Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPR113W (PIS1)22020511031e-155
CAGL0G03157g2192037701e-104
Scas_705.202212067651e-104
Kwal_52.194432121977057e-95
KLLA0D15037g2252066485e-86
Sklu_951.12232056312e-83
AAR037W2622065986e-78
Scas_645.24239651121e-06
Sklu_2382.8271681122e-06
CAGL0I03784g270651051e-05
Kwal_56.24503262841042e-05
KLLA0F05027g298801023e-05
ADR084C277821014e-05
YDL142C (CRD1)28368890.001
Scas_31.125799710.27
KLLA0F24354g391110710.36
AGR344W39095710.39
YHR123W (EPT1)39188652.0
Kwal_33.1471538947642.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR113W
         (217 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR113W (PIS1) [5534] chr16 (752253..752915) CDP-diacylglycerol-...   429   e-155
CAGL0G03157g 292181..292840 highly similar to sp|P06197 Saccharo...   301   e-104
Scas_705.20                                                           299   e-104
Kwal_52.19443                                                         276   7e-95
KLLA0D15037g 1269125..1269802 similar to sp|P06197 Saccharomyces...   254   5e-86
Sklu_951.1 YPR113W, Contig c951 1150-1821 reverse complement          247   2e-83
AAR037W [223] [Homologous to ScYPR113W (PIS1) - SH] complement(4...   234   6e-78
Scas_645.24                                                            48   1e-06
Sklu_2382.8 YDL142C, Contig c2382 19681-20496                          48   2e-06
CAGL0I03784g complement(325276..326088) similar to sp|Q07560 Sac...    45   1e-05
Kwal_56.24503                                                          45   2e-05
KLLA0F05027g complement(492389..493285) similar to sp|Q07560 Sac...    44   3e-05
ADR084C [1825] [Homologous to ScYDL142C (CRD1) - SH] (856914..85...    44   4e-05
YDL142C (CRD1) [726] chr4 complement(201720..202571) Cardiolipin...    39   0.001
Scas_31.1                                                              32   0.27 
KLLA0F24354g join(2269337..2269386,2269496..2270621) similar to ...    32   0.36 
AGR344W [4655] [Homologous to ScYNL130C (CPT1) - SH; ScYHR123W (...    32   0.39 
YHR123W (EPT1) [2411] chr8 (354817..354866,354958..356083) sn-1,...    30   2.0  
Kwal_33.14715                                                          29   2.5  

>YPR113W (PIS1) [5534] chr16 (752253..752915)
           CDP-diacylglycerol-inositol 3-phosphatidyltransferase
           (phosphatidylinositol synthase) [663 bp, 220 aa]
          Length = 220

 Score =  429 bits (1103), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 1   MSSNSTPEKVTAEHVLWYIPNKIGYVRVITAALSFFVMKNHPTAFTWLYSTSCLLDALDG 60
           MSSNSTPEKVTAEHVLWYIPNKIGYVRVITAALSFFVMKNHPTAFTWLYSTSCLLDALDG
Sbjct: 1   MSSNSTPEKVTAEHVLWYIPNKIGYVRVITAALSFFVMKNHPTAFTWLYSTSCLLDALDG 60

Query: 61  TMARKYNQVSSLGAVLDMVTDRSSTAGLMCFLCVQYPQWCVFFQLMLGLDITSHYMHMYA 120
           TMARKYNQVSSLGAVLDMVTDRSSTAGLMCFLCVQYPQWCVFFQLMLGLDITSHYMHMYA
Sbjct: 61  TMARKYNQVSSLGAVLDMVTDRSSTAGLMCFLCVQYPQWCVFFQLMLGLDITSHYMHMYA 120

Query: 121 SLSAGKTSHKSVGEGESRLLHLYYTRRDVLFTICAFNELFYAGLYLQLFSNSATFGKWTT 180
           SLSAGKTSHKSVGEGESRLLHLYYTRRDVLFTICAFNELFYAGLYLQLFSNSATFGKWTT
Sbjct: 121 SLSAGKTSHKSVGEGESRLLHLYYTRRDVLFTICAFNELFYAGLYLQLFSNSATFGKWTT 180

Query: 181 IISFPGYVFKQTANVVQLKRAALIL 205
           IISFPGYVFKQTANVVQLKRAALIL
Sbjct: 181 IISFPGYVFKQTANVVQLKRAALIL 205

>CAGL0G03157g 292181..292840 highly similar to sp|P06197
           Saccharomyces cerevisiae YPR113w PIS1 CDP
           diacylglycerol--inositol 3-phosphatidyltransferase,
           hypothetical start
          Length = 219

 Score =  301 bits (770), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 166/203 (81%), Gaps = 2/203 (0%)

Query: 5   STPEKVTAEHVLWYIPNKIGYVRVITAALSFFVMKNHPTAFTWLYSTSCLLDALDGTMAR 64
           S+ E+VTA+ V+WYIPNKIGY+RVI+A +SF  M+++P     +Y  SCLLDALDGTMAR
Sbjct: 2   SSTEQVTAKDVVWYIPNKIGYMRVISAIISFATMRDYPFLTMLVYGVSCLLDALDGTMAR 61

Query: 65  KYNQVSSLGAVLDMVTDRSSTAGLMCFLCVQYPQ--WCVFFQLMLGLDITSHYMHMYASL 122
           KYNQVS LGAVLDMVTDRS+T+GLMC+LC  YP   WCVFFQ++LGLDI+SHYMHMYA+L
Sbjct: 62  KYNQVSRLGAVLDMVTDRSTTSGLMCYLCFAYPSRIWCVFFQVLLGLDISSHYMHMYANL 121

Query: 123 SAGKTSHKSVGEGESRLLHLYYTRRDVLFTICAFNELFYAGLYLQLFSNSATFGKWTTII 182
           S G+ SHK+V +  SRLLHLYYTRRDVLFTICAFNE+FY GLY   F   AT GKW  II
Sbjct: 122 SGGQGSHKNVSKESSRLLHLYYTRRDVLFTICAFNEVFYGGLYFYSFPQYATVGKWLCII 181

Query: 183 SFPGYVFKQTANVVQLKRAALIL 205
             PGY+FKQ ANV+QL RAAL+L
Sbjct: 182 CLPGYIFKQVANVIQLNRAALML 204

>Scas_705.20
          Length = 221

 Score =  299 bits (765), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 140/206 (67%), Positives = 163/206 (79%), Gaps = 1/206 (0%)

Query: 1   MSSNSTPE-KVTAEHVLWYIPNKIGYVRVITAALSFFVMKNHPTAFTWLYSTSCLLDALD 59
           MSS   P    TA  V WYIPN+IGY+RV+TA +SFF M N+P     +Y  SCLLDALD
Sbjct: 1   MSSTKMPAGSTTANTVFWYIPNQIGYMRVLTAVISFFTMHNYPVFTGLVYGISCLLDALD 60

Query: 60  GTMARKYNQVSSLGAVLDMVTDRSSTAGLMCFLCVQYPQWCVFFQLMLGLDITSHYMHMY 119
           GTMARKYNQVS+LGAVLDMVTDRS+T+GL CFLC ++P WCV FQL+L LDI+SHYMHMY
Sbjct: 61  GTMARKYNQVSTLGAVLDMVTDRSTTSGLTCFLCYKFPSWCVIFQLLLALDISSHYMHMY 120

Query: 120 ASLSAGKTSHKSVGEGESRLLHLYYTRRDVLFTICAFNELFYAGLYLQLFSNSATFGKWT 179
           A+LS+G TSHK+V    S+LLHLYYTRRDVLFTIC FNE FY GLYL  + N  TFGKW 
Sbjct: 121 ATLSSGTTSHKNVSNESSKLLHLYYTRRDVLFTICFFNESFYGGLYLFAYDNYHTFGKWV 180

Query: 180 TIISFPGYVFKQTANVVQLKRAALIL 205
            +IS PG++FKQ  NV+QL+RAALIL
Sbjct: 181 ALISLPGFIFKQITNVIQLQRAALIL 206

>Kwal_52.19443
          Length = 212

 Score =  276 bits (705), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 156/197 (79%), Gaps = 1/197 (0%)

Query: 9   KVTAEHVLWYIPNKIGYVRVITAALSFFVMKNHPTAFTWLYSTSCLLDALDGTMARKYNQ 68
           +VTA+ VLWYIPN+IGY+RV TA +SFF+M  HP   TW+Y TSCLLDALDGTMARKYNQ
Sbjct: 3   QVTAKQVLWYIPNQIGYMRVATAVISFFLMAGHPVWTTWVYGTSCLLDALDGTMARKYNQ 62

Query: 69  VSSLGAVLDMVTDRSSTAGLMCFLCVQYPQWCVFFQLMLGLDITSHYMHMYASLSAGKTS 128
            S  GAVLDMVTDRS+T+ L+CFLCVQYP++   FQ++L LD++SHYMHMYA+LS+G  S
Sbjct: 63  TSGFGAVLDMVTDRSTTSSLLCFLCVQYPRFAAVFQILLSLDLSSHYMHMYATLSSGGES 122

Query: 129 HKSVGEGESRLLHLYYTRRDVLFTICAFNELFYAGLYLQLFSNSATFGKWTTIISFPGYV 188
           HK + E E  LL+LYY+RR VLFT+CAFNELFY  LYL  F   A  G    ++  PGYV
Sbjct: 123 HKKI-EKEQWLLNLYYSRRSVLFTVCAFNELFYLALYLYGFPQLAGIGGVLAVVCLPGYV 181

Query: 189 FKQTANVVQLKRAALIL 205
           FKQ AN+VQLKRAA++L
Sbjct: 182 FKQVANIVQLKRAAMLL 198

>KLLA0D15037g 1269125..1269802 similar to sp|P06197 Saccharomyces
           cerevisiae YPR113w PIS1 CDP diacylglycerol--inositol
           3-phosphatidyltransferase singleton, start by similarity
          Length = 225

 Score =  254 bits (648), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 125/206 (60%), Positives = 146/206 (70%), Gaps = 11/206 (5%)

Query: 10  VTAEHVLWYIPNKIGYVRVITAALSFFVMKNHPTAFTWLYSTSCLLDALDGTMARKYNQV 69
           VTA  VLWYIPN+IGYVRV+T  LS  +M  HP     +Y  SCLLDALDGTMARKY Q+
Sbjct: 4   VTARDVLWYIPNQIGYVRVVTMCLSLVLMAKHPLWTMVVYGVSCLLDALDGTMARKYGQI 63

Query: 70  SSLGAVLDMVTDRSSTAGLMCFLCVQYPQWCVFFQLMLGLDITSHYMHMYASLSAGKTSH 129
           SS GAVLDMVTDRS+T  L+CFLCV YP W   FQL++ LDI+SHY+HMYA+LS G  SH
Sbjct: 64  SSFGAVLDMVTDRSTTTALICFLCVAYPVWSPVFQLLVALDISSHYIHMYATLSTGSQSH 123

Query: 130 KSVGEGESRLLHLYYTRRDVLFTICAFNELFYAGLYLQLFSN----------SATFGKWT 179
           K++ E E  LL+LYYTRR VLFTICA NE+FY GLY+  F            S   G   
Sbjct: 124 KAI-EKEQWLLNLYYTRRKVLFTICALNEMFYMGLYINAFPQFKSYYFPLLGSTHIGAII 182

Query: 180 TIISFPGYVFKQTANVVQLKRAALIL 205
            ++  PGY+FKQ ANVVQL RAAL+L
Sbjct: 183 ALVCLPGYIFKQIANVVQLNRAALML 208

>Sklu_951.1 YPR113W, Contig c951 1150-1821 reverse complement
          Length = 223

 Score =  247 bits (631), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 147/205 (71%), Gaps = 11/205 (5%)

Query: 11  TAEHVLWYIPNKIGYVRVITAALSFFVMKNHPTAFTWLYSTSCLLDALDGTMARKYNQVS 70
           T + VLWYIPN+IGY RV+TA LSFF+M+ HP     +Y  SCLLDALDGTMARKYNQ S
Sbjct: 5   TPQTVLWYIPNQIGYTRVVTAILSFFLMEKHPLYTMLVYGISCLLDALDGTMARKYNQTS 64

Query: 71  SLGAVLDMVTDRSSTAGLMCFLCVQYPQWCVFFQLMLGLDITSHYMHMYASLSAGKTSHK 130
            LGAVLDMVTDRS+T+ L+CFLCV YP++   FQ+++ LD++SHYMHMYA+LS G  SHK
Sbjct: 65  GLGAVLDMVTDRSTTSSLLCFLCVLYPRFASIFQILISLDLSSHYMHMYATLSTGGDSHK 124

Query: 131 SVGEGESRLLHLYYTRRDVLFTICAFNELFYAGLYLQLFSN----------SATFGKWTT 180
            + E E  LL+LYY+ R +LFTICAFNE+FY  LYL  F            S        
Sbjct: 125 KI-EKEQWLLNLYYSNRQMLFTICAFNEIFYMALYLYAFPQLKHVDLPVLGSTHIAGIIA 183

Query: 181 IISFPGYVFKQTANVVQLKRAALIL 205
            +  PGY+FKQ AN++QLKRAA++L
Sbjct: 184 AVCLPGYIFKQIANIIQLKRAAMML 208

>AAR037W [223] [Homologous to ScYPR113W (PIS1) - SH]
           complement(407884..408672) [789 bp, 262 aa]
          Length = 262

 Score =  234 bits (598), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 119/206 (57%), Positives = 143/206 (69%), Gaps = 12/206 (5%)

Query: 10  VTAEHVLWYIPNKIGYVRVITAALSFFVMKNHPTAFTWLYSTSCLLDALDGTMARKYNQV 69
           VTA+ VL YIPN IGY+RV T  ++ F+MKNHP   T +Y  SCLLDALDGTMAR+Y Q 
Sbjct: 42  VTAKQVLRYIPNCIGYMRVATMVVACFLMKNHPAWTTVVYGVSCLLDALDGTMARRYGQT 101

Query: 70  SSLGAVLDMVTDRSSTAGLMCFLCVQYPQWCVFFQLMLGLDITSHYMHMYASLSAGKTSH 129
           S  GAVLDMVTDRS+T  L+CFLC+ YP+W   FQL++ LD++SHYMHMY SLS G  SH
Sbjct: 102 SRFGAVLDMVTDRSTTNALICFLCLLYPRWTPVFQLLIALDLSSHYMHMYGSLSCGD-SH 160

Query: 130 KSVGEGESRLLHLYYTRRDVLFTICAFNELFYAGLYLQLFSN----------SATFGKWT 179
           K + E +  LLH+YY+RRDVLF +C  NELFY G+YL  F               FG   
Sbjct: 161 KKI-EKDQWLLHMYYSRRDVLFAVCFLNELFYFGIYLAGFPQLWHLWLPGLGRLHFGTLV 219

Query: 180 TIISFPGYVFKQTANVVQLKRAALIL 205
            ++  PGYVFKQ  NVVQL RAAL+L
Sbjct: 220 ALLCLPGYVFKQITNVVQLNRAALLL 245

>Scas_645.24
          Length = 239

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 19 IPNKIGYVRVITAAL-SFFVMKNHPTAFTWLYSTSCLLDALDGTMARKYNQVSSLGAVLD 77
          IPN I   R+ T  L  +F++ N+      L++ SC+ D LDG +ARKY   S  G++LD
Sbjct: 24 IPNVITMSRIATTPLVGYFILSNNLIPAMGLFAYSCITDFLDGYIARKYYLKSVAGSILD 83

Query: 78 MVTDR 82
           + D+
Sbjct: 84 PIADK 88

>Sklu_2382.8 YDL142C, Contig c2382 19681-20496
          Length = 271

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 16  LWYIPNKIGYVRVITAAL-SFFVMKNHPTAFTWLYSTSCLLDALDGTMARKYNQVSSLGA 74
           ++ +PN + + R+  A L   +++  + T    L++ SCL D LDG +ARKY   S LG 
Sbjct: 54  IYTLPNILTFSRIAAAPLIGHYILSQNLTPALCLFTYSCLTDFLDGYLARKYKMKSVLGT 113

Query: 75  VLDMVTDR 82
           +LD + D+
Sbjct: 114 ILDPMADK 121

>CAGL0I03784g complement(325276..326088) similar to sp|Q07560
           Saccharomyces cerevisiae YDL142c PGS1 cardiolipin
           synthase, hypothetical start
          Length = 270

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 19  IPNKIGYVRVITAAL-SFFVMKNHPTAFTWLYSTSCLLDALDGTMARKYNQVSSLGAVLD 77
           IPN I   R+ T  +  +F++ N       L++ S + D LDG +AR+YN  S  G +LD
Sbjct: 53  IPNVITITRIATTPMIGYFLLNNQLVPALSLFAYSSITDFLDGYIARRYNMKSDAGTILD 112

Query: 78  MVTDR 82
            + D+
Sbjct: 113 PMADK 117

>Kwal_56.24503
          Length = 262

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 4/84 (4%)

Query: 3   SNSTPEKVTAEHVL---WYIPNKIGYVRVITAAL-SFFVMKNHPTAFTWLYSTSCLLDAL 58
           SN  P       +L   + +PN +   R+  A +    ++ N+      L++ SCL D L
Sbjct: 31  SNVKPNPKKIPSILSSIYTLPNMLTITRIAAAPMIGHCIVNNNLIPALGLFTYSCLTDFL 90

Query: 59  DGTMARKYNQVSSLGAVLDMVTDR 82
           DG MARKY+  S  G VLD + D+
Sbjct: 91  DGYMARKYDMKSVAGTVLDPMADK 114

>KLLA0F05027g complement(492389..493285) similar to sp|Q07560
           Saccharomyces cerevisiae YDL142c PGS1 cardiolipin
           synthase singleton, start by similarity
          Length = 298

 Score = 43.9 bits (102), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 1/80 (1%)

Query: 16  LWYIPNKIGYVRVITAAL-SFFVMKNHPTAFTWLYSTSCLLDALDGTMARKYNQVSSLGA 74
           +W +PN +   R+ T  L  ++++  +      L+  SC+ D LDG +AR Y   S  G 
Sbjct: 82  IWTLPNVLTMSRIATTPLIGYYILTQNLAPAMSLFVYSCVTDFLDGYLARSYKMKSVAGT 141

Query: 75  VLDMVTDRSSTAGLMCFLCV 94
           VLD + D+         LCV
Sbjct: 142 VLDPMADKILMMTTTAALCV 161

>ADR084C [1825] [Homologous to ScYDL142C (CRD1) - SH]
           (856914..857747) [834 bp, 277 aa]
          Length = 277

 Score = 43.5 bits (101), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 5/82 (6%)

Query: 12  AEHVLWYIPNKIGYVRVITAA-LSFFVMKNHPTAFTWLYSTSCLLDALDGTMARKYNQVS 70
            + V+W +PN +   R+  A  +   +M         L++ SC+ D LDG +ARKY   +
Sbjct: 54  PKSVIWTVPNILTMSRIACAPFIGHCIMTQQLMPAFCLFAYSCVTDFLDGYLARKYKSRT 113

Query: 71  SLGAVLDMVTDR----SSTAGL 88
             G +LD + D+     +TAGL
Sbjct: 114 VAGTILDPMADKLLMIVTTAGL 135

>YDL142C (CRD1) [726] chr4 complement(201720..202571) Cardiolipin
           synthase, synthesizes cardiolipin from
           phosphatidylglycerol and CDP-diacylglycerol [852 bp, 283
           aa]
          Length = 283

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 16  LWYIPNKIGYVRV-ITAALSFFVMKNHPTAFTWLYSTSCLLDALDGTMARKYNQVSSLGA 74
           L  IPN +   R+  T  +  F++ N+ T    L++ S + D +DG +ARKY   +  G 
Sbjct: 67  LLNIPNILTLSRIGCTPFIGLFIITNNLTPALGLFAFSSITDFMDGYIARKYGLKTIAGT 126

Query: 75  VLDMVTDR 82
           +LD + D+
Sbjct: 127 ILDPLADK 134

>Scas_31.1
          Length = 257

 Score = 32.0 bits (71), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 39/99 (39%), Gaps = 16/99 (16%)

Query: 9   KVTAEHVLWYIPNKI---GYVRVITAALSFFVMKNHPT----AFTWLYSTSCL------- 54
           K     +LW  PN +   G+  +I   L+  V+   PT       W Y +  L       
Sbjct: 24  KFVTIFLLWMAPNVVTLTGFGFIILNVLT--VLYYDPTLTEETPRWTYFSYALGLFLYQT 81

Query: 55  LDALDGTMARKYNQVSSLGAVLDMVTDRSSTAGLMCFLC 93
            DA DGT AR+  Q   LG + D   D  +T   M   C
Sbjct: 82  FDACDGTHARRTGQSGPLGELFDHCIDSLNTTLSMLVFC 120

>KLLA0F24354g join(2269337..2269386,2269496..2270621) similar to
           sp|P17898 Saccharomyces cerevisiae YNL130c CPT1
           diacylglycerol cholinephosphotransferase, start by
           similarity
          Length = 391

 Score = 32.0 bits (71), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 43/110 (39%), Gaps = 20/110 (18%)

Query: 16  LWYIPNKI---GYVRVITAALSFFVMKNHPT----AFTWLYSTSCL-------LDALDGT 61
           LW  PN +   G+  +I   L+  V+  +PT       W Y +  L        DA DG 
Sbjct: 44  LWMAPNVVTLSGFGFIIVNVLT--VLYLNPTLDQEQPRWAYFSYALGLFLYQTFDACDGA 101

Query: 62  MARKYNQVSSLGAVLDMVTDRSSTAGLMCFLC----VQYPQWCVFFQLML 107
            AR+  Q   LG + D   D  +T   M   C    V Y    +F Q  L
Sbjct: 102 HARRTGQSGPLGELFDHCIDALNTTLSMFIFCSVCGVGYKPMILFIQFAL 151

>AGR344W [4655] [Homologous to ScYNL130C (CPT1) - SH; ScYHR123W
           (EPT1) - SH]
           complement(1368344..1368393,1368447..1369569) [1173 bp,
           390 aa]
          Length = 390

 Score = 32.0 bits (71), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 45/95 (47%), Gaps = 19/95 (20%)

Query: 16  LWYIPNKI-----GYVRVITAALSFFVMK---NHP--TAFTW-----LYSTSCLLDALDG 60
           LW  PN +     G++      + ++  K   N+P  T FT+     LY T    DA DG
Sbjct: 44  LWMAPNAVTLSGFGFIVANLCTVLYYDPKLEGNNPRWTYFTYAIGLFLYQT---FDACDG 100

Query: 61  TMARKYNQVSSLGAVLDMVTDRSSTA-GLMCFLCV 94
             AR+ +Q S LG + D   D  +T+ G++ F  V
Sbjct: 101 AHARRTSQSSPLGELFDHCIDALNTSLGVIVFCSV 135

>YHR123W (EPT1) [2411] chr8 (354817..354866,354958..356083)
           sn-1,2-Diacylglycerol ethanolaminephosphotransferase,
           catalyzes the synthesis of phosphatidylethanolamine from
           CDP-ethanolamine and diacylglycerol [1176 bp, 391 aa]
          Length = 391

 Score = 29.6 bits (65), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 35/88 (39%), Gaps = 13/88 (14%)

Query: 17  WYIPNKI---GYVRVITAALSFFVMKNHPTAFT--WLYSTSCL-------LDALDGTMAR 64
           W  PN I   G+  ++   L+ F    +    T  W Y +  L        D  DG  AR
Sbjct: 45  WMAPNIITLSGFAFIVINVLTVFYYDPNLNTDTPRWTYFSYALGVFLYQTFDGCDGVHAR 104

Query: 65  KYNQVSSLGAVLDMVTDR-SSTAGLMCF 91
           + NQ   LG + D   D  +ST  +  F
Sbjct: 105 RINQSGPLGELFDHSIDAINSTLSIFIF 132

>Kwal_33.14715
          Length = 389

 Score = 29.3 bits (64), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 3/47 (6%)

Query: 47  WLYSTSCLLDALDGTMARKYNQVSSLGAVLDMVTDRSSTAGLMCFLC 93
           +LY T    DA DG  AR+  Q   LG + D   D  +T   M   C
Sbjct: 89  FLYQT---FDACDGQHARRTGQSGPLGELFDHCIDSLNTTLSMMVFC 132

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.135    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,139,969
Number of extensions: 224604
Number of successful extensions: 657
Number of sequences better than 10.0: 19
Number of HSP's gapped: 648
Number of HSP's successfully gapped: 19
Length of query: 217
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 120
Effective length of database: 13,238,163
Effective search space: 1588579560
Effective search space used: 1588579560
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)