Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPR115W1083106451550.0
Scas_716.28110892714071e-176
Kwal_55.20547101481413391e-167
CAGL0G03179g106153513111e-163
YGR097W (ASK10)114650713161e-163
KLLA0D15081g101052712671e-157
AAR086W80775311981e-149
CAGL0B04213g90067710401e-125
ADL234C7363715111e-53
CAGL0G02827g7493715031e-52
YIL105C6863714992e-52
Kwal_23.49586493714911e-51
Sklu_2395.67113714931e-51
YNL047C6563724884e-51
KLLA0F03839g6483714822e-50
Scas_671.236863714822e-50
CAGL0G01386g5323734442e-46
Kwal_56.23334360113731.4
AAR048W101195704.9
Scas_620.11518116679.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR115W
         (1064 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR115W (YPR115W) [5536] chr16 (754873..758124) Protein containi...  1990   0.0  
Scas_716.28                                                           546   e-176
Kwal_55.20547                                                         520   e-167
CAGL0G03179g 295541..298726 similar to sp|P48361 Saccharomyces c...   509   e-163
YGR097W (ASK10) [2057] chr7 (678697..682137) Potential transcrip...   511   e-163
KLLA0D15081g 1271696..1274728 some similarities with sgd|S000631...   492   e-157
AAR086W [272] [Homologous to ScYGR097W (ASK10) - SH; ScYPR115W -...   466   e-149
CAGL0B04213g 412230..414932 some similarities with sp|P48361 Sac...   405   e-125
ADL234C [1507] [Homologous to ScYIL105C - SH; ScYNL047C - SH] (2...   201   1e-53
CAGL0G02827g complement(259569..261818) similar to sp|P40485 Sac...   198   1e-52
YIL105C (YIL105C) [2571] chr9 complement(167578..169638) Protein...   196   2e-52
Kwal_23.4958                                                          193   1e-51
Sklu_2395.6 YIL105C, Contig c2395 8302-10437                          194   1e-51
YNL047C (YNL047C) [4541] chr14 complement(539909..541879) Protei...   192   4e-51
KLLA0F03839g complement(363977..365923) similar to sp|P40485 Sac...   190   2e-50
Scas_671.23                                                           190   2e-50
CAGL0G01386g complement(132280..133878) similar to sp|P40485 Sac...   175   2e-46
Kwal_56.23334                                                          33   1.4  
AAR048W [234] [Homologous to ScYNR026C (SEC12) - SH; ScYCR067C (...    32   4.9  
Scas_620.11                                                            30   9.7  

>YPR115W (YPR115W) [5536] chr16 (754873..758124) Protein containing a
            pleckstrin homology (PH) domain, which mediate
            protein-protein and protein-lipid interactions, has
            moderate similarity to S. cerevisiae Ask10p, which may be
            a transcription factor in the S. cerevisiae
            Skn7p-mediated regulatory system [3252 bp, 1083 aa]
          Length = 1083

 Score = 1990 bits (5155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 977/1064 (91%), Positives = 977/1064 (91%)

Query: 1    MSDYFTFPKQENGGISKQPATPGSTRSSSRNLELPKNYRSFGGSSDELASMYSADSQYLM 60
            MSDYFTFPKQENGGISKQPATPGSTRSSSRNLELPKNYRSFGGSSDELASMYSADSQYLM
Sbjct: 1    MSDYFTFPKQENGGISKQPATPGSTRSSSRNLELPKNYRSFGGSSDELASMYSADSQYLM 60

Query: 61   DMIPDSLTLKNEPASGNTQMNGPDGKENKDIKLDEYILPKTDPRSPYYINMPIPKKLPKS 120
            DMIPDSLTLKNEPASGNTQMNGPDGKENKDIKLDEYILPKTDPRSPYYINMPIPKKLPKS
Sbjct: 61   DMIPDSLTLKNEPASGNTQMNGPDGKENKDIKLDEYILPKTDPRSPYYINMPIPKKLPKS 120

Query: 121  EGKARAKQKVNRADPSDLDVENIYETSGEFVREYPTDILIDRFHKWKKILKSLIAYFREA 180
            EGKARAKQKVNRADPSDLDVENIYETSGEFVREYPTDILIDRFHKWKKILKSLIAYFREA
Sbjct: 121  EGKARAKQKVNRADPSDLDVENIYETSGEFVREYPTDILIDRFHKWKKILKSLIAYFREA 180

Query: 181  AYSQEQIARINYQMKNAVKFAFLTDLEDETNKLVDPSISKLPTKKPQPVPLAAQKLDSKY 240
            AYSQEQIARINYQMKNAVKFAFLTDLEDETNKLVDPSISKLPTKKPQPVPLAAQKLDSKY
Sbjct: 181  AYSQEQIARINYQMKNAVKFAFLTDLEDETNKLVDPSISKLPTKKPQPVPLAAQKLDSKY 240

Query: 241  DTDVEQPQSIQXXXXXXXXXXXXGFMKFGSGSIQDIQVILKKYHLSLGSQQYKISKEILA 300
            DTDVEQPQSIQ            GFMKFGSGSIQDIQVILKKYHLSLGSQQYKISKEILA
Sbjct: 241  DTDVEQPQSIQSVPSEEVASASSGFMKFGSGSIQDIQVILKKYHLSLGSQQYKISKEILA 300

Query: 301  YIIPKLTDLRKDLTTKMKEIKELNGDFKTNIGEHIKITSRLLNKYIASVKLLDEASTSGD 360
            YIIPKLTDLRKDLTTKMKEIKELNGDFKTNIGEHIKITSRLLNKYIASVKLLDEASTSGD
Sbjct: 301  YIIPKLTDLRKDLTTKMKEIKELNGDFKTNIGEHIKITSRLLNKYIASVKLLDEASTSGD 360

Query: 361  KQGEKLKPKHDPYXXXXXXXXXXXXXXXEENYLREAFLNLQSAALQLEKIVYSKIQSALQ 420
            KQGEKLKPKHDPY               EENYLREAFLNLQSAALQLEKIVYSKIQSALQ
Sbjct: 361  KQGEKLKPKHDPYLLKLQLDLQLKRQLLEENYLREAFLNLQSAALQLEKIVYSKIQSALQ 420

Query: 421  RYSALIDSEARLMIKNLCHELQQGILSRPPAVEWDNFVSHHPTCLMNLKSTDPPPQPRRL 480
            RYSALIDSEARLMIKNLCHELQQGILSRPPAVEWDNFVSHHPTCLMNLKSTDPPPQPRRL
Sbjct: 421  RYSALIDSEARLMIKNLCHELQQGILSRPPAVEWDNFVSHHPTCLMNLKSTDPPPQPRRL 480

Query: 481  SDIVYPNMKSPLAKCIRVGYLLKKTESSKSFTKGYFVLTTNYLHEXXXXXXXXXXXXPRS 540
            SDIVYPNMKSPLAKCIRVGYLLKKTESSKSFTKGYFVLTTNYLHE            PRS
Sbjct: 481  SDIVYPNMKSPLAKCIRVGYLLKKTESSKSFTKGYFVLTTNYLHEFKSSDFFLDSKSPRS 540

Query: 541  KNKPVVEQSDISRVNKDGTNAGSHPSSKGTQDPKLTKRRKGXXXXXXXXXXXXXXNDCSL 600
            KNKPVVEQSDISRVNKDGTNAGSHPSSKGTQDPKLTKRRKG              NDCSL
Sbjct: 541  KNKPVVEQSDISRVNKDGTNAGSHPSSKGTQDPKLTKRRKGLSSSNLYPISSLSLNDCSL 600

Query: 601  KDSTDSTFVLQGYASYHSPEDTCTKESSTTSDLACPTKTLASNKGKHQRTPSALSMVSVP 660
            KDSTDSTFVLQGYASYHSPEDTCTKESSTTSDLACPTKTLASNKGKHQRTPSALSMVSVP
Sbjct: 601  KDSTDSTFVLQGYASYHSPEDTCTKESSTTSDLACPTKTLASNKGKHQRTPSALSMVSVP 660

Query: 661  KFLKSSSVPXXXXXXXXXXXXXXXSICEKRVEWTFKIFSASLEPTPEESKNFKKWVQDIK 720
            KFLKSSSVP               SICEKRVEWTFKIFSASLEPTPEESKNFKKWVQDIK
Sbjct: 661  KFLKSSSVPKEQKKAKEEANINKKSICEKRVEWTFKIFSASLEPTPEESKNFKKWVQDIK 720

Query: 721  ALTSFNSTQERSNFIEEKILKSRNHNNGKSSQRSKNSTYITPVDSFVNLSEKVTPSSSVT 780
            ALTSFNSTQERSNFIEEKILKSRNHNNGKSSQRSKNSTYITPVDSFVNLSEKVTPSSSVT
Sbjct: 721  ALTSFNSTQERSNFIEEKILKSRNHNNGKSSQRSKNSTYITPVDSFVNLSEKVTPSSSVT 780

Query: 781  TLNTRKRANRPRYIDIPKSANMNAGAMNSVYRSKVNTPAIDENGNLAIVGETKNSAPQNG 840
            TLNTRKRANRPRYIDIPKSANMNAGAMNSVYRSKVNTPAIDENGNLAIVGETKNSAPQNG
Sbjct: 781  TLNTRKRANRPRYIDIPKSANMNAGAMNSVYRSKVNTPAIDENGNLAIVGETKNSAPQNG 840

Query: 841  MSYTIRTPCKSPYSPYTGEGMLYNRSADNLMASSSRKASAPGEVPQIAVSNHGDEAIIPX 900
            MSYTIRTPCKSPYSPYTGEGMLYNRSADNLMASSSRKASAPGEVPQIAVSNHGDEAIIP 
Sbjct: 841  MSYTIRTPCKSPYSPYTGEGMLYNRSADNLMASSSRKASAPGEVPQIAVSNHGDEAIIPA 900

Query: 901  XXXXXXXXXXXXXXXXXXIHNQRVDFYPSPLMNLPGVSPSCLALDGNANGYFGIPLNCNS 960
                              IHNQRVDFYPSPLMNLPGVSPSCLALDGNANGYFGIPLNCNS
Sbjct: 901  SAYSDSSHKSSRASSVASIHNQRVDFYPSPLMNLPGVSPSCLALDGNANGYFGIPLNCNS 960

Query: 961  EARRGSDLSPFEMESPLFEENRTQNCSGSRKSSACHIPHQCGPRKEGNDSRLIYGNEKGA 1020
            EARRGSDLSPFEMESPLFEENRTQNCSGSRKSSACHIPHQCGPRKEGNDSRLIYGNEKGA
Sbjct: 961  EARRGSDLSPFEMESPLFEENRTQNCSGSRKSSACHIPHQCGPRKEGNDSRLIYGNEKGA 1020

Query: 1021 SQSRLTLKEPLTSKGVEAPYSSLKKTYSAENVPLTSTVSNDKSL 1064
            SQSRLTLKEPLTSKGVEAPYSSLKKTYSAENVPLTSTVSNDKSL
Sbjct: 1021 SQSRLTLKEPLTSKGVEAPYSSLKKTYSAENVPLTSTVSNDKSL 1064

>Scas_716.28
          Length = 1108

 Score =  546 bits (1407), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 352/927 (37%), Positives = 492/927 (53%), Gaps = 156/927 (16%)

Query: 97  ILPKTDPRSPYYINMPIPKKLPKSEGKARAKQKVNRADPSDLDVENIYETSGEFVREYPT 156
           +L K D RSP Y+++PIPK LPK E +    +  + A   D+++E     + ++VREYPT
Sbjct: 78  LLGKNDERSPLYVDVPIPKALPKQEQQDLQNRDGSAATKGDIELEE----NQQYVREYPT 133

Query: 157 DILIDRFHKWKKILKSLIAYFREAAYSQEQIARINYQMKNAVKFAFLTDLEDETNKLVDP 216
           DI+ DRFHKWKKILK+LIAY RE AY+QEQ  RIN Q+K AVKF+FLTD+++ +NKLV+P
Sbjct: 134 DIMADRFHKWKKILKALIAYLREVAYAQEQFGRINNQLKTAVKFSFLTDIQEGSNKLVEP 193

Query: 217 SISKLPTKKPQPVPLAAQK----LDSKYDTDVE------------------QPQSIQ--- 251
             +  P K+ QP+ LA ++    L+    T++E                  Q Q  Q   
Sbjct: 194 MTTIAPIKRQQPMTLAEKQKQAELEKLRATELEFELENSKSQSQFPPQAPLQSQQSQPLN 253

Query: 252 ------------------XXXXXXXXXXXXGFMKFGSGSIQDIQVILKKYHLSLGSQQYK 293
                                         GF+KFGSGSIQDIQVILKKYHLS+ +QQ+K
Sbjct: 254 QMPMNDESSMTLNIYPPIQQLESDDTSATSGFIKFGSGSIQDIQVILKKYHLSVANQQFK 313

Query: 294 ISKEILAYIIPKLTDLRKDLTTKMKEIKELNGDFKTNIGEHIKITSRLLNKYIASVKLLD 353
           +SKEI   +IPKL +LRKDL  K++EIK+++GDFK+NI  H+K+T++LLNKY  S+++++
Sbjct: 314 VSKEITTLLIPKLEELRKDLRVKIQEIKDIHGDFKSNISHHVKLTNQLLNKYNNSIRIMN 373

Query: 354 EASTSGDKQGEKLKPKHDPYXXXXXXXXXXXXXXXEENYLREAFLNLQSAALQLEKIVYS 413
             S S      + +PKHDPY               EENYL++A++NLQS+ +QLEKI+YS
Sbjct: 374 HQSHSH----HEFQPKHDPYLLKLQLDLQLKRQLSEENYLKDAYVNLQSSGMQLEKIIYS 429

Query: 414 KIQSALQRYSALIDSEARLMIKNLCHELQQGILSRPPAVEWDNFVSHHPTCLMNLKSTDP 473
           KIQ+ LQRY+ LID+E RLMIKNLCHELQQGILSRPPA EWD+FVSHHP CL+N KS DP
Sbjct: 430 KIQNVLQRYTTLIDTEVRLMIKNLCHELQQGILSRPPAFEWDHFVSHHPKCLLNWKSVDP 489

Query: 474 PPQPRRLSDIVYPNMKSPLAKCIRVGYLLKKTESSKSFTKGYFVLTTNYLHEXXXXXXXX 533
            PQPR++S+IVY NMKSPLAKCIR GY LK        +KGYFVLT+NY           
Sbjct: 490 VPQPRKVSEIVYSNMKSPLAKCIRAGYFLKNG------SKGYFVLTSNY----------- 532

Query: 534 XXXXPRSKNKPVVEQSDISRVNKDGTNAGSHPSSKGTQDPKLTKRRKGXXXXXXXXXXXX 593
                       + +   S      ++    P+S    DP     +K             
Sbjct: 533 ------------LHEFKTSNFFNQQSSTLQAPAS----DPM---GKKISTLNGLTPINSI 573

Query: 594 XXNDCSLKDSTDSTFVLQGYASYHSPEDTCTKESSTTSDLACPTKTLASNKGKHQRTPSA 653
             N+C L ++ ++ F ++G   +H P  T   + S ++     + +L  N   H++    
Sbjct: 574 SLNECKLIETGENHFTIEGTV-FHGPVTTTANQLSPSTSKTSASMSL--NATHHKK---- 626

Query: 654 LSMVSVPKFLKS-------SSVPXXXXXXXXXXXXXXXSICEKRVEWTFKIFSASLEPTP 706
                +P  LKS       + VP               SI E +V+WTFK   AS   + 
Sbjct: 627 ---YHLPNLLKSKKDAKPKTKVPTATTSSGSTVANNKTSI-ESKVKWTFK--PASKLTSE 680

Query: 707 EESKNFKKWVQDIKALTSFNSTQERSNFIEEKILKSRNHNNGKSSQRSKNSTYITPVDSF 766
           E+SK+FKKWVQD+K+LT++ + ++RS FIE++++K+          RSK S  I P  S 
Sbjct: 681 EDSKHFKKWVQDLKSLTNYKTVKDRSKFIEDRLMKAH--------YRSK-SVGIIP-GSK 730

Query: 767 VNLSEKVTPSSSVTTLNTRKRANRPRYIDIPKSANMNAGAMNSVYRSKVNTPAIDENGNL 826
           ++  +   PS+S       ++  +P+YI I  S   +       +RSK+NTPAID+NGNL
Sbjct: 731 LSQQQYHYPSTS-------EKPGKPQYIQIQNSNPTDWSG----FRSKINTPAIDDNGNL 779

Query: 827 AIVGETKNSAPQNGMSYTIRTPCKSPYSPYTGEGMLYNRSADNLMASSSRKASAPGEVPQ 886
             + E K  AP   M+    +P  SP        M  ++S     ASSS       +   
Sbjct: 780 ITLTERK-YAPTLSMT---PSPMVSP--------MYSDKS-----ASSSNPPPPQQQHQP 822

Query: 887 IAVSNHGDEAIIPXXXXXXXXXXXXXXXXXXXI-----HNQRVDF------YPSPLMNLP 935
             +++  +  I P                   +     H + V        +     NL 
Sbjct: 823 TNIASTSNGIIQPVMTSRNGSASSSGATTPKGVTLNPRHKRHVSLTNSLSAFVQGGSNLG 882

Query: 936 GVSPSCLALDGNANGYFGIPLNCNSEA 962
             SP  +  DG+  GYF IP+  N  A
Sbjct: 883 VHSPESINSDGSMGGYFAIPVRNNQTA 909

>Kwal_55.20547
          Length = 1014

 Score =  520 bits (1339), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 309/814 (37%), Positives = 437/814 (53%), Gaps = 141/814 (17%)

Query: 46  DELASMYSADSQYLMDMIPDSLTLKNEPASGNTQMNGPDGKENKDIKLDEYILPKTDPRS 105
           D+ +S++S+DS YLM++                     D  ++     DE ILPKTD  S
Sbjct: 23  DDASSLFSSDSGYLMELA--------------------DASDD-----DETILPKTDFHS 57

Query: 106 PYYINMPIPKKLPKSEGKARAKQKVNRADPSDLDVENIYETSGEFVREYPTDILIDRFHK 165
           PYY+N+P P             Q    +D S+L  +     +  FVREYPTDIL+DRF K
Sbjct: 58  PYYVNVPTPS------------QSALTSDYSELSQD---AAAAGFVREYPTDILLDRFTK 102

Query: 166 WKKILKSLIAYFREAAYSQEQIARINYQMKNAVKFAFLTDLEDETNKLVDP--------- 216
           W+KILK L  Y RE AY+QE+ ARINY ++ AVKF+FLTDLE+ TN+++DP         
Sbjct: 103 WRKILKGLANYLREVAYAQERFARINYSLRGAVKFSFLTDLEESTNRVIDPFQQRAKKPG 162

Query: 217 ---SISKLPTKKPQPVPLAAQKLDSKYDTDVEQPQSIQXXXXXXX----XXXXXGFMKFG 269
              S S L T    P  +  + L +          + +                GFMKFG
Sbjct: 163 NAASTSNLNTGLKSPPAVDDENLTNSSTLQSSSQSAFEVKNVPMAPGDNDSASSGFMKFG 222

Query: 270 SGSIQDIQVILKKYHLSLGSQQYKISKEILAYIIPKLTDLRKDLTTKMKEIKELNGDFKT 329
           SGSI+DIQV+LKKYH S+G+QQ K+SKE+   ++PKL DLRKDL  K+KEIKEL+GDF+T
Sbjct: 223 SGSIEDIQVVLKKYHTSMGNQQIKMSKELNTVVVPKLDDLRKDLQLKIKEIKELHGDFRT 282

Query: 330 NIGEHIKITSRLLNKYIASVKLLDEASTSGDK-----QGEKLKPKHDPYXXXXXXXXXXX 384
           NIGEHI +T +LL KY+A+VK +  ++ S D+     + +KLKPKHDPY           
Sbjct: 283 NIGEHIALTGQLLQKYMAAVKFM--STNSNDQNIFKLKNQKLKPKHDPYLLKLQLDLQLK 340

Query: 385 XXXXEENYLREAFLNLQSAALQLEKIVYSKIQSALQRYSALIDSEARLMIKNLCHELQQG 444
               EENYL+EA++NLQS+ L+LEKI+Y ++Q  LQRYSALI + AR+ I NLC+EL QG
Sbjct: 341 RQLLEENYLQEAYINLQSSGLELEKIIYGEVQHTLQRYSALISTSARISIGNLCNELHQG 400

Query: 445 ILSRPPAVEWDNFVSHHPTCLMNLKSTDPPPQPRRLSDIVYPNMKSPLAKCIRVGYLLKK 504
           +LS+PPA+EWD+FV HHP CL+N KST+P PQPR+LS I YP MKS LAKCI+ GYL KK
Sbjct: 401 MLSKPPAIEWDHFVGHHPKCLINWKSTEPIPQPRKLSHIRYPKMKSSLAKCIKAGYLSKK 460

Query: 505 TESSKSFTKGYFVLTTNYLHEXXXXXXXXXXXXPRSKNKPVVEQSDISRVNKDGTNAGSH 564
           ++  K++ KGYFVLT+NYLHE                     + S+  ++++D +    H
Sbjct: 461 SQILKNYNKGYFVLTSNYLHE--------------------FKSSNFFKLSQDNSEKKDH 500

Query: 565 PSSKGTQDPKLTKRRKGXXXXXXXXXXXXXXNDCSLKDSTDSTFVLQGYASYHSPEDTCT 624
                       + + G              N   L ++++S F ++G A+  + E    
Sbjct: 501 -----------GEVQTGSKKRAMVPVTSLSLNSAKLVEASESKFSIRGIATSSNFERKSA 549

Query: 625 KESSTTSDLACPTKTLASNKGKHQRTPSALSMVSVPKFLKSSSVPXXXXXXXXXXXXXXX 684
           +     S      +    + GK+            P    S S P               
Sbjct: 550 ETGKMISKSTSSIQKFLKSSGKNPHKKDNHHNHHAPGSSGSVSGP------------VVQ 597

Query: 685 SICEKRVEWTFKIFSASLEPTPEESKNFKKWVQDIKALTSFNSTQERSNFIEEKILKSRN 744
            + +    W FK  S+     PE++K+ KKW+ +++ L++F+++ +R+ FIEEKIL  R 
Sbjct: 598 DVADDVSTWVFKPVSSK----PEDAKDLKKWIAEVRHLSNFDTSADRAKFIEEKIL--RA 651

Query: 745 HNNGKSSQRSKNSTYITPVDSFVNLSEKVTPSSSVTTLNTRKRANRPRYIDI-------P 797
           H+   S   +K ++     D+     +KV  +       T+   N+P +I +       P
Sbjct: 652 HSRASSMNLAKMAS-----DASAKKQDKVASN------RTQGSRNKPHFIHLGPQEFQDP 700

Query: 798 KSANMNAGAMNSVYRSKVNTPAIDENGNLAIVGE 831
            SA           R+K+NTPAID+NGNL   GE
Sbjct: 701 TSA-----------RAKINTPAIDDNGNLITAGE 723

>CAGL0G03179g 295541..298726 similar to sp|P48361 Saccharomyces
           cerevisiae YGR097w ASK10 involved in SKN7P-dependent
           transcription, hypothetical start
          Length = 1061

 Score =  509 bits (1311), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 270/535 (50%), Positives = 349/535 (65%), Gaps = 42/535 (7%)

Query: 7   FPKQENGGISKQP----ATPGSTRSSSRNLELPKNYRSFGGSSDELASMYSADSQYLMDM 62
           FP     G S +     ATPG     SR         S+   +D+  S+ S+D  YLMDM
Sbjct: 18  FPSGSTSGYSTRSTSISATPGYLTPQSRT-------PSYAALNDDAVSIKSSD--YLMDM 68

Query: 63  IPDSLTLKNEPASGNTQMNGPDGKENKDIKLDEYILPKTDPRSPYYINMPIPKKLPKSEG 122
           +PDS+TLK             DG      K  E+ILP+TD RSPY++ +P+P  +  S  
Sbjct: 69  VPDSMTLK-------------DGASISTAKRKEFILPETDERSPYFVGVPVPV-IAASAV 114

Query: 123 KARAKQKVNRADPSDLDVENIYETSGEFVREYPTDILIDRFHKWKKILKSLIAYFREAAY 182
                + + ++  S   + +     G+FVREYPTD+LIDRF+KWKKILKS+IAY RE AY
Sbjct: 115 VDNGDKSLEKSTRSKTVIGDTEGYDGQFVREYPTDMLIDRFYKWKKILKSIIAYLREVAY 174

Query: 183 SQEQIARINYQMKNAVKFAFLTDLEDETNKLVDPSISKLPTKKPQPVPLAA---QKLDSK 239
           +QEQ ARIN Q++N+VKF FLTDL + +NK++DP +S+ P KK  P  +A    QK + +
Sbjct: 175 AQEQFARINNQLRNSVKFPFLTDLTEGSNKIIDP-LSQAP-KKNAPTTMAQKRKQKEEEQ 232

Query: 240 YDTDVEQP-----QSIQXXXXXXXXXXXXGFMKFGSGSIQDIQVILKKYHLSLGSQQYKI 294
              +V+ P     +               GF++FGSGSIQDIQVILKKYH+SL +QQ+KI
Sbjct: 233 NAPNVDLPPVDPSEQFMPVQATDNTSASSGFLRFGSGSIQDIQVILKKYHVSLANQQFKI 292

Query: 295 SKEILAYIIPKLTDLRKDLTTKMKEIKELNGDFKTNIGEHIKITSRLLNKYIASVKLLDE 354
           SKEI++ +IPKL +++KDL+ K+KEIKELNGDFKTNI  HIK+T  LL KYIA+ + +D 
Sbjct: 293 SKEIVSTVIPKLEEIKKDLSFKIKEIKELNGDFKTNINYHIKMTGILLKKYIAACRFVDR 352

Query: 355 ASTSGDKQGEKLKPKHDPYXXXXXXXXXXXXXXXEENYLREAFLNLQSAALQLEKIVYSK 414
            +   D Q  KLKPKHDPY               EENYL+EAF+NLQS+ LQLEKI+YS+
Sbjct: 353 NNYLQDVQN-KLKPKHDPYLLKLQLDLQLKRQIAEENYLQEAFVNLQSSGLQLEKIIYSR 411

Query: 415 IQSALQRYSALIDSEARLMIKNLCHELQQGILSRPPAVEWDNFVSHHPTCLMNLKSTDPP 474
           IQ  LQRYS LIDSEARLMIKNLC ELQ GIL++PPA+EWDNFVSHHP CL+N KS DP 
Sbjct: 412 IQHVLQRYSTLIDSEARLMIKNLCQELQYGILAKPPAMEWDNFVSHHPLCLLNWKSNDPV 471

Query: 475 PQPRRLSDIVYPNMKSPLAKCIRVGYLL----KKTESSKSFTKGYFVLTTNYLHE 525
           P PR  S ++YPNMKSP++KCIR GY +     K+  S +F K YF+LT+ Y+H+
Sbjct: 472 PVPRNASAVIYPNMKSPMSKCIRAGYFMMKSESKSSKSNNFQKSYFILTSTYIHQ 526

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 109/259 (42%), Gaps = 59/259 (22%)

Query: 597 DCSLKDSTDSTFVLQGYASYHS------PEDTCTKE--SSTTSDLACPTKTLASNKGKHQ 648
           +C L +S+D+ FV++G A Y +      P+    K    + ++ ++ P  ++   K    
Sbjct: 604 ECRLVESSDAIFVIEGKAEYSNNLTEKVPKKQVYKSMAHAGSNTISNPLASIPGAKYGQD 663

Query: 649 RTPSALSMVSVPKFLKSSSVPXXXXXXXXXXXXXXXSICEK----------RVEWTFKIF 698
            +   L    + K +K +                      K          +V+WTFK+ 
Sbjct: 664 ASTKVLHKTKLSKLVKGAKAKTLGTETSKHSKSGLEKDANKVVTNKVYTTEQVKWTFKMV 723

Query: 699 SASLEPTPEESKNFKKWVQDIKALTSFNSTQERSNFIEEKILKSRNHNN------GKSSQ 752
           +   +PT +E K F KW+ DIK LT F   +ER NFIE++++KS+  +       G+S+Q
Sbjct: 724 AE--KPTEDEVKYFNKWIIDIKNLTKFEKPKERFNFIEDRLMKSQTKSQMSVAEEGRSNQ 781

Query: 753 RSKNSTYITPVDSFVNLSEKVTPSSSVTTLNTRKRANRPRYIDIPKSANMNAGAMNSVYR 812
            S                             T   A +P YI    S  +++ +  +   
Sbjct: 782 NS-----------------------------TSNFAGKPTYI----SLGVDSKSTFTPDG 808

Query: 813 SKVNTPAIDENGNLAIVGE 831
           S +NTPAID+NGNL   G+
Sbjct: 809 SVMNTPAIDDNGNLITFGQ 827

>YGR097W (ASK10) [2057] chr7 (678697..682137) Potential
           transcription factor involved in Skn7p-mediated
           two-component regulatory system [3441 bp, 1146 aa]
          Length = 1146

 Score =  511 bits (1316), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 262/507 (51%), Positives = 334/507 (65%), Gaps = 54/507 (10%)

Query: 49  ASMYSADSQYLMDMIPDSLTLKNEPASGNTQMNGPDGKENKDIKLDEYILPKTDPRSPYY 108
           +S++S  SQYLMD++PDS+TL NE  S     N          +  E+ILP+TD RSPY+
Sbjct: 30  SSIHSKSSQYLMDILPDSMTL-NESVSSIVANN----------QAKEFILPETDERSPYF 78

Query: 109 INMPIPKKLPKSEGKARAKQKVNRADPSDLDVENIYETSGEFVREYPTDILIDRFHKWKK 168
           IN+PIPK  P S  + +     + A              G+FV+EYPTDIL+DRF+KWKK
Sbjct: 79  INVPIPKAQPTSTTETKKPLAGDEA------------IDGQFVKEYPTDILVDRFYKWKK 126

Query: 169 ILKSLIAYFREAAYSQEQIARINYQMKNAVKFAFLTDLEDETNKLVDP-SISKLPTKKPQ 227
           ILK L+ Y RE AY+QEQ ARINYQ+K +VKF FLTD+++ TN + DP + +    KK Q
Sbjct: 127 ILKGLVIYLREVAYAQEQFARINYQLKGSVKFPFLTDIDETTNTITDPFTTAPRGPKKAQ 186

Query: 228 PV-----------------------PLAAQKLDSKYDTDVEQPQSIQXXXXXXXXXXXXG 264
           P                         + A   +SK      + + +Q            G
Sbjct: 187 PAQKKVGLTDSEQFQMQMQQEQQENAVQAPTDESKMSLAPHEYKPVQTTESDNTSAAS-G 245

Query: 265 FMKFGSGSIQDIQVILKKYHLSLGSQQYKISKEILAYIIPKLTDLRKDLTTKMKEIKELN 324
           F+KFGSGSIQDIQVILKKYHLSL +QQ+KISKEI + +IPKL +LRKDL  K+ EIK+L+
Sbjct: 246 FVKFGSGSIQDIQVILKKYHLSLANQQFKISKEITSTVIPKLEELRKDLRYKITEIKDLH 305

Query: 325 GDFKTNIGEHIKITSRLLNKYIASVKLLDEASTSGD------KQGEKLKPKHDPYXXXXX 378
           GDFKTNIG HI++TS+LL KYIA+VK ++      D      K+  KL PKHDPY     
Sbjct: 306 GDFKTNIGAHIQLTSQLLKKYIAAVKFMNAHGIGNDRASPTNKKPHKLDPKHDPYLLKLQ 365

Query: 379 XXXXXXXXXXEENYLREAFLNLQSAALQLEKIVYSKIQSALQRYSALIDSEARLMIKNLC 438
                     EE YL+EAF+NLQS+ LQLEKI+Y+KIQ AL RYSALIDSEARLMIKN+C
Sbjct: 366 LDLQLKRQVAEETYLQEAFINLQSSGLQLEKIIYTKIQHALLRYSALIDSEARLMIKNMC 425

Query: 439 HELQQGILSRPPAVEWDNFVSHHPTCLMNLKSTDPPPQPRRLSDIVYPNMKSPLAKCIRV 498
            ELQ GI+S+PPA EWDNFV+ HP+CL+N KS DP P PR++SD++YP+MKSPLAKCI+ 
Sbjct: 426 QELQHGIISKPPAFEWDNFVTQHPSCLLNWKSNDPIPPPRKVSDVIYPHMKSPLAKCIKA 485

Query: 499 GYLLKKTESSKSFTKGYFVLTTNYLHE 525
           GY LKK+E   ++ +GYFVLT+NY+HE
Sbjct: 486 GYFLKKSELLPTYHQGYFVLTSNYIHE 512

 Score =  115 bits (289), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 142/497 (28%), Positives = 210/497 (42%), Gaps = 81/497 (16%)

Query: 596  NDCSLKDSTDSTFVLQGYASYHSPEDTCTKESSTTSDLACPTKTLASNKGKHQRTPSALS 655
            NDC+LKD++ + FVL G  + +   D   K SS+T        +L   K  H+ T    S
Sbjct: 596  NDCTLKDASSTKFVLVGKPTLNENAD-VRKSSSSTYLSGSSQASLP--KYGHE-TAKIFS 651

Query: 656  MVSVPKFLKSSSVPXXXXXXXXXXXXXXXSICEKR--VEWTFKIFSASLEPTPEESKNFK 713
                 KFLK S                  +  E    V WTFKI S   EP+ EE K+FK
Sbjct: 652  KAPFHKFLKGSKPKNKNTKSSELDQFYAAAQKESNNYVTWTFKIVSP--EPSEEELKHFK 709

Query: 714  KWVQDIKALTSFNSTQERSNFIEEKILKSRNHNNGKSSQRSKNSTYITP--VDSFVNLSE 771
            +WVQD+K LTSFN T++R  FIE++++KS     G  S+ S N    TP   DS   L +
Sbjct: 710  RWVQDLKNLTSFNDTKDRIKFIEDRVMKSHRFKAGHMSRNSVNIGSHTPCLTDSTFTLQD 769

Query: 772  KVTPSSSVTTLNTRKRANRPRYIDIPKSANMNAGAMNSVYRSKVNTPAIDENGNLAIVGE 831
              T     T++N + RA +P+YI I    N  A    + +RSKVNTPAID+ GNL  V  
Sbjct: 770  GTT-----TSVNLKGRAEKPQYIHIQN--NSLADFDGNGFRSKVNTPAIDDYGNLITVER 822

Query: 832  TKNSAPQNGMSYTIRTPCKSP-YSPYTGEGMLYNRSADNLMASSSRKASAPGEVPQIAVS 890
                +P     Y   +   +P YS  +    +YN                 G  P ++++
Sbjct: 823  RPAQSPHQYSDYMATSGNTTPSYSSGSRPQSMYN-----------------GYNPAVSIT 865

Query: 891  NHGDEAIIPXXXXXXXXXXXXXXXXXXXIHNQRVDFYPSPLMNLPGVSPSCLALDGN--- 947
            ++G                         + +QR     S   +LPG S + L+L  N   
Sbjct: 866  SNG--------MMLQQSTANNNTNPTTNLRHQR---NISQTSSLPGFSYTSLSLPVNSPG 914

Query: 948  -------ANGYFGIPLNCNSEARRGSDLSPFEMESPLFEEN---------------RTQ- 984
                   + GYF IPL+ N+     +  +  E  SP + ++               RT  
Sbjct: 915  SSNSESSSGGYFAIPLHGNNNNNNYTQRNS-EGSSPCYNDDQIRQQQQPLQMQPLSRTSS 973

Query: 985  ---NCSGSRKSSACHIPHQCGP-----RKEGNDSRLIYGNEKGASQSRLTLKEPLTSKGV 1036
               N +  R +SA +      P          + + +  ++   + S  T+   +T+   
Sbjct: 974  SSVNVTAMRSTSAGNSITANAPVVPKVMVNNQNVKTVAADQSATAPSSPTMNSSVTTINR 1033

Query: 1037 EAPYSSLKKTYSAENVP 1053
            E+PY +LKKT S  NVP
Sbjct: 1034 ESPYQTLKKTNSTGNVP 1050

>KLLA0D15081g 1271696..1274728 some similarities with sgd|S0006319
           Saccharomyces cerevisiae YPR115w, hypothetical start
          Length = 1010

 Score =  492 bits (1267), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 265/527 (50%), Positives = 329/527 (62%), Gaps = 74/527 (14%)

Query: 43  GSSDELASMYSADSQYLMDMIPDSLTLKNEPASGNTQMNGPDGKENKDIKLDEYILPKTD 102
           GS  + +S+ S+DS YL+D+                     D  E +DI      LPKT+
Sbjct: 11  GSLADNSSVASSDSNYLLDL--------------------ADETEYEDI------LPKTN 44

Query: 103 PRSPYYINMPIPKK------------------LPKSEGKARAKQKV----------NRAD 134
             SPYY+N+P PK                      +   ARA   V          N   
Sbjct: 45  YHSPYYVNVPTPKHSLLAGAGANSASAGANSGAGNANISARAGANVGVGSGAGASANAGK 104

Query: 135 PSDLDVENIYETSGEFVREYPTDILIDRFHKWKKILKSLIAYFREAAYSQEQIARINYQM 194
              LD+ +  + +  FVREYPTDIL DRFHKW+KILK++I Y RE AYSQEQ ARINY +
Sbjct: 105 AEGLDLYD--DGTASFVREYPTDILADRFHKWRKILKAMIIYLREVAYSQEQFARINYSL 162

Query: 195 KNAVKFAFLTDLEDETNKLVDPSISKLPTKKPQPV------------PLAAQKLDSKYDT 242
           KN+VKF+FLTDL++ TN++ DP    LP KKPQP+            P AA    +  ++
Sbjct: 163 KNSVKFSFLTDLDESTNRVSDPLTKNLPQKKPQPMTQMKSPFDEKPDPFAASNASTLNNS 222

Query: 243 DVEQPQSIQXXXXXXXXXXXXGFMKFGSGSIQDIQVILKKYHLSLGSQQYKISKEILAYI 302
            ++  Q +Q            GFM FGSGSIQDIQVILKKYHLSL SQQ K SKEI   I
Sbjct: 223 SIDLGQELQLEPNDSCSGA--GFMNFGSGSIQDIQVILKKYHLSLASQQVKSSKEITLQI 280

Query: 303 IPKLTDLRKDLTTKMKEIKELNGDFKTNIGEHIKITSRLLNKYIASVKLLDEASTSGD-- 360
           IPKL DLRKDL+ K+KEIKELN DFKTNI EH+ +T +LL+KYIA+V  L++ ++  D  
Sbjct: 281 IPKLEDLRKDLSHKIKEIKELNADFKTNIQEHVALTGQLLHKYIAAVNFLNDNASRSDLI 340

Query: 361 --KQGEKLKPKHDPYXXXXXXXXXXXXXXXEENYLREAFLNLQSAALQLEKIVYSKIQSA 418
             K+   LK KHDPY               EENYL+EA++NLQS+ ++LEKI++S IQ  
Sbjct: 341 KLKRNSSLKSKHDPYLLKLQLDLQLKRQLLEENYLQEAYINLQSSGMELEKIIFSTIQKT 400

Query: 419 LQRYSALIDSEARLMIKNLCHELQQGILSRPPAVEWDNFVSHHPTCLMNLKSTDPPPQPR 478
           LQ++SA+ID +AR  I NLC ELQ+GILS+PP VEWDNFVSHHP CL+N KSTDP PQPR
Sbjct: 401 LQKFSAIIDVQARTSINNLCRELQRGILSKPPCVEWDNFVSHHPRCLLNWKSTDPIPQPR 460

Query: 479 RLSDIVYPNMKSPLAKCIRVGYLLKKTESSKSFTKGYFVLTTNYLHE 525
           +LSDI YP MKS LAKCIR GYLLKK++  K + KGYFVLT+NYLHE
Sbjct: 461 KLSDIRYPKMKSSLAKCIRAGYLLKKSKYLKQYNKGYFVLTSNYLHE 507

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/128 (37%), Positives = 67/128 (52%), Gaps = 20/128 (15%)

Query: 704 PTPEESKNFKKWVQDIKALTSFNSTQERSNFIEEKILKSRNHNNGKSSQRSKNSTYITPV 763
           P   + K FKKW  ++K LT F++T +R+ +IEEKILK+  HN   SS  S   +   P 
Sbjct: 636 PADVDVKEFKKWTNNLKDLTKFHNTLDRARYIEEKILKA--HNKFASSTLSLGQSKSEP- 692

Query: 764 DSFVNLSEKVTPSSSVTTLNTRKRANRPRYIDIPKSANMNAGAMNSVYRSKVNTPAIDEN 823
                     T S  +++ ++     RP YI +P  + +N        RSKVNTPAID+N
Sbjct: 693 ----------TSSLHLSSQSSSNLQQRPHYIQLPSVSQVN-------LRSKVNTPAIDDN 735

Query: 824 GNLAIVGE 831
           GNL    E
Sbjct: 736 GNLIFATE 743

>AAR086W [272] [Homologous to ScYGR097W (ASK10) - SH; ScYPR115W -
           SH] complement(496601..499024) [2424 bp, 807 aa]
          Length = 807

 Score =  466 bits (1198), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 292/753 (38%), Positives = 405/753 (53%), Gaps = 144/753 (19%)

Query: 87  ENKDIKLDEYILPKTDPRSPYYINMPIPKKLPKSEGKARAKQKVNRADPSDLDVENIYET 146
           E  D+   E +LPK    SP+Y+++P+P+ L                     D  ++ + 
Sbjct: 22  ELADVTEFEGVLPKDHYSSPFYVDVPVPQSLG--------------------DHRHLGDD 61

Query: 147 SGEFVREYPTDILIDRFHKWKKILKSLIAYFREAAYSQEQIARINYQMKNAVKFAFLTDL 206
           +  +VREYPT IL DRF KW+K+LKSL+AY RE A +QEQ ARIN  +K+AVKF+FL DL
Sbjct: 62  TQSYVREYPTSILADRFDKWRKLLKSLVAYLREVAAAQEQHARINAHLKSAVKFSFLADL 121

Query: 207 EDETNKLVDPSISKLPTKKPQPVPLAAQKLDSKYDTDVEQPQSIQXXXXXXXXXXXXGFM 266
           E+ TNK+V+    K P+   Q    +AQ  DS +                       GF+
Sbjct: 122 EEGTNKVVEQL--KRPSSPSQSGAESAQ--DSYFQVQ---------------EGCSNGFL 162

Query: 267 KFGSGSIQDIQVILKKYHLSLGSQQYKISKEILAYIIPKLTDLRKDLTTKMKEIKELNGD 326
           ++GSGSIQD+QV LKKYH+++ +QQ K S+E+   +IPKL +LR++L++K+KEIKEL+ D
Sbjct: 163 RYGSGSIQDLQVSLKKYHMTVSNQQLKASRELNNVVIPKLEELRRNLSSKIKEIKELSND 222

Query: 327 FKTNIGEHIKITSRLLNKYIASVKLLDEA--STSGDKQGEKLKPKHDPYXXXXXXXXXXX 384
           FKTNI E + +T +LL KYIASV LL  A  STS    G++LKPKHDPY           
Sbjct: 223 FKTNIHEQVALTGQLLQKYIASVDLLSTAEDSTSSKSTGQRLKPKHDPYLLKLQLDLQLK 282

Query: 385 XXXXEENYLREAFLNLQSAALQLEKIVYSKIQSALQRYSALIDSEARLMIKNLCHELQQG 444
               EENYL+EA++NLQ++ ++LEKIVY +IQ+ALQ+++  +D E+   I  +C EL++G
Sbjct: 283 RQLLEENYLQEAYINLQTSGMELEKIVYGQIQTALQKFAHYMDIESCAAINGICQELRRG 342

Query: 445 ILSRPPAVEWDNFVSHHPTCLMNLKSTDPPPQPRRLSDIVYPNMKSPLAKCIRVGYLLKK 504
           ILS+P  +EWD+FV  HPTCL+N KS+DP P PRRLSDI YP MKSP+AKCIR GYL+KK
Sbjct: 343 ILSKPTTIEWDDFVGLHPTCLLNWKSSDPVPPPRRLSDIRYPKMKSPMAKCIRAGYLMKK 402

Query: 505 TESSKSFTKGYFVLTTNYLHEXXXXXXXXXXXXPRSKNKPVVEQSDISRVNKDGTNAGSH 564
           ++  K++ KGYFVLT+NYLHE                     + SD  ++     N G  
Sbjct: 403 SKLLKNYNKGYFVLTSNYLHE--------------------FKSSDFFKM----ANNGEK 438

Query: 565 PSSKGTQ-DPKLTKRRKGXXXXXXXXXXXXXXNDCSLKDSTDSTFVL-QGYASYHSPEDT 622
           PS K    DP                      N+ ++ ++    FVL   +A   S E  
Sbjct: 439 PSLKKINFDP----------------LGSIPLNESTVTEALPQKFVLCSTWAGIDSQEAG 482

Query: 623 CTKESSTTSDLACPTKTLASNKGKHQRTPSALSMVSVPKFLKSSSVPXXXXXXXXXXXXX 682
            +  SS TS          S +G         S VS+ K LK ++ P             
Sbjct: 483 LSATSSGTS--------FTSMQGSR-------SSVSLGKLLKGAAKP---GKALTSAKAS 524

Query: 683 XXSICEKRVEWTFKIFSASLEPTPEESKNFKKWVQDIKALTSFNSTQERSNFIEEKILKS 742
              I +  V WTFK        T +  K+FKKW  +++ L  FNST ER  +IEEKI+K+
Sbjct: 525 TSEITKGHV-WTFK------PSTTQSEKDFKKWCGELRQLAGFNSTLERCRYIEEKIVKA 577

Query: 743 RNHNNGKSSQRSKNSTYITPVDSFVNLSEKVTPSSSVTTLNTRKRANRPRYIDI----PK 798
            +  + K+SQ S  +    P                        RA +P++IDI    P 
Sbjct: 578 HSRASSKASQSSIGTPPEGP-----------------------GRAQKPQFIDIKGLSPI 614

Query: 799 SANMNAGAMNSVYRSKVNTPAIDENGNLAIVGE 831
             N+          S +NTPA D+NGNL + G+
Sbjct: 615 GYNI---------ASPINTPAFDDNGNLIMAGD 638

>CAGL0B04213g 412230..414932 some similarities with sp|P48361
           Saccharomyces cerevisiae YGR097w ASK10 involved in
           SKN7P-dependent transcription, hypothetical start
          Length = 900

 Score =  405 bits (1040), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 255/677 (37%), Positives = 358/677 (52%), Gaps = 105/677 (15%)

Query: 97  ILPKTDPRSPYYINMPIPKKLPKSEGKARAKQKVNRADPSDLDVENIYETSGEFVREYPT 156
           ++ +T+  SPYY+ +P+P+ +  S     +  K            N Y  S ++V+EYPT
Sbjct: 95  VVSRTEVNSPYYLPVPVPEAVTDSANPVSSSAKEQYL--------NGYHHS-QYVKEYPT 145

Query: 157 DILIDRFHKWKKILKSLIAYFREAAYSQEQIARINYQMKNAVKFAFLTDLEDETNKLVDP 216
            +L DRF KW KILK LI+Y REAAY +E IAR++ ++K  V F FLTDL+D  N+LVDP
Sbjct: 146 VLLADRFKKWNKILKYLISYLREAAYVEEHIARLHVKLKKKVTFPFLTDLDDH-NQLVDP 204

Query: 217 SISKLPTKKPQPVPLAAQK------------------LDSKYDTDVEQPQSIQXXXXXXX 258
               LPTK+ QP+  A +K                   +  +DT++E    +        
Sbjct: 205 YQKNLPTKRTQPITPAEKKRLEAEAALAAATTTEETTEELDFDTELEDEVPV---SSDND 261

Query: 259 XXXXXGFMKFGSGSIQDIQVILKKYHLSLGSQQYKISKEILAYIIPKLTDLRKDLTTKMK 318
                GF+KFGSGSIQDIQV+LKKYH S+  QQ K+S+EI+  +IPKL  L K+L  K++
Sbjct: 262 TMAPSGFLKFGSGSIQDIQVLLKKYHGSIAGQQLKVSREIMENVIPKLEGLVKELNNKIR 321

Query: 319 EIKELNGDFKTNIGEHIKITSRLLNKYIASVKLL----DEASTSGDKQGEKLKPKHDPYX 374
           EIK L+GDF+TN+   +  TSRL+ KY + VK L     +A+T+       ++PK DPY 
Sbjct: 322 EIKSLDGDFRTNLIGQMNQTSRLIQKYNSVVKKLANEKSDATTT-------IQPKCDPYL 374

Query: 375 XXXXXXXXXXXXXXEENYLREAFLNLQSAALQLEKIVYSKIQSALQRYSALIDSEARLMI 434
                         EE YL EAF+NLQS+ L LE+IVY+KIQSAL+ Y+ALIDSEARL++
Sbjct: 375 VKIQLETQLKKQLAEEKYLMEAFVNLQSSGLDLERIVYTKIQSALENYTALIDSEARLIL 434

Query: 435 KNLCHELQQGILSRPPAVEWDNFVSHHPTCLMNLKSTDPPPQPRRLSDIVYPNMKSPLAK 494
           KNLC ELQQG+LS+P   EWD F++HH  C++N  ST P P PR LSDIVY NMK+P +K
Sbjct: 435 KNLCQELQQGMLSKPANYEWDQFITHHTNCMLNWTSTQPKPVPRELSDIVYQNMKAPQSK 494

Query: 495 CIRVGYLLKKT-ESSKSFTKGYFVLTTNYLHEXXXXXXXXXXXXPRSKNKPVVEQSDISR 553
           CIR GY+   + +  K ++KGYF+LT++YLHE                     + SD S+
Sbjct: 495 CIRKGYMYYGSGKDVKKYSKGYFILTSHYLHE--------------------FKDSDFSK 534

Query: 554 VNKDGTNAGSHPSSKGTQDPKLTKRRKGXXXXXXXXXXXXXXNDCSLKDSTDSTFVLQGY 613
             K  T+A ++          L   +                +D  +++ TD+  V    
Sbjct: 535 EMKGSTDASNNFCHMAISLVNLIPEK------------SFSLSDIDIEEITDTEMVF--- 579

Query: 614 ASYHSPEDTCTKESSTTSDLACPTKTLASNKGKHQ-RTPSALSMVSVPKFLKS----SSV 668
                     T  S  ++              +H+ R+PS  +  +VPKFL+     S+ 
Sbjct: 580 ----------TARSLKSTKPRSSPSPAPIPAPEHKSRSPSITA--AVPKFLRGGPSRSTK 627

Query: 669 PXXXXXXXXXXXXXXXSICE------KRVEWTFKIFSASLEPTPEE-SKNFKKWVQDIKA 721
                           S+ E      +R  W  ++   SL    EE  K FKKW  D KA
Sbjct: 628 TRSNSGANRQTLFAEPSLSEPLREIGERTTWHLRL---SLGDYDEEYKKQFKKWSSDFKA 684

Query: 722 LTSFNSTQERSNFIEEK 738
           L  FN +  R++FI E+
Sbjct: 685 LADFNHSYHRNSFINER 701

>ADL234C [1507] [Homologous to ScYIL105C - SH; ScYNL047C - SH]
           (293117..295327) [2211 bp, 736 aa]
          Length = 736

 Score =  201 bits (511), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 118/371 (31%), Positives = 187/371 (50%), Gaps = 59/371 (15%)

Query: 155 PTDILIDRFHKWKKILKSLIAYFREAAYSQEQIARINYQMKNAVKFAFLTDLEDETNKLV 214
           PT++L  RF  W+ ++K++I Y  E A  Q+++ R + ++ +AV F F +        + 
Sbjct: 246 PTEVLAGRFASWRAVIKAIIVYLTETASIQDELVRQHLRLSHAVSFPFFS-----VENVR 300

Query: 215 DPSISKLPTKKPQPVPLAAQKLDSKYDTDVEQPQSIQXXXXXXXXXXXXGFMKFGSGSIQ 274
            PS    P +K      A Q+                             F+  GSGSIQ
Sbjct: 301 QPST---PEEK------AIQQF----------------------------FLPLGSGSIQ 323

Query: 275 DIQVILKKYHLSLGSQQYKISKEILAYIIPKLTDLRKDLTTKMKEIKELNGDFKTNIGEH 334
           D+  IL  YH  + S   K SKE+   +IP+L D+R+DL  K+KEIK L  DFK +  + 
Sbjct: 324 DLPTILTGYHAQMASMASKASKELTNEVIPRLEDMRRDLLVKIKEIKSLQSDFKNSCAKE 383

Query: 335 IKITSRLLNKYIASVKLLDEASTSGDKQGEKLKPKHDPYXXXXXXXXXXXXXXXEENYLR 394
           +  T ++L  +  SV+           Q     PK DPY               EEN+L 
Sbjct: 384 VSETKQMLRTFHESVE-----------QARYGTPKSDPYLTRILLDKQLKRQLAEENFLH 432

Query: 395 EAFLNLQSAALQLEKIVYSKIQSALQRYSALIDSEARLMIKNLCHELQQGILSRPPAVEW 454
           +AF NLQ++  +LEK+V  +IQSAL  Y+ ++  EA+L+  ++  +L  G LSR P  EW
Sbjct: 433 QAFNNLQASGKELEKVVVMEIQSALTVYARILGREAQLVFDSVITKLDMGFLSRDPVFEW 492

Query: 455 DNFVSHHPTCLMNLKSTDPPPQPRRLSDIVYPNMKSPLAKCIRVGYLLKKTESSKSFTKG 514
           D+F++  P  +      +P    R L DI Y +   PL   ++ G+L ++++  KS+++G
Sbjct: 493 DDFIARDPNFV------EPSVPMRSLKDITYKHQYDPLTYKLQCGFLERRSKFLKSYSRG 546

Query: 515 YFVLTTNYLHE 525
           ++VLT ++LHE
Sbjct: 547 FYVLTPSFLHE 557

>CAGL0G02827g complement(259569..261818) similar to sp|P40485
           Saccharomyces cerevisiae YIL105c, start by similarity
          Length = 749

 Score =  198 bits (503), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 118/371 (31%), Positives = 182/371 (49%), Gaps = 59/371 (15%)

Query: 155 PTDILIDRFHKWKKILKSLIAYFREAAYSQEQIARINYQMKNAVKFAFLTDLEDETNKLV 214
           PTD+L  RF  W+ +++S+I Y  E A  +++I R   ++ +AV+F F T          
Sbjct: 228 PTDVLAARFSAWRNVIRSIIVYLTEIASIEDEIVRQQLRLSHAVQFPFFT---------- 277

Query: 215 DPSISKLPTKKPQPVPLAAQKLDSKYDTDVEQPQSIQXXXXXXXXXXXXGFMKFGSGSIQ 274
                                ++++Y     QP S +             F+  GSGS+Q
Sbjct: 278 ---------------------IENQY-----QPTSSEDRYTQKF------FLPLGSGSVQ 305

Query: 275 DIQVILKKYHLSLGSQQYKISKEILAYIIPKLTDLRKDLTTKMKEIKELNGDFKTNIGEH 334
           D+  IL +YH +L S     S+E+   +IP+L DLR+DL  K+KEIK L  DFK +  + 
Sbjct: 306 DLPTILNQYHEALASNASNASRELTNDVIPRLEDLRRDLLVKIKEIKSLQSDFKNSCAKE 365

Query: 335 IKITSRLLNKYIASVKLLDEASTSGDKQGEKLKPKHDPYXXXXXXXXXXXXXXXEENYLR 394
           ++ T + +  YI S+           K+     PK DPY               EEN+L 
Sbjct: 366 LQQTKQDMKHYIDSL-----------KEARYGTPKQDPYLAKIALDKQIKKQLIEENFLH 414

Query: 395 EAFLNLQSAALQLEKIVYSKIQSALQRYSALIDSEARLMIKNLCHELQQGILSRPPAVEW 454
           EAF NL+++  +LEK+V  +IQ+AL  Y+ L+  +++L+   L  +L  G  +  P  EW
Sbjct: 415 EAFDNLETSGAELEKVVVMEIQNALTIYARLLGQQSQLIFDILISKLDMGFFNMNPQYEW 474

Query: 455 DNFVSHHPTCLMNLKSTDPPPQPRRLSDIVYPNMKSPLAKCIRVGYLLKKTESSKSFTKG 514
           D F+S  P  L       P    R L +I Y     P    IR GYL ++++  KS++KG
Sbjct: 475 DTFISRDPNFL------QPNVPMRNLKEITYKYQHDPFTYEIRSGYLERRSKFLKSYSKG 528

Query: 515 YFVLTTNYLHE 525
           ++VLT N+LHE
Sbjct: 529 FYVLTPNFLHE 539

>YIL105C (YIL105C) [2571] chr9 complement(167578..169638) Protein
           with similarity to Ask10p and Ynl047p, contains a
           Q/N-rich domain [2061 bp, 686 aa]
          Length = 686

 Score =  196 bits (499), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 123/371 (33%), Positives = 190/371 (51%), Gaps = 59/371 (15%)

Query: 155 PTDILIDRFHKWKKILKSLIAYFREAAYSQEQIARINYQMKNAVKFAFLTDLEDETNKLV 214
           PTDIL  RF  W+ ++KS+I Y  E A  Q++I R   ++ +AV+F F +          
Sbjct: 188 PTDILAARFSAWRNVIKSVIVYLTEIASIQDEIVRQQLRLSHAVQFPFFS---------- 237

Query: 215 DPSISKLPTKKPQPVPLAAQKLDSKYDTDVEQPQSIQXXXXXXXXXXXXGFMKFGSGSIQ 274
                                ++++Y    ++ +S+Q             F+  G+GSIQ
Sbjct: 238 ---------------------IENQYQPSSQEDKSVQKF-----------FLPLGNGSIQ 265

Query: 275 DIQVILKKYHLSLGSQQYKISKEILAYIIPKLTDLRKDLTTKMKEIKELNGDFKTNIGEH 334
           D+  IL +YH SL S   K S+E+   +IP+L DLR+DL  K+KEIK L  DFK +  + 
Sbjct: 266 DLPTILNQYHESLASSASKASRELTNDVIPRLEDLRRDLIVKIKEIKSLQSDFKNSCSKE 325

Query: 335 IKITSRLLNKYIASVKLLDEASTSGDKQGEKLKPKHDPYXXXXXXXXXXXXXXXEENYLR 394
           ++ T + + ++  S+K   +A  S         PK DP+               EEN+L 
Sbjct: 326 LQQTKQAMKQFQESLK---DARYS--------VPKQDPFLTKLALDRQIKKQLQEENFLH 374

Query: 395 EAFLNLQSAALQLEKIVYSKIQSALQRYSALIDSEARLMIKNLCHELQQGILSRPPAVEW 454
           EAF NL+++  +LEKIV  +IQ++L  Y+ L+  EA+L+   L  +L  G  +  P  EW
Sbjct: 375 EAFDNLETSGAELEKIVVMEIQNSLTIYARLLGQEAQLVFDILISKLDSGFFNVDPQFEW 434

Query: 455 DNFVSHHPTCLMNLKSTDPPPQPRRLSDIVYPNMKSPLAKCIRVGYLLKKTESSKSFTKG 514
           DNF+S  P  L+      P    R   +IVY     PL   I+ G+L ++++  KS++KG
Sbjct: 435 DNFISRDPNFLL------PNLPMRTFKEIVYKYQFDPLTYEIKSGFLERRSKFLKSYSKG 488

Query: 515 YFVLTTNYLHE 525
           Y+VLT N+LHE
Sbjct: 489 YYVLTPNFLHE 499

>Kwal_23.4958
          Length = 649

 Score =  193 bits (491), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 119/371 (32%), Positives = 183/371 (49%), Gaps = 59/371 (15%)

Query: 155 PTDILIDRFHKWKKILKSLIAYFREAAYSQEQIARINYQMKNAVKFAFLTDLEDETNKLV 214
           PT++L  RF  W+ +++S++ Y  E    Q++I R   ++ +AV F F       T    
Sbjct: 145 PTEVLAQRFAAWRSVIRSILVYLTETVSIQDEIVRQQLRLSHAVNFPFFA-----TENQH 199

Query: 215 DPSISKLPTKKPQPVPLAAQKLDSKYDTDVEQPQSIQXXXXXXXXXXXXGFMKFGSGSIQ 274
            PS    P +K      A QK                             F+  G+GS+Q
Sbjct: 200 QPST---PEEK------AIQKF----------------------------FLPMGNGSVQ 222

Query: 275 DIQVILKKYHLSLGSQQYKISKEILAYIIPKLTDLRKDLTTKMKEIKELNGDFKTNIGEH 334
           D+  IL ++H  + +   K+SKE+   +IP+L DLR DL  K+KEIK L+ DFK +  + 
Sbjct: 223 DLPSILSQFHSQMANGALKMSKELANEVIPRLEDLRGDLLIKIKEIKTLHSDFKNSCSKE 282

Query: 335 IKITSRLLNKYIASVKLLDEASTSGDKQGEKLKPKHDPYXXXXXXXXXXXXXXXEENYLR 394
           ++ T   L  +I +V    EA+  G        PK DPY               EEN L 
Sbjct: 283 LQQTKHDLKHFIEAV----EAARYG-------APKSDPYLIKISLEKQIKRQLNEENLLH 331

Query: 395 EAFLNLQSAALQLEKIVYSKIQSALQRYSALIDSEARLMIKNLCHELQQGILSRPPAVEW 454
           EAF NLQ +  +LEK+V  +IQ+AL  Y+ L+   A+++   L   L  G  ++ P  EW
Sbjct: 332 EAFDNLQGSGRELEKVVVMEIQNALSIYARLLGQNAQIVFDVLISRLDVGFFNKEPVFEW 391

Query: 455 DNFVSHHPTCLMNLKSTDPPPQPRRLSDIVYPNMKSPLAKCIRVGYLLKKTESSKSFTKG 514
           DNF+S  P  +      +P    R + DIVY     PL   ++ G+L ++++  KS+TKG
Sbjct: 392 DNFISKDPNFI------EPNLPVRHMRDIVYKYQDDPLTYEVKSGFLERRSKFLKSYTKG 445

Query: 515 YFVLTTNYLHE 525
           +++LT++YLHE
Sbjct: 446 FYLLTSSYLHE 456

>Sklu_2395.6 YIL105C, Contig c2395 8302-10437
          Length = 711

 Score =  194 bits (493), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 118/371 (31%), Positives = 184/371 (49%), Gaps = 59/371 (15%)

Query: 155 PTDILIDRFHKWKKILKSLIAYFREAAYSQEQIARINYQMKNAVKFAFLTDLEDETNKLV 214
           PT++L  RF  W+ +++S++ Y  E    Q++I R   ++ +AV F F            
Sbjct: 182 PTEVLAQRFAAWRSVIRSILVYMTETVSIQDEIVRQQLRLSHAVNFPFFAT--------- 232

Query: 215 DPSISKLPTKKPQPVPLAAQKLDSKYDTDVEQPQSIQXXXXXXXXXXXXGFMKFGSGSIQ 274
                     + QP   A +K   K+                        F+  G+GSIQ
Sbjct: 233 --------ENQHQPT-TAEEKAIQKF------------------------FLPLGNGSIQ 259

Query: 275 DIQVILKKYHLSLGSQQYKISKEILAYIIPKLTDLRKDLTTKMKEIKELNGDFKTNIGEH 334
           D+  IL +YH  + S   K SKE+   ++P+L DLR+DL  K+KEIK L  DFK +  + 
Sbjct: 260 DLPSILTQYHSQMASAASKASKELTNEVLPRLEDLRRDLLVKIKEIKGLQSDFKNSCNKE 319

Query: 335 IKITSRLLNKYIASVKLLDEASTSGDKQGEKLKPKHDPYXXXXXXXXXXXXXXXEENYLR 394
           ++ T + L  +  S+   +EA     +Q        DPY               EEN+L 
Sbjct: 320 LQQTKQDLKGFQDSI---EEARYGTARQ--------DPYLAKIILDKQIKRQLTEENFLH 368

Query: 395 EAFLNLQSAALQLEKIVYSKIQSALQRYSALIDSEARLMIKNLCHELQQGILSRPPAVEW 454
           EAF NLQS+  +LEK+V  +IQ+AL  Y+ ++  EA+L+   L  +L  G  ++ P  EW
Sbjct: 369 EAFNNLQSSGRELEKVVVMEIQNALTIYARILGQEAQLVFDILISKLDMGFFNKEPIFEW 428

Query: 455 DNFVSHHPTCLMNLKSTDPPPQPRRLSDIVYPNMKSPLAKCIRVGYLLKKTESSKSFTKG 514
           DNFVS  P  +      +P    R + DIVY N   PL   ++ G+L ++++  KS++KG
Sbjct: 429 DNFVSKDPNFV------EPDLPMRHMKDIVYRNQFDPLTNEVKSGFLERRSKFLKSYSKG 482

Query: 515 YFVLTTNYLHE 525
           ++VLT ++LHE
Sbjct: 483 FYVLTPSFLHE 493

>YNL047C (YNL047C) [4541] chr14 complement(539909..541879) Protein
           with similarity to Ask10p [1971 bp, 656 aa]
          Length = 656

 Score =  192 bits (488), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 115/372 (30%), Positives = 193/372 (51%), Gaps = 60/372 (16%)

Query: 155 PTDILIDRFHKWKKILKSLIAYFREAAYSQEQIARINYQMKNAVKFAFLTDLEDETNKLV 214
           PTD+L  RF  W+ ++++++ Y  E A  Q++I R   ++ +AV+F F +          
Sbjct: 164 PTDVLSARFSAWRNVIRAILVYLSETASIQDEIVRQQLRLSHAVQFPFFS---------- 213

Query: 215 DPSISKLPTKKPQPVPLAAQKLDSKYDTDVEQPQSIQXXXXXXXXXXXXGFMKFGSGSIQ 274
                                ++++Y     + +S+Q             F+  GSGS+Q
Sbjct: 214 ---------------------IENQYQPVSNEDKSMQKF-----------FLPLGSGSVQ 241

Query: 275 DIQVILKKYHLSLGSQQYKISKEILAYIIPKLTDLRKDLTTKMKEIKELNGDFKTNIGEH 334
           D+  +L KYH +L S   K SKE+ + IIP+L DLR+DL  K+KEIK L  DFK +  + 
Sbjct: 242 DLPTMLTKYHDNLASLASKSSKELTSEIIPRLEDLRRDLLVKIKEIKALQSDFKNSCNKE 301

Query: 335 IKITSRLLNKYIASVKLLDEASTSGDKQGEKLKPKHDPYXXXXXXXXXXXXXXXEENYLR 394
           ++ T  L+       KL +E+     K+ +   PK DP+               EENYL 
Sbjct: 302 LQQTKHLM-------KLFNESL----KECKLGTPKSDPFLIKLQLEKQIKRQLVEENYLH 350

Query: 395 EAFLNLQSAALQLEKIVYSKIQSALQRYSALIDSEARLMIKNLCHELQQGILSRPPAVEW 454
           EAF NLQ++  QLE ++  +IQ+ L  Y+ ++  EA+++  ++  +L   IL++   +EW
Sbjct: 351 EAFDNLQNSGAQLESVIVMEIQNGLTSYARILGKEAQVVFDSVISKLDSTILNKNTNLEW 410

Query: 455 DNFVSHHPTCLMNLKSTDPPPQP-RRLSDIVYPNMKSPLAKCIRVGYLLKKTESSKSFTK 513
           D+F+      L N+ +  PP  P RR  +I Y N   P    ++ G+L K+++  KS+++
Sbjct: 411 DSFI------LRNISNFVPPNLPMRRFKEISYSNQNDPFTFEVKSGFLEKRSKFLKSYSR 464

Query: 514 GYFVLTTNYLHE 525
           G++VLT ++LHE
Sbjct: 465 GFYVLTPSFLHE 476

>KLLA0F03839g complement(363977..365923) similar to sp|P40485
           Saccharomyces cerevisiae YIL105c, start by similarity
          Length = 648

 Score =  190 bits (482), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 111/371 (29%), Positives = 184/371 (49%), Gaps = 59/371 (15%)

Query: 155 PTDILIDRFHKWKKILKSLIAYFREAAYSQEQIARINYQMKNAVKFAFLTDLEDETNKLV 214
           PT++L  RF  W+ I++SL+ Y +E    Q+++ R + ++++A+ F F T          
Sbjct: 158 PTEVLSQRFAAWRGIIRSLLVYLQETVSIQDEVVRQHLRLQHAINFPFFT---------- 207

Query: 215 DPSISKLPTKKPQPVPLAAQKLDSKYDTDVEQPQSIQXXXXXXXXXXXXGFMKFGSGSIQ 274
                                +DS++     + ++IQ             F+  G GSIQ
Sbjct: 208 ---------------------IDSQHQPTTPEDKNIQKF-----------FLPLGHGSIQ 235

Query: 275 DIQVILKKYHLSLGSQQYKISKEILAYIIPKLTDLRKDLTTKMKEIKELNGDFKTNIGEH 334
           D+  +  +YH  +     K SKE+   +IP+L D+R+DL  K+KEI+ L  DFK +  + 
Sbjct: 236 DLPTLFNQYHTQMVHAASKASKELSQDVIPRLEDMRRDLLVKIKEIQSLESDFKNSCNKE 295

Query: 335 IKITSRLLNKYIASVKLLDEASTSGDKQGEKLKPKHDPYXXXXXXXXXXXXXXXEENYLR 394
           ++ T   L  +  S+    E S  G         K DP+               EEN+L 
Sbjct: 296 LQETKIRLKAFQESL----ENSKYGS-------VKQDPFLAKILLEKQIKKQLTEENFLH 344

Query: 395 EAFLNLQSAALQLEKIVYSKIQSALQRYSALIDSEARLMIKNLCHELQQGILSRPPAVEW 454
           EAF NLQ++  +LEK+V  +IQ+AL  Y+ ++  EA+++   L  +L  G  ++ P  EW
Sbjct: 345 EAFNNLQTSGRELEKVVMMEIQNALTSYAKVLGQEAQIVFDVLISKLDTGFFNKDPVFEW 404

Query: 455 DNFVSHHPTCLMNLKSTDPPPQPRRLSDIVYPNMKSPLAKCIRVGYLLKKTESSKSFTKG 514
           +NFV+  P  +      DP    RR+ DIVY N   P    I+ G L ++++  KS+++G
Sbjct: 405 ENFVAKDPNFI------DPNLPMRRVKDIVYKNQNDPFTYEIKSGILERRSKFLKSYSRG 458

Query: 515 YFVLTTNYLHE 525
           ++VLT ++LHE
Sbjct: 459 FYVLTPSFLHE 469

>Scas_671.23
          Length = 686

 Score =  190 bits (482), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 118/371 (31%), Positives = 185/371 (49%), Gaps = 59/371 (15%)

Query: 155 PTDILIDRFHKWKKILKSLIAYFREAAYSQEQIARINYQMKNAVKFAFLTDLEDETNKLV 214
           PTDIL  RF  W+ I++S++AY  E A  Q++I R   ++ +AV+F F +          
Sbjct: 234 PTDILAARFSAWRNIIRSILAYLTETASIQDEIVRQQLRLSHAVQFPFFS---------- 283

Query: 215 DPSISKLPTKKPQPVPLAAQKLDSKYDTDVEQPQSIQXXXXXXXXXXXXGFMKFGSGSIQ 274
                                LD+++     QP S +             F+  G+ SIQ
Sbjct: 284 ---------------------LDNQH-----QPSSYEDKATQKF------FLPQGNNSIQ 311

Query: 275 DIQVILKKYHLSLGSQQYKISKEILAYIIPKLTDLRKDLTTKMKEIKELNGDFKTNIGEH 334
           D+  IL  YH    +     S+E+   +IP+L DLR+DL  K+KEIK L  DFK +  + 
Sbjct: 312 DLPTILFNYHNKTANSASAASRELTNEVIPRLEDLRRDLLIKIKEIKSLQSDFKNSCIKE 371

Query: 335 IKITSRLLNKYIASVKLLDEASTSGDKQGEKLKPKHDPYXXXXXXXXXXXXXXXEENYLR 394
           ++ T + L  +  S+K   +A  S         PK DPY               EEN+L 
Sbjct: 372 LQQTKQDLRNFYDSLK---DARYST--------PKQDPYLTKIVLDKQIKRQISEENFLH 420

Query: 395 EAFLNLQSAALQLEKIVYSKIQSALQRYSALIDSEARLMIKNLCHELQQGILSRPPAVEW 454
           EAF NL+++  +LEK+V  +IQ+AL +Y+ L+  +++++  +L  +L  G  +  P  EW
Sbjct: 421 EAFDNLETSGAELEKVVVMEIQNALTQYARLLGQQSQIVFDDLIAKLDSGFFNIDPQFEW 480

Query: 455 DNFVSHHPTCLMNLKSTDPPPQPRRLSDIVYPNMKSPLAKCIRVGYLLKKTESSKSFTKG 514
           DNF++  P  L+      P    R   +I+Y     PL   IR GYL ++++  KS++KG
Sbjct: 481 DNFIARDPNFLL------PNLPMRNFKNIIYKAQYDPLTYQIRSGYLERRSKFLKSYSKG 534

Query: 515 YFVLTTNYLHE 525
           Y+VLT ++LHE
Sbjct: 535 YYVLTPSFLHE 545

>CAGL0G01386g complement(132280..133878) similar to sp|P40485
           Saccharomyces cerevisiae YIL105c or sp|P53955
           Saccharomyces cerevisiae YNL047c, hypothetical start
          Length = 532

 Score =  175 bits (444), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 117/373 (31%), Positives = 184/373 (49%), Gaps = 19/373 (5%)

Query: 154 YPTDILIDRFHKWKKILKSLIAYFREAAYSQEQIARINYQMKNAVKFAFLTDLEDETNKL 213
           +P + L  RF +W+K+LK++I Y  E A  QE+I R N ++ N +    +++    ++  
Sbjct: 20  HPAEQLAQRFTEWRKVLKAIIVYLSEVASVQEEIIRQNAKVSNILASHGISNAGIGSSGS 79

Query: 214 VDPSISKLPTKKPQPVPLAAQKLDSKYDTDVEQPQSIQXXXXXXXXXXXXGFMKFGSGSI 273
                  L +   +     A     K +       S +             F+  G+GSI
Sbjct: 80  GLSGSFNLTSAANKLASGGAHDKHGKNNNGWFFSGS-EEDNTHSANTINHFFLPIGNGSI 138

Query: 274 QDIQVILKKYHLSLGSQQYKISKEILAYIIPKLTDLRKDLTTKMKEIKELNGDFKTNIGE 333
           QD+ +IL++YH  + ++  K ++E+   IIP L  L KDL  K+K IK L+ DFK N  +
Sbjct: 139 QDVPIILRQYHDVMAAEAAKGTRELQNSIIPGLESLNKDLVLKIKSIKSLSSDFKNNCSK 198

Query: 334 HIKITSRLLNKYIASVKLLDEASTSGDKQGEKLKPKHDPYXXXXXXXXXXXXXXXEENYL 393
            +  T   + K+  S+            Q  K  P  DPY               EEN+L
Sbjct: 199 ELDTTRECMVKFQQSIN-----------QARKNVPARDPYLLKVNLDNQIRRQLSEENFL 247

Query: 394 REAFLNLQSAALQLEKIVYSKIQSALQRYSALIDSEARLMIKNLCHELQQGILSRPPAVE 453
            EAF+NLQS+  +LEKIV + IQ+A +  + ++ +EA+++   L + L    LS  P+ E
Sbjct: 248 HEAFMNLQSSGQELEKIVVASIQNAFRVLAQILGAEAKIIDDQLVNRLLSSFLSLSPSHE 307

Query: 454 WDNFVSHHPTCLMNLKSTDPPPQP-RRLSDIVYPNMKSPLAKCIRVGYLLKKTESSKSFT 512
           WDNF+    T  +      P   P R+  +I Y     PL   ++ GYL ++++  KS+T
Sbjct: 308 WDNFLLRDNTNFI------PLNLPMRKFKEIEYTGKNDPLTLVVQCGYLERRSKYLKSYT 361

Query: 513 KGYFVLTTNYLHE 525
           KGY+VLT NYLHE
Sbjct: 362 KGYYVLTPNYLHE 374

>Kwal_56.23334
          Length = 360

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 59/113 (52%), Gaps = 5/113 (4%)

Query: 265 FMKFGSGSIQDIQVILKKYHLSLGSQQYKISKEILAYIIPKLTDLRKDLTTKMKEIKEL- 323
           F+K     ++ I+++L  +  S+ S +YK +KE LA  + KL +L + +  K+ E+    
Sbjct: 247 FIKIWQQKLKLIRLLLSSFSKSIASNEYK-TKEPLAAQLSKLNELHQLVVEKVDELVSTV 305

Query: 324 ---NGDFKTNIGEHIKITSRLLNKYIASVKLLDEASTSGDKQGEKLKPKHDPY 373
              + DFK +  E +++T+ L +     V+++   +   DK+G+ ++     Y
Sbjct: 306 FMASHDFKADDEEILELTTVLNSSIQKIVQIIKTLNKGDDKKGKWIEVWDAKY 358

>AAR048W [234] [Homologous to ScYNR026C (SEC12) - SH; ScYCR067C
           (SED4) - SH] complement(425661..428696) [3036 bp, 1011
           aa]
          Length = 1011

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 14/95 (14%)

Query: 6   TFPKQENGGISKQPATPGSTRSSSRNLELPKNYRSFGGSSDELAS--------MYSADSQ 57
           TF +QE     KQ   P S  S + +LE+P    ++   + +L S        + +A++ 
Sbjct: 832 TFSEQE-----KQQLEPSSIESVATSLEVPNEATTYEVEAADLTSSVDPIEIVIETAETA 886

Query: 58  YLMDMIPDSLTLKNEPASGNTQMNGPDGKENKDIK 92
           Y  D  PD + L+N   S   Q + PD  E  D++
Sbjct: 887 Y-NDASPDIVNLENTLTSTEQQDSAPDINEVDDLE 920

>Scas_620.11
          Length = 518

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 53/116 (45%), Gaps = 16/116 (13%)

Query: 69  LKNEPASGNTQMNGPDGKENKDIKLDEYILPKTDPRSPYYINMPIPKKLPKSEGKARAKQ 128
           L+ +    N  + G   KE KD+ L    L     ++P   +  +PKK P  E   ++++
Sbjct: 38  LQRQKLYTNFSIYGELNKEVKDVDLTR-ALRSIIFKNPILAHTIVPKKYPDQEPFYQSEE 96

Query: 129 KVNRADPSDLDVENIYETSGEFVREYP----TDILIDRFHKWKKILKSLIAYFREA 180
            +N   P             +F++  P    +DILI+   ++++I+  ++  F+EA
Sbjct: 97  YLNAPYPEH-----------DFIKVLPKLSLSDILINEQEEFREIVDDILTQFKEA 141

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.128    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 33,504,688
Number of extensions: 1452784
Number of successful extensions: 4381
Number of sequences better than 10.0: 53
Number of HSP's gapped: 4480
Number of HSP's successfully gapped: 79
Length of query: 1064
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 952
Effective length of database: 12,718,893
Effective search space: 12108386136
Effective search space used: 12108386136
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)