Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AAL184W8.830ON1121125801e-78
KLLA0D01661g8.830ON1121003632e-45
Ecym_27118.830ON1151043535e-44
CAGL0J06666g8.830ON1121103274e-40
Kwal_27.103288.830ON1271083173e-38
SAKL0D01738g8.830ON1781093213e-38
Suva_13.368.830ON1051043134e-38
YML108W8.830ON1051053136e-38
Smik_13.268.830ON1051053092e-37
Skud_13.338.830ON1051053057e-37
Kpol_1069.38.830ON1151083051e-36
NDAI0E003608.830ON1221203052e-36
TPHA0I001908.830ON138853062e-36
TDEL0B006708.830ON1111082981e-35
ZYRO0G13970g8.830ON112992971e-35
TBLA0B031908.830ON1221152939e-35
KLTH0C04070g8.830ON1131112911e-34
KNAG0G033608.830ON1111062911e-34
NCAS0B011008.830ON1151092912e-34
KAFR0A027608.830ON112892668e-31
SAKL0H09042gna 1ON46568661.1
ZYRO0G07128g4.69ON50071632.5
Ecym_81655.367ON99662615.6
SAKL0H10274g8.526ON88469607.3
KLLA0E23607g8.551ON23679599.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AAL184W
         (112 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AAL184W Chr1 (12906..13244) [339 bp, 112 aa] {ON} Syntenic homol...   228   1e-78
KLLA0D01661g Chr4 complement(148193..148531) [339 bp, 112 aa] {O...   144   2e-45
Ecym_2711 Chr2 (1376908..1377255) [348 bp, 115 aa] {ON} similar ...   140   5e-44
CAGL0J06666g Chr10 complement(639077..639415) [339 bp, 112 aa] {...   130   4e-40
Kwal_27.10328 s27 (287686..288069) [384 bp, 127 aa] {ON} YML108W...   126   3e-38
SAKL0D01738g Chr4 (138687..139223) [537 bp, 178 aa] {ON} similar...   128   3e-38
Suva_13.36 Chr13 (54612..54929) [318 bp, 105 aa] {ON} YML108W (R...   125   4e-38
YML108W Chr13 (54793..55110) [318 bp, 105 aa] {ON} Putative prot...   125   6e-38
Smik_13.26 Chr13 (51023..51340) [318 bp, 105 aa] {ON} YML108W (R...   123   2e-37
Skud_13.33 Chr13 (54349..54666) [318 bp, 105 aa] {ON} YML108W (R...   122   7e-37
Kpol_1069.3 s1069 (4998..5345) [348 bp, 115 aa] {ON} (4998..5345...   122   1e-36
NDAI0E00360 Chr5 (57992..58360) [369 bp, 122 aa] {ON} Anc_8.830 ...   122   2e-36
TPHA0I00190 Chr9 complement(33784..34200) [417 bp, 138 aa] {ON} ...   122   2e-36
TDEL0B00670 Chr2 (127614..127949) [336 bp, 111 aa] {ON} Anc_8.83...   119   1e-35
ZYRO0G13970g Chr7 complement(1111500..1111838) [339 bp, 112 aa] ...   119   1e-35
TBLA0B03190 Chr2 complement(742438..742806) [369 bp, 122 aa] {ON...   117   9e-35
KLTH0C04070g Chr3 (355923..356264) [342 bp, 113 aa] {ON} similar...   116   1e-34
KNAG0G03360 Chr7 complement(723353..723688) [336 bp, 111 aa] {ON...   116   1e-34
NCAS0B01100 Chr2 complement(181912..182259) [348 bp, 115 aa] {ON...   116   2e-34
KAFR0A02760 Chr1 complement(575048..575386) [339 bp, 112 aa] {ON...   107   8e-31
SAKL0H09042g Chr8 (771410..772807) [1398 bp, 465 aa] {ON} simila...    30   1.1  
ZYRO0G07128g Chr7 (563726..565228) [1503 bp, 500 aa] {ON} highly...    29   2.5  
Ecym_8165 Chr8 complement(346320..349310) [2991 bp, 996 aa] {ON}...    28   5.6  
SAKL0H10274g Chr8 complement(877895..880549) [2655 bp, 884 aa] {...    28   7.3  
KLLA0E23607g Chr5 (2099005..2099715) [711 bp, 236 aa] {ON} simil...    27   9.3  

>AAL184W Chr1 (12906..13244) [339 bp, 112 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YML108W
          Length = 112

 Score =  228 bits (580), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%)

Query: 1   MATDNFYRMMILLEEPHKQHSTDGRKIENASHDFVDELLLPIQVDDLEVLNTWFDKFDEE 60
           MATDNFYRMMILLEEPHKQHSTDGRKIENASHDFVDELLLPIQVDDLEVLNTWFDKFDEE
Sbjct: 1   MATDNFYRMMILLEEPHKQHSTDGRKIENASHDFVDELLLPIQVDDLEVLNTWFDKFDEE 60

Query: 61  ICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQLDEDSSSDAK 112
           ICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQLDEDSSSDAK
Sbjct: 61  ICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQLDEDSSSDAK 112

>KLLA0D01661g Chr4 complement(148193..148531) [339 bp, 112 aa] {ON}
           similar to uniprot|Q03759 Saccharomyces cerevisiae
           YML108W defines a new subfamily of the split beta-alpha-
           beta sandwiches.
          Length = 112

 Score =  144 bits (363), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 83/100 (83%)

Query: 2   ATDNFYRMMILLEEPHKQHSTDGRKIENASHDFVDELLLPIQVDDLEVLNTWFDKFDEEI 61
           AT+N YRM+ILLEEP  + + D +K +NA+H+FVDEL LPIQVD++++LN+WFDKFDE+I
Sbjct: 3   ATENVYRMLILLEEPISESAGDTKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFDEKI 62

Query: 62  CIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAAN 101
           CIPNEGHIKYEISSDGLIVLILDK I  ++  V  FV  N
Sbjct: 63  CIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQN 102

>Ecym_2711 Chr2 (1376908..1377255) [348 bp, 115 aa] {ON} similar to
           Ashbya gossypii AAL184W
          Length = 115

 Score =  140 bits (353), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 85/104 (81%), Gaps = 1/104 (0%)

Query: 1   MATDNFYRMMILLEEPHKQHSTDGRKIENASHDFVDELLLPIQVDDLEVLNTWFDKFDEE 60
           M+ DNFYRMMILLEE   +   +  K  NA+HDFVDE++LP+QVD+L+VLN WFDKFDEE
Sbjct: 4   MSADNFYRMMILLEEAIPESKDENIK-ANATHDFVDEVVLPMQVDELDVLNKWFDKFDEE 62

Query: 61  ICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQLD 104
           IC+PNEG+IKYEISSDGLIVL++ +E S ++  V++FVA N LD
Sbjct: 63  ICLPNEGYIKYEISSDGLIVLMVSQERSSIVNQVKNFVAKNPLD 106

>CAGL0J06666g Chr10 complement(639077..639415) [339 bp, 112 aa] {ON}
           similar to uniprot|Q03759 Saccharomyces cerevisiae
           YML108w
          Length = 112

 Score =  130 bits (327), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 85/110 (77%), Gaps = 3/110 (2%)

Query: 5   NFYRMMILLEEPHKQHST--DGRKIENASHDFVDELLLPIQVDDLEVLNTWFDKFDEEIC 62
           N YRMM+LLEEP ++  T  D ++ +   H+F+DEL LP Q+D++++LN WFDKFD+EIC
Sbjct: 3   NLYRMMVLLEEPMEEDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDKFDDEIC 62

Query: 63  IPNEGHIKYEISSDGLIVLILDKEIS-EVIGLVRDFVAANQLDEDSSSDA 111
           IPNEGHIKYEI+SDGLIVLILDKE+  E +G V+ FV  N ++++   DA
Sbjct: 63  IPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQNNVEDEDEEDA 112

>Kwal_27.10328 s27 (287686..288069) [384 bp, 127 aa] {ON} YML108W -
           Hypothetical ORF [contig 36] FULL
          Length = 127

 Score =  126 bits (317), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 80/108 (74%), Gaps = 6/108 (5%)

Query: 1   MATDNFYRMMILLEEPHKQHST-DGRKIEN-----ASHDFVDELLLPIQVDDLEVLNTWF 54
           M+ +  YRM++L+E+P K   T DG K EN     A+H+FVDEL+LP ++DD++ LN WF
Sbjct: 15  MSDERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWF 74

Query: 55  DKFDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQ 102
           DKFD EICIPNEG IKYEISSDGL+VL+LD+   EV+  VR FV + +
Sbjct: 75  DKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQSER 122

>SAKL0D01738g Chr4 (138687..139223) [537 bp, 178 aa] {ON} similar to
           uniprot|Q03759 Saccharomyces cerevisiae YML108W defines
           a new subfamily of the split beta-alpha- beta
           sandwiches.
          Length = 178

 Score =  128 bits (321), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 64/109 (58%), Positives = 84/109 (77%), Gaps = 1/109 (0%)

Query: 1   MATDNFYRMMILLEEPHKQHSTDGRK-IENASHDFVDELLLPIQVDDLEVLNTWFDKFDE 59
           M+ DN YRM++LLEE     S +  +     SH+FVDEL+LPIQVD++++LN WFDKFDE
Sbjct: 70  MSGDNGYRMLMLLEEAIPDSSQENNENTTKTSHEFVDELVLPIQVDEMDLLNDWFDKFDE 129

Query: 60  EICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQLDEDSS 108
           +ICIPNEG+IKYEISSDGLIVLIL+KE  EV+  VR FV  +Q+ ++ +
Sbjct: 130 QICIPNEGYIKYEISSDGLIVLILNKEREEVVDKVRRFVEEHQVQDEEA 178

>Suva_13.36 Chr13 (54612..54929) [318 bp, 105 aa] {ON} YML108W
           (REAL)
          Length = 105

 Score =  125 bits (313), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 63/104 (60%), Positives = 79/104 (75%), Gaps = 3/104 (2%)

Query: 1   MATDNFYRMMILLEEPHKQHSTDGRKIENAS---HDFVDELLLPIQVDDLEVLNTWFDKF 57
           MA +N YRM++LLE+  K +  D + ++      H+FVDEL+LP QVD+L+ LN WFDKF
Sbjct: 1   MAKNNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELMLPFQVDELDELNVWFDKF 60

Query: 58  DEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAAN 101
           D EICIPNEGHIKYEISSDGLIVL+LDKEI +V+  V+ FV  N
Sbjct: 61  DAEICIPNEGHIKYEISSDGLIVLMLDKEIEDVVEKVKRFVEEN 104

>YML108W Chr13 (54793..55110) [318 bp, 105 aa] {ON} Putative protein
           of unknown function whose structure defines a new
           subfamily of the split beta-alpha-beta sandwiches; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YML108W is not an essential
           gene
          Length = 105

 Score =  125 bits (313), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 78/105 (74%), Gaps = 3/105 (2%)

Query: 1   MATDNFYRMMILLEEPHKQHSTDGRKIENAS---HDFVDELLLPIQVDDLEVLNTWFDKF 57
           M+  N YRM++LLE+  K +  D + ++      H+FVDEL+LP  VD+L+ LNTWFDKF
Sbjct: 1   MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKF 60

Query: 58  DEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQ 102
           D EICIPNEGHIKYEISSDGLIVL+LDKEI EV+  V+ FV  N 
Sbjct: 61  DAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVEENN 105

>Smik_13.26 Chr13 (51023..51340) [318 bp, 105 aa] {ON} YML108W
           (REAL)
          Length = 105

 Score =  123 bits (309), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 79/105 (75%), Gaps = 3/105 (2%)

Query: 1   MATDNFYRMMILLEEPHKQHSTDGRKIENAS---HDFVDELLLPIQVDDLEVLNTWFDKF 57
           M+ +N YRM++LLE+  K +  D + ++      H+FVDEL+LP  VD+L+ LN WFDKF
Sbjct: 1   MSRNNTYRMLVLLEDDAKVNKEDEKFLKGKPGKMHEFVDELILPFDVDELDELNIWFDKF 60

Query: 58  DEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQ 102
           D EICIPNEGHIKYEISSDGLIVL+LDKEI EVI  V+ FV  N+
Sbjct: 61  DAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVIEKVKQFVEDNK 105

>Skud_13.33 Chr13 (54349..54666) [318 bp, 105 aa] {ON} YML108W
           (REAL)
          Length = 105

 Score =  122 bits (305), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 78/105 (74%), Gaps = 3/105 (2%)

Query: 1   MATDNFYRMMILLEEPHKQHSTDGRKIENAS---HDFVDELLLPIQVDDLEVLNTWFDKF 57
           M+  N YRM++LLE+  K    D + ++      H+FVDEL+LP ++D+L+ LN WFDKF
Sbjct: 1   MSKSNAYRMLVLLEDDTKISKEDEKFLKGKPGKMHEFVDELILPFEIDELDELNIWFDKF 60

Query: 58  DEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQ 102
           D EICIPNEGHIKYEISSDGLIVL+LDKEI EV+  V++FV  N 
Sbjct: 61  DAEICIPNEGHIKYEISSDGLIVLMLDKEIQEVVEKVKNFVEDNN 105

>Kpol_1069.3 s1069 (4998..5345) [348 bp, 115 aa] {ON} (4998..5345)
           [348 nt, 116 aa]
          Length = 115

 Score =  122 bits (305), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 8/108 (7%)

Query: 2   ATDNFYRMMILLEE--------PHKQHSTDGRKIENASHDFVDELLLPIQVDDLEVLNTW 53
             ++ YRM+ILLEE          +Q  T+  K     H+FVDEL+LP QVD+++ LN W
Sbjct: 4   GAESNYRMLILLEEGMENLDEEQTQQDRTEEPKESKKMHEFVDELVLPFQVDEIDSLNDW 63

Query: 54  FDKFDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAAN 101
           FDKFDEEICIPNEGHIKYEI+SDG+IVLILDKEI  V+  V++FV +N
Sbjct: 64  FDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSN 111

>NDAI0E00360 Chr5 (57992..58360) [369 bp, 122 aa] {ON} Anc_8.830
           YML108W
          Length = 122

 Score =  122 bits (305), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 81/120 (67%), Gaps = 19/120 (15%)

Query: 2   ATDNFYRMMILLEEPHKQ-------------------HSTDGRKIENASHDFVDELLLPI 42
           +T+N YR+MILLEE   +                   H++D  K     H+F++EL+LP 
Sbjct: 3   STNNMYRLMILLEEEIGEPDLKDGSIDEATETETKDVHNSDEEKNVKKMHEFIEELILPF 62

Query: 43  QVDDLEVLNTWFDKFDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQ 102
             ++L++LN WFDKFDEEICIPNEGHIKYEI+SDGLIVL+LDKEI +V+G ++ F+  NQ
Sbjct: 63  GTEELDLLNEWFDKFDEEICIPNEGHIKYEITSDGLIVLLLDKEIEDVVGEIKKFIETNQ 122

>TPHA0I00190 Chr9 complement(33784..34200) [417 bp, 138 aa] {ON}
           Anc_8.830 YML108W
          Length = 138

 Score =  122 bits (306), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 73/85 (85%)

Query: 19  QHSTDGRKIENASHDFVDELLLPIQVDDLEVLNTWFDKFDEEICIPNEGHIKYEISSDGL 78
           +H+ +  + ++ SH+FVDEL+LP  VD+L++LN WFDKFD+E+CIPNEGHIKYEI+SDGL
Sbjct: 36  EHNVEKGETQSKSHEFVDELILPFNVDELDMLNEWFDKFDDEVCIPNEGHIKYEITSDGL 95

Query: 79  IVLILDKEISEVIGLVRDFVAANQL 103
           IVL+LDKEI  V+  V++FV+ANQ+
Sbjct: 96  IVLMLDKEIEHVVSKVKEFVSANQM 120

>TDEL0B00670 Chr2 (127614..127949) [336 bp, 111 aa] {ON} Anc_8.830
           YML108W
          Length = 111

 Score =  119 bits (298), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 57/108 (52%), Positives = 79/108 (73%), Gaps = 9/108 (8%)

Query: 2   ATDNFYRMMILLEEPHKQHSTDGRKIEN--------ASHDFVDELLLPIQVDDLEVLNTW 53
             DNFY M+I LEE   ++  +G  ++N        +SH+FVDEL+LP QVD+++ LN W
Sbjct: 3   GNDNFYHMIIFLEES-IENGQEGNSVDNGEDKQDVKSSHEFVDELVLPFQVDEIDALNEW 61

Query: 54  FDKFDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAAN 101
           FDKFDE++CIPNEGHIKYEI+SDG++VL+LDKE+  ++  V+ FV  N
Sbjct: 62  FDKFDEKLCIPNEGHIKYEITSDGMMVLLLDKELEHLVNDVKTFVEEN 109

>ZYRO0G13970g Chr7 complement(1111500..1111838) [339 bp, 112 aa]
          {ON} highly similar to uniprot|Q03759 Saccharomyces
          cerevisiae YML108W defines a new subfamily of the split
          beta-alpha-beta sandwiches.
          Length = 112

 Score =  119 bits (297), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 58/99 (58%), Positives = 75/99 (75%), Gaps = 7/99 (7%)

Query: 2  ATDNFYRMMILLEEPHKQHSTDGRKIENAS--HDFVDELLLPIQVDDLEVLNTWFDKFDE 59
            +N YRM++LLEEP       G K E+    H+F+DEL+LP  VD+++ LN+WFDKFDE
Sbjct: 3  GPENSYRMLVLLEEP-----VSGSKPEDEKKVHEFMDELVLPFNVDEIDQLNSWFDKFDE 57

Query: 60 EICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFV 98
          +ICIPNEGHIKYEI+SDG+IVLILDKE+  ++  VR FV
Sbjct: 58 QICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFV 96

>TBLA0B03190 Chr2 complement(742438..742806) [369 bp, 122 aa] {ON}
           Anc_8.830 YML108W
          Length = 122

 Score =  117 bits (293), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 75/115 (65%), Gaps = 19/115 (16%)

Query: 7   YRMMILLEEPH---------KQHSTDGRKIENA----------SHDFVDELLLPIQVDDL 47
           YRMM+LLEE           K  S+     E            SH+F+DEL+LP  VD+L
Sbjct: 8   YRMMVLLEEDMEPIEDDINLKSESSSNDNTEKVTTTKNTEPKKSHEFIDELILPFHVDEL 67

Query: 48  EVLNTWFDKFDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQ 102
           ++LN WFDKFDE+ICIPNEGHIKYEI+SDGLI+LILD +I  V+  V+DFV  NQ
Sbjct: 68  DILNEWFDKFDEQICIPNEGHIKYEITSDGLIILILDNDIKHVVEQVKDFVQNNQ 122

>KLTH0C04070g Chr3 (355923..356264) [342 bp, 113 aa] {ON} similar to
           uniprot|Q03759 Saccharomyces cerevisiae YML108W defines
           a new subfamily of the split beta-alpha- beta
           sandwiches.
          Length = 113

 Score =  116 bits (291), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 77/111 (69%), Gaps = 6/111 (5%)

Query: 1   MATDNFYRMMILLEEPHKQ------HSTDGRKIENASHDFVDELLLPIQVDDLEVLNTWF 54
           M+ +  YRM++L+E+  +Q        T G     A+H+FVDEL+LP ++DD++ LN WF
Sbjct: 1   MSDERNYRMLVLVEDVLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWF 60

Query: 55  DKFDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQLDE 105
           DKFD +ICIPNEG IKYEISSDGL+VL+LD+   +V+  VR FV A   DE
Sbjct: 61  DKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVEAESGDE 111

>KNAG0G03360 Chr7 complement(723353..723688) [336 bp, 111 aa] {ON}
           Anc_8.830 YML108W
          Length = 111

 Score =  116 bits (291), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 58/106 (54%), Positives = 76/106 (71%), Gaps = 7/106 (6%)

Query: 4   DNFYRMMILLEEP-------HKQHSTDGRKIENASHDFVDELLLPIQVDDLEVLNTWFDK 56
           D+ YRM+IL+EEP        +  S DG +   ++H+++DEL LP  +D+L+ LN WFDK
Sbjct: 6   DDTYRMLILVEEPLEDDVPTTEVTSEDGSQPIKSTHEYIDELHLPFGLDELDALNEWFDK 65

Query: 57  FDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQ 102
           FDEEICIPNEGHIKYEISSDGLIVL+L KEI  V   ++ F+  +Q
Sbjct: 66  FDEEICIPNEGHIKYEISSDGLIVLMLGKEIEHVYEQIKSFIETHQ 111

>NCAS0B01100 Chr2 complement(181912..182259) [348 bp, 115 aa] {ON}
           Anc_8.830 YML108W
          Length = 115

 Score =  116 bits (291), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 64/109 (58%), Positives = 80/109 (73%), Gaps = 7/109 (6%)

Query: 1   MATDNFYRMMILLEEPHK------QHSTDGRKIE-NASHDFVDELLLPIQVDDLEVLNTW 53
           M+ DN YRM++LLEE  +        +TD +  E   +H+F++ELLLP +V +L+ LN W
Sbjct: 1   MSKDNMYRMLVLLEEEMEEPELFDNDTTDSKATEPKKTHEFIEELLLPFEVSELDALNKW 60

Query: 54  FDKFDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQ 102
           FDKFDEEICIPNEGHIKYEISSDGLIVL+LDKEI  VI  V+ F+  NQ
Sbjct: 61  FDKFDEEICIPNEGHIKYEISSDGLIVLLLDKEIENVISEVKKFIDDNQ 109

>KAFR0A02760 Chr1 complement(575048..575386) [339 bp, 112 aa] {ON}
           Anc_8.830 YML108W
          Length = 112

 Score =  107 bits (266), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 68/89 (76%), Gaps = 8/89 (8%)

Query: 14  EEPHKQHSTDGRKIENASHDFVDELLLPIQVDDLEVLNTWFDKFDEEICIPNEGHIKYEI 73
           E+P KQ ST        SH+F++EL+LP +  +L+ LN WFDKFDEEICIPNEG+IKYEI
Sbjct: 32  EQP-KQEST-------KSHEFIEELILPFETSELDTLNEWFDKFDEEICIPNEGNIKYEI 83

Query: 74  SSDGLIVLILDKEISEVIGLVRDFVAANQ 102
           SSDGL+VL++DK+I  V+  V++FV  NQ
Sbjct: 84  SSDGLVVLLIDKQIENVVEKVKEFVNNNQ 112

>SAKL0H09042g Chr8 (771410..772807) [1398 bp, 465 aa] {ON} similar
           to uniprot|Q08268 Saccharomyces cerevisiae YOL119C MCH4
           Protein with similarity to mammalian monocarboxylate
           permeases which are involved in transport of
           monocarboxylic acids across the plasma membrane mutant
           is not deficient in monocarboxylate transport
          Length = 465

 Score = 30.0 bits (66), Expect = 1.1,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query: 42  IQVDDLEVLNTWFDKFDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAAN 101
           ++ ++++VL     K D ++  P+ G   Y +     + L+    +   +G ++ +++ N
Sbjct: 36  VETEEIDVL-----KLDSDLDFPDGGKKAYSVVLGSFMGLVSVFGVLNSVGAIQAYISEN 90

Query: 102 QLDEDSSS 109
           QL E SSS
Sbjct: 91  QLKETSSS 98

>ZYRO0G07128g Chr7 (563726..565228) [1503 bp, 500 aa] {ON} highly
           similar to uniprot|P32582 Saccharomyces cerevisiae
           YGR155W CYS4 Cystathionine beta-synthase catalyzes the
           synthesis of cystathionine from serine and homocysteine
           the first committed step in cysteine biosynthesis
          Length = 500

 Score = 28.9 bits (63), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 12/71 (16%)

Query: 12  LLEEPHKQHSTD--GRKIENASHDFVDELLLPIQVDDLEVLNTWFDKFDEEICIPNEGHI 69
           +L +P   + TD  G K+E   +DFV ++L   +VD      TW+   D+   I    + 
Sbjct: 221 ILAQPESLNKTDVSGYKVEGIGYDFVPQVLNRKEVD------TWYKTDDKASFI----YA 270

Query: 70  KYEISSDGLIV 80
           +  IS++G++V
Sbjct: 271 RQLISNEGVLV 281

>Ecym_8165 Chr8 complement(346320..349310) [2991 bp, 996 aa] {ON}
           similar to Ashbya gossypii ADR292W
          Length = 996

 Score = 28.1 bits (61), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 10/62 (16%)

Query: 47  LEVLNTWFDKFDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIG-----LVRDFVAAN 101
           + VLN  + K     CI  + H  +    + L+V IL  +  E+IG     LV  F+A+N
Sbjct: 56  IAVLNKVYSK-----CIEQQLHESFNYWFNKLVVRILSLKKQEIIGDRIVRLVAAFIASN 110

Query: 102 QL 103
           +L
Sbjct: 111 EL 112

>SAKL0H10274g Chr8 complement(877895..880549) [2655 bp, 884 aa] {ON}
           weakly similar to uniprot|P38308 Saccharomyces
           cerevisiae YBR203W COS111 Protein required for wild-type
           resistance to the antifungal drug ciclopirox olamine not
           related to the COS family of subtelomerically-encoded
           proteins
          Length = 884

 Score = 27.7 bits (60), Expect = 7.3,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 13/69 (18%)

Query: 44  VDDLEVLNTWFDKFDEEICIPNEGHIKYEISSDGLIVLILDKE--ISEVIGLVRDFVAAN 101
           +DDLE+ NT+  KF E      E + K  I S  L+ L + KE  ++EV+  V      N
Sbjct: 786 LDDLEMSNTFTVKFYE-----GEMYFKLRIRSGNLLGLKVYKESDVTEVVCTV------N 834

Query: 102 QLDEDSSSD 110
           +  ED S D
Sbjct: 835 RFTEDQSDD 843

>KLLA0E23607g Chr5 (2099005..2099715) [711 bp, 236 aa] {ON} similar
           to uniprot|P38304 Saccharomyces cerevisiae YBR193C MED8
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 236

 Score = 27.3 bits (59), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 11/79 (13%)

Query: 40  LPIQVDDLEVLNTWFDKFDEEICIPNEGHIKYEISS------DGLIVLILDKE-ISEVIG 92
           L + +  L  L    D ++E +    +  + Y + S      +GLI  ++ K+ I EV  
Sbjct: 84  LTVTLSQLSSLTNTLDHYEETL----DATVAYPLPSFPTTAHEGLITTLMRKKNIPEVDE 139

Query: 93  LVRDFVAANQLDEDSSSDA 111
            ++D    N LD DS SDA
Sbjct: 140 WIKDAKETNGLDVDSLSDA 158

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.137    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,052,870
Number of extensions: 559487
Number of successful extensions: 1562
Number of sequences better than 10.0: 37
Number of HSP's gapped: 1545
Number of HSP's successfully gapped: 37
Length of query: 112
Length of database: 53,481,399
Length adjustment: 82
Effective length of query: 30
Effective length of database: 44,078,787
Effective search space: 1322363610
Effective search space used: 1322363610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)