/199 (40%), Gaps = 41/199 (20%)

Query: 75  FKSDREAFQVGLLSTLPFFERAREGKIGKIIRTP--------VDDEGNYINEFC------ 120
           F  +R   +V LL   P  ER+    +G+    P        +  E ++   F       
Sbjct: 3   FDLNRVVEEVCLLEGQPLSERSLAAIVGEYDDGPTLSKTIRGIGAEKDFNTRFIADRAEC 62

Query: 121 -------IRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPG 173
                  IR     ++        +FIHG G  L  F      +  +D +++  A+DLPG
Sbjct: 63  VDVRGKKIRVCHNCQDSSQVHELFLFIHGLGGELEQFEPLLRLVDAMDQRFL--ALDLPG 120

Query: 174 YGYSTRC-QFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAH 232
           +G S    ++P      ++ E+ A F+                 + +++ HSMG YLT+H
Sbjct: 121 FGKSDEWDEYPMLKVVETIEEIAAKFN---------------AAKIVLVGHSMGCYLTSH 165

Query: 233 YAQS--RQNHFKKLIMCSP 249
           + ++  + +   ++++ SP
Sbjct: 166 FYEAYHKVHSINRIVLLSP 184

>SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {ON}
           similar to uniprot|P38139 Saccharomyces cerevisiae
           YBR204C Hypothetical ORF
          Length = 392

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 56/118 (47%), Gaps = 19/118 (16%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAW 197
           +FIHG G  L  F    + L LL+  +   ++DLPG+G S               EVE++
Sbjct: 133 VFIHGLGGTLAQFEPLLKLLSLLNKGFF--SMDLPGFGSSD--------------EVESY 176

Query: 198 FHERLETWLSKRGLLQAPHRNMVM-AHSMGAYLTAHYAQSRQNH--FKKLIMCSPAGI 252
               +   + K      P RN+V+  HSMG YL  H+  + Q    F++L++ +P  +
Sbjct: 177 GMLEIVAIVQKTFAKLTPSRNLVLIGHSMGCYLAIHFCSAFQEQYSFQELVLLAPPSL 234

>KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON} 
          Length = 356

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 55/108 (50%), Gaps = 13/108 (12%)

Query: 146 GLGFFIKNFEHLPLLDDQWVIH--AIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLE 203
           GLG  ++ FE L  L D    +  AIDLPG+G S       D + +S+  +     + LE
Sbjct: 88  GLGGNLEQFEPLVRLIDASNKNFLAIDLPGFGKSE------DYSNYSMTHIATLIDQMLE 141

Query: 204 TWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQ--SRQNHFKKLIMCSP 249
           T +   G     ++  VM HSMG +L  H+ +  +++   +KLI+ SP
Sbjct: 142 TVI---GTAPDNYKINVMGHSMGTHLALHFYELFNKKYTVEKLILVSP 186

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 58/114 (50%), Gaps = 10/114 (8%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAW 197
           IFIHG G  L  F+   +   L +  ++  A+DLPG+G S      +++  +S+  +  +
Sbjct: 93  IFIHGLGGSLEQFLPLLKLTDLSNKSFI--AVDLPGFGQS-EFNDEYNIANYSMSSIIGF 149

Query: 198 FHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNHF--KKLIMCSP 249
               L++ +  R  L    + ++  HSMG YL  H+ Q  +  +  +K+++ +P
Sbjct: 150 ----LKSQVFSR-YLTTNTKIILTGHSMGCYLALHFYQQYKTEYQIQKIVLLAP 198

>NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON}
           Anc_8.524 YBR204C
          Length = 362

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 57/114 (50%), Gaps = 14/114 (12%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAW 197
           +FIHG G  L  F      L L +++++  A+DLPG+G S       +   +++ +V + 
Sbjct: 93  LFIHGLGGVLEQFEPLLRLLDLNENKFL--ALDLPGFGKSD------EYEDYNMFDVISI 144

Query: 198 FHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAH--YAQSRQNHFKKLIMCSP 249
            H  ++  + +R         +++ HSMG Y++ H  Y    +  FKKL+  SP
Sbjct: 145 IHTIVDRLIPER----TTSNIVLVGHSMGCYISLHLFYKSYTRFSFKKLVFLSP 194

>CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa]
           {ON} weakly similar to uniprot|P38139 Saccharomyces
           cerevisiae YBR204c peroxisomal serine-active lipase
          Length = 354

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 59/130 (45%), Gaps = 15/130 (11%)

Query: 137 LIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEA 196
            + IHG G  +  F    + L LL  ++ + A+DLPG+G S         N + +  V +
Sbjct: 78  FLLIHGLGGSMDQFQPLMKLLTLL--KYRVIALDLPGFGQSGS-----STNGYDMLYVTS 130

Query: 197 WFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQS--RQNHFKKLIMCSPAGISP 254
              + ++  +  +  +       V+ HSMG Y+ +H+ Q    + +  KL++  P    P
Sbjct: 131 VVKKVVDNNIENKTDIDFK----VVGHSMGCYIASHFVQMYHEEYNIDKLVLTCPP--PP 184

Query: 255 SKSMKKQPPW 264
           S S  +Q  +
Sbjct: 185 SISTLRQDNY 194

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 68/151 (45%), Gaps = 15/151 (9%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAW 197
           +FIHG G  LG F        L   +++   +DLPG+G S       ++ ++S++ V   
Sbjct: 85  LFIHGLGGSLGQFEPLLRLTHLKGKKFL--TLDLPGFGQSD------ELESYSMKSVIET 136

Query: 198 FHERLETWL-SKRGLLQAPHRNMVMA-HSMGAYLTAHYAQ--SRQNHFKKLIMCSPAGIS 253
               ++    +++ L +     +++  HSMG YL  H+ +  S+    +K+ + SP    
Sbjct: 137 IRSVVDLATGNQKSLGENTQLKLILTGHSMGCYLCLHFFETYSKNYDIRKIALLSPPK-P 195

Query: 254 PSKSMKKQPPWWFIKLWDRNVSP--FSLVRN 282
              S+ K+  W    LW     P  F L RN
Sbjct: 196 IMTSLSKRNYWTQWALWGVFKLPFIFDLYRN 226

>KLTH0E12188g Chr5 (1082142..1083152) [1011 bp, 336 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 336

 Score = 37.4 bits (85), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 61/141 (43%), Gaps = 26/141 (18%)

Query: 104 IIRTPVDDEGNYINE----FCIRPASMEENHGAATNH-----LIFIHGYGAGLGFFIKNF 154
           I++ P+D E +++ E      +    +  +H     H      +F HG G  L  F    
Sbjct: 39  ILKEPLDFENSFLAEHERFLQVGTTRLRTSHNIKHQHGEGPIYLFFHGLGGNLTQFEPLL 98

Query: 155 EHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQA 214
             L  L++ +V  A+DLPG+G S       + + + + +V    H+          L   
Sbjct: 99  RLLGELNEGFV--AMDLPGFGLSE------EQDGYQMLQVTQVIHDAF--------LQIT 142

Query: 215 PHRNMVMA-HSMGAYLTAHYA 234
            H+ +++  HSMG +L  H+A
Sbjct: 143 DHKKIILVGHSMGCHLVLHFA 163

>TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.524
           YBR204C
          Length = 378

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 52/116 (44%), Gaps = 9/116 (7%)

Query: 138 IFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAW 197
           +F+ G G  L  +      + +L+++++    DLPG+G S         N   V  +   
Sbjct: 98  VFLPGLGGSLDQYEPLLRLMDILNEKFI--GFDLPGFGGSEEDTSEGGYNMIKVCHI--- 152

Query: 198 FHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQN----HFKKLIMCSP 249
            +E L++ +++    +      ++ HSMG YL  H+  S Q        +LI+ SP
Sbjct: 153 INEALQSIITQNYSTRDTIELRLVGHSMGCYLVLHFFNSFQTKTEYKISQLILTSP 208

>TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {ON}
           Anc_8.524 YBR204C
          Length = 348

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 44/99 (44%), Gaps = 16/99 (16%)

Query: 137 LIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTR-CQFP-FDVNTHSVREV 194
            +FIHG G  L  F      L   +  ++  A DLPG+G S    Q+P  DV    V+ +
Sbjct: 81  FLFIHGLGGTLEQFEPVLRELDQRNKSFL--AFDLPGFGKSDEWDQYPMLDV----VKSI 134

Query: 195 EAWFHERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHY 233
           +   H+           L+    N++  HSMG YL  H+
Sbjct: 135 DWLIHQLTNN-------LKFEKLNLI-GHSMGCYLAVHF 165

>Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON}
           YBR204C (REAL)
          Length = 376

 Score = 33.5 bits (75), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 54/115 (46%), Gaps = 14/115 (12%)

Query: 146 GLGFFIKNFE-HLPLLD-DQWVIHAIDLPGYGYSTR-CQFPFDVNTHSVREVEAWFHERL 202
           GL   ++ FE  L L+D DQ    A+DLPG+G+S+    +P       V  +     + L
Sbjct: 95  GLAGNLEQFEPLLKLIDSDQKAFLALDLPGFGHSSEWADYPM---LKVVELIFVLVCDVL 151

Query: 203 ETWLS----KRGLLQAPHRNMVMA-HSMGAYLTAHYAQSRQNHFK---KLIMCSP 249
           + W +     R +    +R +V+  HSMG +L  H  +      K   K+++ +P
Sbjct: 152 KKWPAAVPKDREVNPFDNRKIVLTGHSMGCFLACHLYEQHLAALKVVEKMVLLTP 206

>Kwal_27.9730 s27 complement(37595..39706) [2112 bp, 703 aa] {ON}
           YML128C (MSC1) -  [contig 336] FULL
          Length = 703

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 3/49 (6%)

Query: 261 QP-PWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEI 308
           QP PWW  K W+R         N  P+       WS +  R LLN+ ++
Sbjct: 64  QPTPWW--KFWERKTRLADFYHNQDPISEWFFDSWSAKDLRKLLNKSKV 110

>KLTH0E16258g Chr5 (1444885..1447011) [2127 bp, 708 aa] {ON} similar
           to uniprot|Q03104 Saccharomyces cerevisiae YML128C MSC1
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the endoplasmic
           reticulum msc1 mutants are defective in directing
           meiotic recombination events to homologous chromatids
          Length = 708

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 3/49 (6%)

Query: 261 QP-PWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEI 308
           QP PWW  K W+R         N  P+       WS +  R LL++ ++
Sbjct: 64  QPTPWW--KFWERKTKLADFTSNQEPISEWFFDSWSAKDLRKLLSKNKV 110

>KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {ON}
           similar to uniprot|P53750 Saccharomyces cerevisiae
           YNR064C
          Length = 294

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 8/61 (13%)

Query: 137 LIFIHGYGAGLGFFIKNFEHL-PLLDDQWVIHAIDLPGYGYSTRCQ---FPFDVNTHSVR 192
           ++ +HGY      F     HL PL+ D++ + A DLPG+G++   +   + FD    +VR
Sbjct: 33  IVLLHGYPTSSTMF----RHLIPLISDKFHVIAPDLPGFGFTEVPEDYHYSFDNLAATVR 88

Query: 193 E 193
           E
Sbjct: 89  E 89

>Skud_14.400 Chr14 complement(717609..718490) [882 bp, 293 aa] {ON}
           YNR064C (REAL)
          Length = 293

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 7/65 (10%)

Query: 131 GAATN-HLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYS---TRCQFPFDV 186
           G A N  ++ +HG+ +    F +N   +PLL  Q+ + A DLPG+G+S       F FD 
Sbjct: 25  GVAGNPTIVLLHGFPSSSNMF-RNL--IPLLASQFHVIAPDLPGFGFSETPDDYTFSFDA 81

Query: 187 NTHSV 191
            + +V
Sbjct: 82  LSDTV 86

>YNR064C Chr14 complement(749136..750008) [873 bp, 290 aa] {ON}
           Epoxide hydrolase, member of the alpha/beta hydrolase
           fold family; may have a role in detoxification of
           epoxides
          Length = 290

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 7/65 (10%)

Query: 131 GAATN-HLIFIHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYS---TRCQFPFDV 186
           GAA N  ++ +HG+      F +N   +PLL  Q+ I A DLPG+G++      +F FD 
Sbjct: 25  GAAGNPTILLLHGFPTSSNMF-RNL--IPLLAGQFHIIAPDLPGFGFTETPENYKFSFDS 81

Query: 187 NTHSV 191
              S+
Sbjct: 82  LCESI 86

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.139    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,597,648
Number of extensions: 2315643
Number of successful extensions: 4494
Number of sequences better than 10.0: 73
Number of HSP's gapped: 4420
Number of HSP's successfully gapped: 99
Length of query: 431
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 319
Effective length of database: 40,638,807
Effective search space: 12963779433
Effective search space used: 12963779433
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)