Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPR112C (MRD1)88787243850.0
Scas_705.2286989028950.0
CAGL0B04169g86188526940.0
KLLA0D14949g87888626470.0
Kwal_23.398587688726330.0
ADR035C83887625680.0
Scas_88.125624510251e-133
CAGL0E03245g4251861962e-15
KLLA0C11495g4451851872e-14
Scas_621.104151851845e-14
YGR159C (NSR1)4141801836e-14
AFR107W3961861801e-13
Sklu_1879.44211871749e-13
YER165W (PAB1)5771721704e-12
CAGL0L11792g5791721678e-12
Scas_576.75751651661e-11
AGR122C5851721652e-11
Sklu_1838.35891721642e-11
YHR015W (MIP6)6593301606e-11
KLLA0C17600g5921621501e-09
Sklu_2442.114642091427e-09
KLLA0F07799g5241311321e-07
Scas_637.23771711264e-07
CAGL0J11154g3802081265e-07
Sklu_1790.3473731231e-06
AEL016C6781861222e-06
YCL011C (GBP2)4271741203e-06
Scas_635.75811101194e-06
CAGL0M03795g513951195e-06
CAGL0E01947g452951185e-06
Sklu_1715.13961011186e-06
YOL123W (HRP1)534781187e-06
Kwal_55.21960597951187e-06
Kwal_56.23486587821178e-06
AFL224W2061101128e-06
YNL016W (PUB1)4532231161e-05
Scas_565.8322861141e-05
KLLA0C12925g570951151e-05
KLLA0A05346g874931152e-05
KLLA0D08206g391831132e-05
CAGL0I08943g6021991142e-05
ABL134C375781132e-05
YPL043W (NOP4)685891142e-05
AGL250W7291951142e-05
Sklu_2182.3371761123e-05
Scas_701.3321601103e-05
Kwal_33.14463393781113e-05
YNL110C (NOP15)2201141083e-05
YOL041C (NOP12)459491114e-05
KLLA0F23650g312801104e-05
Sklu_2353.5252601084e-05
CAGL0L03806g2551201076e-05
ADL063W320971087e-05
ADL160W5261181089e-05
CAGL0B04807g4192041089e-05
Scas_666.112241101059e-05
CAGL0D05236g443781071e-04
Scas_717.41379991061e-04
CAGL0L12672g682931081e-04
Sklu_2407.32211131031e-04
Kwal_33.152081861231021e-04
Kwal_26.7179456671061e-04
Kwal_0.2502161681032e-04
Scas_316.1483891062e-04
Kwal_26.8458219771022e-04
Sklu_2307.2697951062e-04
Scas_558.14353561052e-04
KLLA0B00847g269561032e-04
YIL061C (SNP1)300601033e-04
KLLA0D11792g685671053e-04
Kwal_27.118326862071053e-04
YNL004W (HRB1)4293301033e-04
YBR212W (NGR1)672731043e-04
Kwal_47.18572363761033e-04
Scas_376.14041891034e-04
CAGL0D06182g280701014e-04
CAGL0H03861g4432771034e-04
Scas_598.1516981016e-04
CAGL0H10604g416861007e-04
CAGL0I09900g21159978e-04
Kwal_0.3705601641000.001
Kwal_26.752226270980.001
YNL175C (NOP13)40397980.001
Scas_643.1644864990.001
Scas_671.444385980.001
ADR017W17357940.001
Kwal_23.586427860970.001
YDR432W (NPL3)41474970.002
CAGL0H04763g38374970.002
KLLA0A08338g76670980.002
AGR390C37889960.002
Sklu_2221.828156950.002
ACR274W42674960.002
AGR010C26690940.003
ADR189W26957940.003
YGL044C (RNA15)29670940.003
KLLA0E08745g475235940.004
CAGL0K06655g80273950.004
YIR005W (IST3)14872890.004
KLLA0E11011g432127940.004
Scas_697.10610193940.005
KLLA0D05016g26291910.006
CAGL0M12573g29953920.006
Scas_621.1631470920.006
Sklu_2213.425772910.006
Kwal_27.1144743985920.007
Kwal_27.10364443132920.007
KLLA0D13420g16661880.008
KLLA0F09383g25875900.008
Kwal_56.2470982895920.008
KLLA0C05522g54069910.009
CAGL0F01023g39658910.010
Kwal_33.1349633072890.012
ADR183C32071890.013
AEL217W83478900.014
Sklu_1706.1672176900.015
AAL018W337250890.015
YPL178W (CBC2)20863870.016
Scas_720.224560870.020
AAR151W48173880.022
CAGL0E03630g74664890.022
AFR649W31080860.027
Sklu_1984.328496860.028
YFR023W (PES4)611176870.030
CAGL0A04213g63972870.034
AER285C42671860.040
Kwal_27.1233720959840.041
Sklu_2257.418861830.044
Kwal_55.2097213561810.044
AFL050W21883830.050
Kwal_14.185153573850.050
Kwal_27.1109620163820.058
YBL051C (PIN4)66872850.064
ADR001C32481830.067
Scas_530.468455840.074
CAGL0C01529g23658820.075
KLLA0B00979g34260820.10
Scas_714.5923355800.13
Scas_709.2*17145780.15
Sklu_2375.520768790.16
KLLA0D13772g34572800.18
Kwal_30.1289028054790.18
Kwal_55.2090314767760.21
Sklu_905.151572800.22
CAGL0F08217g67890800.23
Sklu_2085.220976770.24
CAGL0J01914g16961760.24
KLLA0C08019g30160770.41
Scas_665.4219193760.42
YDR429C (TIF35)27455760.47
Sklu_2249.430981760.53
CAGL0H04675g27455750.63
Kwal_55.2041428480750.69
AGR057C727186760.71
KLLA0B10472g19886730.74
ACR235W57872750.75
Scas_500.662172750.85
YHL024W (RIM4)71355750.92
CAGL0A03117g232117730.96
CAGL0H03267g77573750.98
KLLA0F18216g70851751.00
CAGL0H02123g55547741.1
CAGL0J02200g14447701.2
ADL126C46695731.2
KLLA0E00484g242217721.4
KLLA0C07194g29745702.6
Scas_696.3244569703.1
YDR381W (YRA1)22689683.5
YIR001C (SGN1)25069683.6
YHR086W (NAM8)52369694.5
Kwal_55.2103911966654.6
KLLA0F17413g388147684.6
ADL253C751118694.9
Kwal_26.7414704128685.3
AER349C21859666.1
Sklu_2391.176173686.2
Kwal_33.1481057472677.7
ADL371C28462668.4
YMR268C (PRP24)44469668.8
Scas_632.7*22984659.2
Kwal_56.2394580640669.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR112C
         (872 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein w...  1693   0.0  
Scas_705.22                                                          1119   0.0  
CAGL0B04169g complement(404713..407298) highly similar to tr|Q06...  1042   0.0  
KLLA0D14949g complement(1259860..1262496) similar to sgd|S000631...  1024   0.0  
Kwal_23.3985                                                         1018   0.0  
ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH] (768392..77...   993   0.0  
Scas_88.1                                                             399   e-133
CAGL0E03245g complement(299236..300513) similar to sp|P27476 Sac...    80   2e-15
KLLA0C11495g complement(990832..992169) some similarities with s...    77   2e-14
Scas_621.10                                                            75   5e-14
YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar ...    75   6e-14
AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH] complement(...    74   1e-13
Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement         72   9e-13
YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding prot...    70   4e-12
CAGL0L11792g 1259275..1261014 highly similar to sp|P04147 Saccha...    69   8e-12
Scas_576.7                                                             69   1e-11
AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH] (978634..98...    68   2e-11
Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement         68   2e-11
YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similar...    66   6e-11
KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces...    62   1e-09
Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement      59   7e-09
KLLA0F07799g complement(734889..736463) similar to sp|Q08208 Sac...    55   1e-07
Scas_637.2                                                             53   4e-07
CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces...    53   5e-07
Sklu_1790.3 YOL041C, Contig c1790 1701-3122                            52   1e-06
AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W (...    52   2e-06
YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein inv...    51   3e-06
Scas_635.7                                                             50   4e-06
CAGL0M03795g complement(428607..430148) highly similar to sp|Q99...    50   5e-06
CAGL0E01947g 193225..194583 some similarities with sp|Q99383 Sac...    50   5e-06
Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement          50   6e-06
YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylate...    50   7e-06
Kwal_55.21960                                                          50   7e-06
Kwal_56.23486                                                          50   8e-06
AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH] complement...    48   8e-06
YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylate...    49   1e-05
Scas_565.8                                                             49   1e-05
KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383 S...    49   1e-05
KLLA0A05346g 485886..488510 some similarities with sp|P53316 Sac...    49   2e-05
KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces c...    48   2e-05
CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces c...    49   2e-05
ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH] (140625..14...    48   2e-05
YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein r...    49   2e-05
AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH] complement(...    49   2e-05
Sklu_2182.3 YDR432W, Contig c2182 3920-5035                            48   3e-05
Scas_701.3                                                             47   3e-05
Kwal_33.14463                                                          47   3e-05
YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein ...    46   3e-05
YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein ...    47   4e-05
KLLA0F23650g 2210563..2211501 some similarities with sp|P53927 S...    47   4e-05
Sklu_2353.5 YIL061C, Contig c2353 10817-11575                          46   4e-05
CAGL0L03806g 438388..439155 similar to sp|P53927 Saccharomyces c...    46   6e-05
ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH] complement(...    46   7e-05
ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH] complement(...    46   9e-05
CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces c...    46   9e-05
Scas_666.11                                                            45   9e-05
CAGL0D05236g 499006..500337 weakly similar to sp|P43607 Saccharo...    46   1e-04
Scas_717.41                                                            45   1e-04
CAGL0L12672g complement(1359637..1361685) similar to sp|P37838 S...    46   1e-04
Sklu_2407.3 YNL110C, Contig c2407 3664-4329 reverse complement         44   1e-04
Kwal_33.15208                                                          44   1e-04
Kwal_26.7179                                                           45   1e-04
Kwal_0.250                                                             44   2e-04
Scas_316.1                                                             45   2e-04
Kwal_26.8458                                                           44   2e-04
Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement         45   2e-04
Scas_558.1                                                             45   2e-04
KLLA0B00847g complement(65983..66792) similar to sp|Q04067 Sacch...    44   2e-04
YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1 snRNA-a...    44   3e-04
KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces...    45   3e-04
Kwal_27.11832                                                          45   3e-04
YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with simila...    44   3e-04
YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible R...    45   3e-04
Kwal_47.18572                                                          44   3e-04
Scas_376.1                                                             44   4e-04
CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces c...    44   4e-04
CAGL0H03861g complement(361189..362520) similar to sp|P38922 Sac...    44   4e-04
Scas_598.1                                                             44   6e-04
CAGL0H10604g complement(1033488..1034738) similar to sp|P32588 S...    43   7e-04
CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces c...    42   8e-04
Kwal_0.370                                                             43   0.001
Kwal_26.7522                                                           42   0.001
YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleola...    42   0.001
Scas_643.16                                                            43   0.001
Scas_671.4                                                             42   0.001
ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH] complement(...    41   0.001
Kwal_23.5864                                                           42   0.001
YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved i...    42   0.002
CAGL0H04763g 454589..455740 highly similar to sp|Q01560 Saccharo...    42   0.002
KLLA0A08338g 736461..738761 weakly similar to sp|P39684 Saccharo...    42   0.002
AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH] (1446842..1...    42   0.002
Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement       41   0.002
ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH] complement...    42   0.002
AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH] (736609..7...    41   0.003
ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH] complement...    41   0.003
YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component...    41   0.003
KLLA0E08745g 782800..784227 some similarities with sp|P32588 Sac...    41   0.004
CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces c...    41   0.004
YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in ...    39   0.004
KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces c...    41   0.004
Scas_697.10                                                            41   0.005
KLLA0D05016g complement(431592..432380) similar to sp|P25555 Sac...    40   0.006
CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces...    40   0.006
Scas_621.16                                                            40   0.006
Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement         40   0.006
Kwal_27.11447                                                          40   0.007
Kwal_27.10364                                                          40   0.007
KLLA0D13420g complement(1157491..1157991) some similarities with...    39   0.008
KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces c...    39   0.008
Kwal_56.24709                                                          40   0.008
KLLA0C05522g 494240..495862 some similarities with sp|P32831 Sac...    40   0.009
CAGL0F01023g complement(108155..109345) similar to tr|Q08208 Sac...    40   0.010
Kwal_33.13496                                                          39   0.012
ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH] (1024792..1...    39   0.013
AEL217W [2289] [Homologous to ScYGR250C - SH] complement(225217....    39   0.014
Sklu_1706.1 YFR023W, Contig c1706 1364-3382                            39   0.015
AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C (G...    39   0.015
YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of nu...    38   0.016
Scas_720.2                                                             38   0.020
AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH] complement(6...    39   0.022
CAGL0E03630g complement(335091..337331) weakly similar to sp|P38...    39   0.022
AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073...    38   0.027
Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement         38   0.028
YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA po...    38   0.030
CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces c...    38   0.034
AER285C [2787] [Homologous to ScYMR268C (PRP24) - SH] (1162117.....    38   0.040
Kwal_27.12337                                                          37   0.041
Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement         37   0.044
Kwal_55.20972                                                          36   0.044
AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH] complement(...    37   0.050
Kwal_14.1851                                                           37   0.050
Kwal_27.11096                                                          36   0.058
YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein wit...    37   0.064
ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH] (708437..70...    37   0.067
Scas_530.4                                                             37   0.074
CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces c...    36   0.075
KLLA0B00979g 77439..78467 some similarities with sp|Q01560 Sacch...    36   0.10 
Scas_714.59                                                            35   0.13 
Scas_709.2*                                                            35   0.15 
Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement       35   0.16 
KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4 A...    35   0.18 
Kwal_30.12890                                                          35   0.18 
Kwal_55.20903                                                          34   0.21 
Sklu_905.1 YMR268C, Contig c905 196-1743                               35   0.22 
CAGL0F08217g complement(814508..816544) similar to sp|P53316 Sac...    35   0.23 
Sklu_2085.2 YOR319W, Contig c2085 3158-3787                            34   0.24 
CAGL0J01914g complement(189309..189818) similar to sp|P40565 Sac...    34   0.24 
KLLA0C08019g complement(704199..705104) some similarities with s...    34   0.41 
Scas_665.4                                                             34   0.42 
YDR429C (TIF35) [1252] chr4 complement(1324465..1325289) Transla...    34   0.47 
Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement         34   0.53 
CAGL0H04675g complement(447256..448080) highly similar to sp|Q04...    33   0.63 
Kwal_55.20414                                                          33   0.69 
AGR057C [4367] [Homologous to ScYLR095C (IOC2) - SH] (821017..82...    34   0.71 
KLLA0B10472g complement(914512..915108) similar to sgd|S0006099 ...    33   0.74 
ACR235W [1282] [Homologous to ScYBL051C (PIN4) - SH] complement(...    33   0.75 
Scas_500.6                                                             33   0.85 
YHL024W (RIM4) [2262] chr8 (56646..58787) Protein required for s...    33   0.92 
CAGL0A03117g join(315979..316263,317561..317974) highly similar ...    33   0.96 
CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces c...    33   0.98 
KLLA0F18216g 1677731..1679857 some similarities with sp|P38741 S...    33   1.00 
CAGL0H02123g complement(188454..190121) similar to sp|Q00539 Sac...    33   1.1  
CAGL0J02200g complement(215042..215476) similar to sp|P40561 Sac...    32   1.2  
ADL126C [1615] [Homologous to ScYFR032C - SH] (469991..471391) [...    33   1.2  
KLLA0E00484g complement(45755..46483) similar to sp|P10080 Sacch...    32   1.4  
KLLA0C07194g 624694..625587 no similarity, hypothetical start          32   2.6  
Scas_696.32                                                            32   3.1  
YDR381W (YRA1) [1208] chr4 (1236546..1236830,1237597..1237992) P...    31   3.5  
YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein wi...    31   3.6  
YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated ...    31   4.5  
Kwal_55.21039                                                          30   4.6  
KLLA0F17413g complement(1594037..1595203) similar to sgd|S000402...    31   4.6  
ADL253C [1488] [Homologous to ScYNL059C (ARP5) - SH] (255552..25...    31   4.9  
Kwal_26.7414                                                           31   5.3  
AER349C [2850] [Homologous to NOHBY] (1278446..1279102) [657 bp,...    30   6.1  
Sklu_2391.1 YPL190C, Contig c2391 194-2479 reverse complement          31   6.2  
Kwal_33.14810                                                          30   7.7  
ADL371C [1370] [Homologous to ScYBR119W (MUD1) - SH] (55727..565...    30   8.4  
YMR268C (PRP24) [4222] chr13 complement(802887..804221) Pre-mRNA...    30   8.8  
Scas_632.7*                                                            30   9.2  
Kwal_56.23945                                                          30   9.9  

>YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein with
           similarity to Pab1p, Pub1p, Nsr1p, Nop4p and other
           RNA-binding proteins, contains multiple RNA-binding
           domains, is required for 35S rRNA processing [2664 bp,
           887 aa]
          Length = 887

 Score = 1693 bits (4385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 844/872 (96%), Positives = 844/872 (96%)

Query: 1   MSRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFG 60
           MSRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFG
Sbjct: 1   MSRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFG 60

Query: 61  FIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPRVPQPMKEKRREALKRFREKEE 120
           FIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPRVPQPMKEKRREALKRFREKEE
Sbjct: 61  FIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPRVPQPMKEKRREALKRFREKEE 120

Query: 121 KLLQEENRKKKKVDENKHSNIDDEIRKNKQLQEFMETMKPSSQVTSWEKVGIDKSIEDEK 180
           KLLQEENRKKKKVDENKHSNIDDEIRKNKQLQEFMETMKPSSQVTSWEKVGIDKSIEDEK
Sbjct: 121 KLLQEENRKKKKVDENKHSNIDDEIRKNKQLQEFMETMKPSSQVTSWEKVGIDKSIEDEK 180

Query: 181 LKREEEDSSVQGNSLLAHALALKEENNKDEAPNLVIENESDDEYSALNRNRDEDQEDAGE 240
           LKREEEDSSVQGNSLLAHALALKEENNKDEAPNLVIENESDDEYSALNRNRDEDQEDAGE
Sbjct: 181 LKREEEDSSVQGNSLLAHALALKEENNKDEAPNLVIENESDDEYSALNRNRDEDQEDAGE 240

Query: 241 EEKMISISNLKDTDIGLVNDDANSDEKENEKRRNLAQDEKVSDLDWFKQRRVRIKESEAE 300
           EEKMISISNLKDTDIGLVNDDANSDEKENEKRRNLAQDEKVSDLDWFKQRRVRIKESEAE
Sbjct: 241 EEKMISISNLKDTDIGLVNDDANSDEKENEKRRNLAQDEKVSDLDWFKQRRVRIKESEAE 300

Query: 301 TREKSSSYATEQNESLDTKKEEQPERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEED 360
           TREKSSSYATEQNESLDTKKEEQPERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEED
Sbjct: 301 TREKSSSYATEQNESLDTKKEEQPERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEED 360

Query: 361 FRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHILP 420
           FRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHILP
Sbjct: 361 FRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHILP 420

Query: 421 GEEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSWNSLYMNQDAVLGSVAAKLGLEK 480
           GEEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSWNSLYMNQDAVLGSVAAKLGLEK
Sbjct: 421 GEEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSWNSLYMNQDAVLGSVAAKLGLEK 480

Query: 481 SQLIDAENSSSAVKQALAEAHVIGDVRKYFESKGVDLTKFSQLKSTNQRDDKVILVKNFP 540
           SQLIDAENSSSAVKQALAEAHVIGDVRKYFESKGVDLTKFSQLKSTNQRDDKVILVKNFP
Sbjct: 481 SQLIDAENSSSAVKQALAEAHVIGDVRKYFESKGVDLTKFSQLKSTNQRDDKVILVKNFP 540

Query: 541 FGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFTKLSYKRFKDGIIYLE 600
           FGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFTKLSYKRFKDGIIYLE
Sbjct: 541 FGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFTKLSYKRFKDGIIYLE 600

Query: 601 RGPKDCFTKPAEADDLINNTSAKEEENPVEVKPSSNDLMEANKDVTEGSSNAHDEDVIDG 660
           RGPKDCFTKPAEADDLINNTSAKEEENPVEVKPSSNDLMEANKDVTEGSSNAHDEDVIDG
Sbjct: 601 RGPKDCFTKPAEADDLINNTSAKEEENPVEVKPSSNDLMEANKDVTEGSSNAHDEDVIDG 660

Query: 661 PTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKE 720
           PTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKE
Sbjct: 661 PTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKE 720

Query: 721 QANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVF 780
           QANAVIAAMDGTVIDGHKIQLKLSHRQASQS               VKNLPFEATRKDVF
Sbjct: 721 QANAVIAAMDGTVIDGHKIQLKLSHRQASQSGNTKTKSNKKSGKIIVKNLPFEATRKDVF 780

Query: 781 ELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQYXXX 840
           ELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQY   
Sbjct: 781 ELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQYAEE 840

Query: 841 XXXXXXXXXXRMTKKVRKQVATNEMAALRNGG 872
                     RMTKKVRKQVATNEMAALRNGG
Sbjct: 841 DAVDAEEEIARMTKKVRKQVATNEMAALRNGG 872

>Scas_705.22
          Length = 869

 Score = 1119 bits (2895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/890 (67%), Positives = 690/890 (77%), Gaps = 57/890 (6%)

Query: 1   MSRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFG 60
           MSRIIVKGLP +LTDDNL++HF KRL Q H ++ +N     LITDVKILR+R GESR+F 
Sbjct: 1   MSRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINS----LITDVKILRNREGESRKFA 56

Query: 61  FIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPRVPQPMKEKRREALKRFREKEE 120
           FIGY NEEDAFDAV YFNGS+INT+K+EVSMAKSFADPRVPQPMKE++REALKRFREKEE
Sbjct: 57  FIGYHNEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPRVPQPMKERKREALKRFREKEE 116

Query: 121 KLLQEENRKKKKVDEN-KHSNIDDEIRKNKQLQEFMETMKPSSQVTSWEKVGIDKSIEDE 179
           +LL E ++KK+KV E  +  +ID EI KNKQLQEF+ETMKPSSQV SWEK    K+ E  
Sbjct: 117 RLLAESDKKKQKVKEKERRLSIDAEISKNKQLQEFIETMKPSSQVPSWEKPVSHKNAE-- 174

Query: 180 KLKREEEDSSVQGNSLLAHALALKEENNKDEAPNLVIENESDDEYSALNRNRDEDQEDAG 239
                 ED+    N LLA        N  D+   L+ ENESDDEY+  N+    DQ+D  
Sbjct: 175 ------EDNEESSNPLLALL-----NNGDDDKKPLLKENESDDEYADFNK----DQKDEQ 219

Query: 240 EEEKMISISNLKDTDIGLVNDDANSDEKENEKRR---NLAQDEKVSDLDWFKQRRVRIKE 296
           E+E M+ +            DD N+ E   +K R   +LAQDEKVSDL+WFKQRRVRI+E
Sbjct: 220 EDEPMMKL------------DDLNTTETTEKKTREDDHLAQDEKVSDLNWFKQRRVRIRE 267

Query: 297 SEAETREKSSSYA---TEQNESLDTKKEEQPERAVPQK--------TDEELAIEKINQTG 345
            E+E  + SS      TE N SL    + + +    +K        T E++A+EKI++TG
Sbjct: 268 GESEAAKPSSLSKEGNTEGNASLKENTDSENKNDEEEKKEEQEPQQTPEDIAMEKISKTG 327

Query: 346 RLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVE 405
           RLFLRNILYT+ E+DFRKLF PFGELEEVHVALDTRTG+SKGFAY+LFKD K AV AY+E
Sbjct: 328 RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIE 387

Query: 406 LDKQIFQGRLLHILPGEEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSWNSLYMNQ 465
           LDKQIFQGRLLHILP + KKSHRLDEFDLKNMPLKKQ+ELK+K  ASRQTFSWNSLYMNQ
Sbjct: 388 LDKQIFQGRLLHILPADAKKSHRLDEFDLKNMPLKKQRELKKKDNASRQTFSWNSLYMNQ 447

Query: 466 DAVLGSVAAKLGLEKSQLIDAENSSSAVKQALAEAHVIGDVRKYFESKGVDLTKFSQLKS 525
           DAVLGSVAAKLGL+KS LID E+S+SAVKQALAEAH+IGDVRKYFESKGVDLTKF+Q KS
Sbjct: 448 DAVLGSVAAKLGLKKSDLIDPESSNSAVKQALAEAHIIGDVRKYFESKGVDLTKFAQTKS 507

Query: 526 TNQRDDKVILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFT 585
             QRD KVILVKNFP+GTTREE+GE+FLP+GKL+RLLMPP+GTIAIV++RDTTS R+AFT
Sbjct: 508 PEQRDAKVILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRDTTSGRSAFT 567

Query: 586 KLSYKRFKDGIIYLERGPKDCFTKPAEADDLINNTSAKEEENPVEVKPSSNDLMEANKDV 645
           KL++KRFKDGIIYLE+GPKDCFT+ AE  DLI   +   EEN VEVK +  ++M    D 
Sbjct: 568 KLAFKRFKDGIIYLEKGPKDCFTRDAEPADLIEADAP--EENVVEVKDTVKEIM----DS 621

Query: 646 TEGSSNA--HDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQ 703
           T+ +SN    DE V DGPTVSIFIKNLNF+TT+  L+ RFK F+GFVVAQVKTKPDPKH 
Sbjct: 622 TDKTSNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHA 681

Query: 704 GKTLSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQ-ASQSXXXXXXXXXXX 762
            KTLSMGFGF EFRTKEQANAVI+A+DGTVIDGH+IQLKLSHRQ +S +           
Sbjct: 682 DKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTSSAKGKKIKS 741

Query: 763 XXXXVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQ 822
               VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQ
Sbjct: 742 GKIIVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQ 801

Query: 823 LHGVHLLGRRLVMQYXXXXXXXXXXXXXRMTKKVRKQVATNEMAALRNGG 872
           L GVHLLGRRLVMQY             RMTKKV+KQV ++E+AALRN G
Sbjct: 802 LQGVHLLGRRLVMQYAQEEAADAEEEIARMTKKVKKQVVSSELAALRNSG 851

>CAGL0B04169g complement(404713..407298) highly similar to tr|Q06106
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 861

 Score = 1042 bits (2694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/885 (64%), Positives = 682/885 (77%), Gaps = 50/885 (5%)

Query: 1   MSRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFG 60
           MSR+IVKGLP+YLT+  L++HF KRL   H+   V+G    LITD++IL++R G+SRRF 
Sbjct: 1   MSRVIVKGLPIYLTEPELQKHFNKRLITTHATSNVDG----LITDLRILKNREGKSRRFA 56

Query: 61  FIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPRVPQPMKEKRREALKRFREKEE 120
           FIGY+NE+DA DAV YF+GSFI TSKIEV MAKSFADPRVP+ MKEK+REALKR REKEE
Sbjct: 57  FIGYKNEQDALDAVNYFDGSFIYTSKIEVDMAKSFADPRVPKSMKEKKREALKRLREKEE 116

Query: 121 KLLQEENRKKKKVDENKHSNIDDEIRKNKQLQEFMETMKPSSQVTSWEKVG----IDKSI 176
           KLL+E+N+K K  D     NID EI K+KQL+EF+ETMKPS+Q +SW+K+      +  +
Sbjct: 117 KLLEEKNKKLKVQDTKSKINIDAEIEKDKQLKEFIETMKPSAQTSSWDKITETAEPESGL 176

Query: 177 EDEKLKREEEDSSVQGNSLLAHALALKEENNKDEAPNLVIENESDDEYSALNRNRDE--D 234
            +E+   +EE S+V  N LL HAL++K+ +          EN+SDDEY + N N D    
Sbjct: 177 AEEQELDDEESSNV--NPLLKHALSMKKGD----------ENDSDDEYMSFN-NADSKAG 223

Query: 235 QEDAGEEEKMISISNLKDTDIGLVNDDANSDEKENEKRRNLAQDEKVSDLDWFKQRRVRI 294
            +++ EEEKMIS+S L      + N++++++ KE++    LA++E++SD+DW KQRRVRI
Sbjct: 224 SDESNEEEKMISLSELP-----VQNEESSAEPKEDD---GLAKNEEISDMDWIKQRRVRI 275

Query: 295 KESEAETREKSSSYATEQNESLDTKKEEQPERAVPQK------TDEELAIEKINQTGRLF 348
           +E+  +  E+   +AT    ++  K+ E+  +A P +       DEE AI KI +TGRLF
Sbjct: 276 RENGEKVGEE---FAT----NVQDKESEENSQATPAEELQEEIPDEEQAIAKIQKTGRLF 328

Query: 349 LRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDK 408
           LRNILY+S E+DF+KLFSP+GEL+EVHVA+DTRTG SKGFAYVLF   + AV AY+ELDK
Sbjct: 329 LRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDK 388

Query: 409 QIFQGRLLHILPGEEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSWNSLYMNQDAV 468
           QIFQGRLLHIL  +E K HRLDEFDLKNMPLKKQ+ELK+KAAAS+ TFSWNSLYMNQDAV
Sbjct: 389 QIFQGRLLHILAADEMKDHRLDEFDLKNMPLKKQRELKKKAAASKATFSWNSLYMNQDAV 448

Query: 469 LGSVAAKLGLEKSQLIDAENSSSAVKQALAEAHVIGDVRKYFESKGVDLTKFSQLKSTNQ 528
           LGSVAAKLG++K+ LID ENS+SAVKQALAEAHVIGDVRKYFE+KGVDLTKFS LKS +Q
Sbjct: 449 LGSVAAKLGVQKADLIDPENSNSAVKQALAEAHVIGDVRKYFETKGVDLTKFSNLKSPSQ 508

Query: 529 RDDKVILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFTKLS 588
           RDD+VILVKNFPFGTTREELGE+F+P+GKLERLLMPPAGTIAIVQFRD  S R+AF+KL+
Sbjct: 509 RDDRVILVKNFPFGTTREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSAFSKLA 568

Query: 589 YKRFKDGIIYLERGPKDCFTKPAEADDLINNTSAKEEENPVEVKPSSNDLMEANKDVTEG 648
           +KRFK  +IYLE+GPKDCFTK A  +D + +    EE++  E  PSS DL+E+       
Sbjct: 569 FKRFKGTVIYLEKGPKDCFTKAASNEDAMEHD---EEKSAKEAGPSSADLLESVSSKKTE 625

Query: 649 SSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLS 708
                DE V+DGPTVSIFIKNLNF TT+Q LTDRFKVF+GFVVAQVKTKPDPK + K LS
Sbjct: 626 DKEDEDEQVVDGPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLS 685

Query: 709 MGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVK 768
           MGFGFVEFRTKEQA AVI+AMDGTVIDGHKIQLKLSHRQ +                 VK
Sbjct: 686 MGFGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAG--SQEKKKAKNGKIIVK 743

Query: 769 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHL 828
           NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEF+LPKEAENAMDQL GVHL
Sbjct: 744 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHL 803

Query: 829 LGRRLVMQYXXXXXXXXXXXXXRMTKKVRKQVATNEMAAL-RNGG 872
           LGRRLVMQ              RMTKKVRKQ A +E+AA+ RN G
Sbjct: 804 LGRRLVMQPAEQEAANAEEELERMTKKVRKQAAVSEIAAMTRNAG 848

>KLLA0D14949g complement(1259860..1262496) similar to sgd|S0006316
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 878

 Score = 1024 bits (2647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/886 (61%), Positives = 667/886 (75%), Gaps = 39/886 (4%)

Query: 1   MSRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFG 60
           MSR+IVKGLP+YL +D LR+   KRL QKH    V       ++DVK++++R+GESRRF 
Sbjct: 1   MSRVIVKGLPIYLKEDRLRDLIEKRLTQKHQSTDVQS----YLSDVKLMKNRDGESRRFA 56

Query: 61  FIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPRVPQPMKEKRREALKRFREKEE 120
           FIG+R+EEDAFD V YFNG+F++TSKIEVSMAKSFADPRVPQPM+EKRREALKR RE+EE
Sbjct: 57  FIGFRDEEDAFDCVNYFNGTFVDTSKIEVSMAKSFADPRVPQPMREKRREALKRLREREE 116

Query: 121 KLLQEENRKKKKV------DENKHSNIDDEIRKNKQLQEFMETMKPSSQVTSWEKVGIDK 174
            LL ++   +KK       D  K  +ID EI KNKQLQEF+ TMKPSSQVTSWE V   K
Sbjct: 117 LLLADKKDSQKKQKSDSNNDGGKKHDIDAEIAKNKQLQEFINTMKPSSQVTSWETVQSSK 176

Query: 175 SIEDEKLKREEEDSSVQGNSLLAHALALK-EENNKDEAPNL--VIENESDDEYSALNRNR 231
           +  +++   ++E   +  N LL+ ALALK    + DE  ++  +  NESDDEY +LN   
Sbjct: 177 TQGEDEEAADDEVGEMSSNPLLSQALALKGNSRDADEDTDMFKLPGNESDDEYVSLNGGS 236

Query: 232 DEDQEDAGEEEKMISISNLKDTDIGLVNDDANSDEKENEKRRNLAQDEKVSDLDWFKQRR 291
           +    D  E + M+S+    DT      DD             +A+DE VSDLDW K RR
Sbjct: 237 NNANTDEPEPQ-MMSLDTF-DTAGPTSTDD-------------MAKDEAVSDLDWLKNRR 281

Query: 292 VRIKESEAETREKSSSYATEQNESLDTKKEEQPERAVPQKTDEELAIEKINQTGRLFLRN 351
           VRIK+       K       +      ++ E+ E    Q+++EE +++KI +TGRLFLRN
Sbjct: 282 VRIKDGADTPVSKQQQQPDTE-----QQQPEETEVETSQESEEEKSLKKIRETGRLFLRN 336

Query: 352 ILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIF 411
           ILYT+ E+DFRKLFSP+GELEEVH+A+DTRTGQSKGFAYVLFK++ NA  A+VELDKQIF
Sbjct: 337 ILYTATEDDFRKLFSPYGELEEVHIAVDTRTGQSKGFAYVLFKNADNAATAFVELDKQIF 396

Query: 412 QGRLLHILPGEEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSWNSLYMNQDAVLGS 471
           QGRLLHILP + KKSH+LDEFDLKN+PLKKQ+ELKRKA +++QTFSWNSLYMNQDAVL S
Sbjct: 397 QGRLLHILPADAKKSHKLDEFDLKNLPLKKQRELKRKANSAQQTFSWNSLYMNQDAVLSS 456

Query: 472 VAAKLGLEKSQLIDAENSSSAVKQALAEAHVIGDVRKYFESKGVDLTKFSQLKSTNQRDD 531
           VA KLG++KS+LIDAENSSSAVKQALAEA VIGDVRK+FE++GVDLTKF+QLK++ +RDD
Sbjct: 457 VADKLGMKKSELIDAENSSSAVKQALAEASVIGDVRKFFETRGVDLTKFAQLKNS-ERDD 515

Query: 532 KVILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFTKLSYKR 591
           +VILVKNFP+GTTREE+ E+FLP+GKL+RLL+PP+GTIAI+QFRD  +ARAAF+K+SYKR
Sbjct: 516 RVILVKNFPYGTTREEIAELFLPFGKLQRLLLPPSGTIAILQFRDVPAARAAFSKISYKR 575

Query: 592 FKDGIIYLERGPKDCFTKPAEADDLINNTSAKEEENPVEVKPSSNDLMEANK----DVTE 647
           FKDGIIYLE+GP DCFT+ A+ D+L+ + +  ++    E K S  DL+EA      D  +
Sbjct: 576 FKDGIIYLEKGPSDCFTRDAQGDELVESETDIQKATAKEAKISGADLLEAQSLPAADKDD 635

Query: 648 GSSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTL 707
              +  D+DV  GPTVSIFIKNLNFSTT+Q LT++FK F GFVVAQVKTKPDPK  GKTL
Sbjct: 636 HDDDDDDDDVQAGPTVSIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTL 695

Query: 708 SMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQA-SQSXXXXXXXXXXXXXXX 766
           SMGFGF EF+TKEQANAVI+AM+GT++DGHK+QLKLSHRQ  S +               
Sbjct: 696 SMGFGFAEFKTKEQANAVISAMEGTILDGHKLQLKLSHRQGTSTTNASSKKKKKNQGKII 755

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 826
           VKNLPFEATRKDVFELF+SFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQL GV
Sbjct: 756 VKNLPFEATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGV 815

Query: 827 HLLGRRLVMQYXXXXXXXXXXXXXRMTKKVRKQVATNEMAALRNGG 872
           HLLGRRLVM++             +MT+KV+KQV T ++A +RN G
Sbjct: 816 HLLGRRLVMEFVEQDPEDVEQQIEKMTRKVKKQVNTTKIANMRNSG 861

>Kwal_23.3985
          Length = 876

 Score = 1018 bits (2633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/887 (61%), Positives = 664/887 (74%), Gaps = 45/887 (5%)

Query: 1   MSRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFG 60
           MSR+IVKG+P YLT+D L++HF KRL   H  + ++ S    +TDVKIL++R GESRRF 
Sbjct: 1   MSRVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISES----LTDVKILKNRAGESRRFA 56

Query: 61  FIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPRVPQPMKEKRREALKRFREKEE 120
           F+G+++EEDAFDAV YF+ SFI+TSKIEVSMAKSFADPRVPQPM+EKRREALKR  E+EE
Sbjct: 57  FVGFKSEEDAFDAVNYFDQSFIDTSKIEVSMAKSFADPRVPQPMREKRREALKRLHEREE 116

Query: 121 KLLQEENRKKKKVDEN--KHSNIDDEIRKNKQLQEFMETMKPSSQVTSWEKVGIDKSIED 178
           +LL+++  KK++      KH N+D EI+ N QLQEF++TMKPS+QVTSW+ +G      +
Sbjct: 117 QLLEDKKAKKQQQQRGPAKH-NLDAEIKSNTQLQEFLDTMKPSAQVTSWDNLGGAVQAAN 175

Query: 179 EKLKREEEDSSVQGNSLLAHALALKEENNKDEAPNL-VIENESDDEYSALN-RNRDEDQE 236
           +       D+  QGNSLLA ALA+K     + + N  V ENESDDEY+ LN +  D   E
Sbjct: 176 DAQNTVSSDAP-QGNSLLAQALAMK---TGEPSGNFKVQENESDDEYTMLNNKANDGGNE 231

Query: 237 DAGEEEKMISISNLKDTDIGLVNDDANSDEKENEKRRNLAQDEKVSDLDWFKQRRVRIKE 296
           D GEEE+M+ +                 D+ E++ + N+AQDEKVSD +W KQ R+RIKE
Sbjct: 232 DGGEEEQMVKL-----------------DDFEDKTKENMAQDEKVSDFNWLKQHRIRIKE 274

Query: 297 SEAETREKSSSYATEQNESLDTKKE------EQPERAVPQK-----TDEELAIEKINQTG 345
           +   T        T + +S D ++E      E PE    Q+     T+EE  I+KI  TG
Sbjct: 275 NTEGTENTDPEGVTARPKS-DIREEDNVESTEDPESTEQQESKLDTTEEEKFIQKIEATG 333

Query: 346 RLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVE 405
           RLFLRNILYT+ E+DFRKLF+PFGELEEVHVALDTRTG+SKGFAYV+FK+  +A NAYVE
Sbjct: 334 RLFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVE 393

Query: 406 LDKQIFQGRLLHILPGEEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSWNSLYMNQ 465
           LDKQIFQGRLLHILPGE+KKSHRLDEFDLKN+PLKKQ+ LKRKA AS  TFSWNSLYMNQ
Sbjct: 394 LDKQIFQGRLLHILPGEQKKSHRLDEFDLKNLPLKKQRSLKRKANASHDTFSWNSLYMNQ 453

Query: 466 DAVLGSVAAKLGLEKSQLIDAENSSSAVKQALAEAHVIGDVRKYFESKGVDLTKFSQLKS 525
           DAVLGSVAAKLG++KS LIDA ++S+AVKQALAEAHVIGDVRKYFESKG+DLTKF Q KS
Sbjct: 454 DAVLGSVAAKLGVQKSDLIDATDASAAVKQALAEAHVIGDVRKYFESKGMDLTKFEQFKS 513

Query: 526 TNQRDDKVILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFT 585
            + RDD V+LVKNFPFGTT  EL ++FLP+GKL+RLL+PPA TIA+VQ+RD TSARAAF+
Sbjct: 514 PSDRDDTVLLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFS 573

Query: 586 KLSYKRFKDGIIYLERGPKDCFTKPAEADDLINNTSAKEEENPVEVKPSSNDLMEANKDV 645
           KLSYKRFKDGI+YLE+GPK+CF++  E D+ + +    +  N  E + + +++M+     
Sbjct: 574 KLSYKRFKDGILYLEKGPKNCFSREPEGDETMVDEIVAQSTNVKEARTTGDEIMQTA--T 631

Query: 646 TEGSSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGK 705
                +   +DV+DGPTVSIF+KNLNFSTT + LT++FK F GFVVAQVKTKPDPK+  K
Sbjct: 632 ASKPEDDGTDDVVDGPTVSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNK 691

Query: 706 TLSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXX 765
           TLSMGFGF EF+T+EQA AVI AMDG V+DGH+IQLKLSHRQ  QS              
Sbjct: 692 TLSMGFGFAEFKTREQALAVIDAMDGAVLDGHRIQLKLSHRQGGQS-SSSGKSKKGTGKI 750

Query: 766 XVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
            VKNLPFE  RK +FELF+SFGQLKSVR+PKKFDKSARGFAFVEFLLPKEAENAM+QL G
Sbjct: 751 IVKNLPFEVERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQG 810

Query: 826 VHLLGRRLVMQYXXXXXXXXXXXXXRMTKKVRKQVATNEMAALRNGG 872
           VHLLGRRLVMQ+             RMTKKVR QV T E AALRNGG
Sbjct: 811 VHLLGRRLVMQHAEEEPQDAEEQIARMTKKVRSQVTTREHAALRNGG 857

>ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH]
           (768392..770908) [2517 bp, 838 aa]
          Length = 838

 Score =  993 bits (2568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/876 (59%), Positives = 631/876 (72%), Gaps = 59/876 (6%)

Query: 1   MSRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGP-DLITDVKILRDRNGESRRF 59
           MSR+IVKGLP+YL +  LR HF KRL+Q+       G G  D ITDVKI++D++G SRRF
Sbjct: 1   MSRVIVKGLPIYLEEARLRAHFLKRLQQQ-------GRGSEDQITDVKIVKDKSGNSRRF 53

Query: 60  GFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPRVPQPMKEKRREALKRFREKE 119
            FIGYR+E+DAFDA+EYFNGSFI+T++IEV+MAKSFADPRVP PM+EKRREALKR RE+E
Sbjct: 54  AFIGYRSEQDAFDAIEYFNGSFIDTARIEVAMAKSFADPRVPTPMREKRREALKRLRERE 113

Query: 120 EKLLQEENRKKKKVDENKHSNIDDEIRKNKQLQEFMETMKPSSQVTSWEKVGIDKSIEDE 179
           +++L E+ +K+ K        ID EI KNKQLQEF+ETM P     +             
Sbjct: 114 DRILAEKRQKQTK----PQHGIDAEISKNKQLQEFIETMNPKMAAAAANP---------- 159

Query: 180 KLKREEEDSSVQGNSLLAHALALKEENNKDEAPNLVIENESDDEYSALNRNRDEDQEDAG 239
                  +     N LL+ AL   E++ + +   L  E ESDDEY+ L++     +ED  
Sbjct: 160 --MARAAEQPASANPLLS-ALHGAEDDEEVDMFQLS-EQESDDEYTDLHQRPQSAEEDEL 215

Query: 240 EEEKMISISNLKDTDIGLVNDDANSDEKENEKRRNLAQDEKVSDLDWFKQRRVRIKESEA 299
           EE                V  D ++    +     +A +++VSDL+W K RR+RI++ E 
Sbjct: 216 EEPA--------------VGQDLDAAPAPDAAEDGMATNQEVSDLEWLKNRRIRIRDGED 261

Query: 300 ETREKSSSYATEQNESLDTKKEEQPERAVPQK---TDEELAIEKINQTGRLFLRNILYTS 356
                +      +  +         E+ VPQ+   + EE A+ KI  TGRLFLRNILY +
Sbjct: 262 AEAAPAPQEQAAEEPA---------EQEVPQEDEVSAEEAALTKIRATGRLFLRNILYDA 312

Query: 357 KEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLL 416
            EEDF++LFSP+GELEEVHVA+DTRTGQSKGFAYVLFKD ++A NAY+ELDKQIFQGRLL
Sbjct: 313 TEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHAANAYIELDKQIFQGRLL 372

Query: 417 HILPGEEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSWNSLYMNQDAVLGSVAAKL 476
           HILP + KK+HRLDEFDLKN+PLKKQ+ELKRKA A++QTFSWNSL+MNQDAVL SVAAKL
Sbjct: 373 HILPADAKKTHRLDEFDLKNLPLKKQRELKRKATAAQQTFSWNSLFMNQDAVLSSVAAKL 432

Query: 477 GLEKSQLIDAENSSSAVKQALAEAHVIGDVRKYFESKGVDLTKFSQLKSTNQRDDKVILV 536
           G+EKSQLID ENS SAVKQALAEAHVIGDVRKYFE++GVDLT+F + K   +RDD++ILV
Sbjct: 433 GMEKSQLIDPENSGSAVKQALAEAHVIGDVRKYFEARGVDLTQFEKFKKVTERDDRIILV 492

Query: 537 KNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFTKLSYKRFKDGI 596
           KNFP GTTREEL E+FLP+GK+ER+LMPP+GTIAI+Q+RD  +AR AFTKLSYKRFK  I
Sbjct: 493 KNFPHGTTREELAELFLPFGKIERMLMPPSGTIAIIQYRDVPAARGAFTKLSYKRFKAPI 552

Query: 597 IYLERGPKDCFTKPAEADDLINNTSAKEEENPVEVKPSSNDLMEANKDVTEGSSNAHDED 656
           +YLE+GPKDCF++    D+L+   +A E+    E+K S  D+M+A+       + A    
Sbjct: 553 LYLEKGPKDCFSREPRGDELLEGDAAPEDVK--EIKKSVEDVMDADSKTPSSEATA---- 606

Query: 657 VIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEF 716
            IDGPTVSIF+KNLNFSTT+  L ++FK F+GFVVAQVKTKPDPK+  K LSMGFGF+EF
Sbjct: 607 -IDGPTVSIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEF 665

Query: 717 RTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFEATR 776
           RTKEQA AVIAAMDG VIDGHKIQLK+SH+Q+S                 VKNLPFEATR
Sbjct: 666 RTKEQAGAVIAAMDGAVIDGHKIQLKISHKQSSLPKTSKGSKKKISGKIIVKNLPFEATR 725

Query: 777 KDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQ 836
           KDVFELF+SFGQLKSVRVPKKFDKSARGFAFVEFLLP EAENAMDQL GVHLLGRRLVMQ
Sbjct: 726 KDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLLGRRLVMQ 785

Query: 837 YXXXXXXXXXXXXXRMTKKVRKQVATNEMAALRNGG 872
           Y             +MT K++KQ A ++M ALRN G
Sbjct: 786 YAEQESDDVEEQISKMTMKMKKQAAVSKMGALRNSG 821

>Scas_88.1
          Length = 256

 Score =  399 bits (1025), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 191/245 (77%), Positives = 220/245 (89%), Gaps = 2/245 (0%)

Query: 346 RLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVE 405
           RLF+  I    K  DF +LFSP+GELEEVHVALDTRTG+SKGFAY++FK+ +NAV+AY+E
Sbjct: 2   RLFVHFI--HCKGIDFXQLFSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIE 59

Query: 406 LDKQIFQGRLLHILPGEEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSWNSLYMNQ 465
           LDKQIFQGRLLHILP E KKSHRLDEFDLKN+PLKKQ+ELKRKA AS+QTFSWNSLYMNQ
Sbjct: 60  LDKQIFQGRLLHILPAEAKKSHRLDEFDLKNLPLKKQRELKRKANASQQTFSWNSLYMNQ 119

Query: 466 DAVLGSVAAKLGLEKSQLIDAENSSSAVKQALAEAHVIGDVRKYFESKGVDLTKFSQLKS 525
           DAVL SVA+KLG+EKS+LID  NS SAVKQALAEAHVIGDVRK+FES+GVDLTKF + KS
Sbjct: 120 DAVLSSVASKLGMEKSELIDPTNSGSAVKQALAEAHVIGDVRKFFESRGVDLTKFVEYKS 179

Query: 526 TNQRDDKVILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFT 585
            ++RD+ V+LVKNFPFGTT+EEL E+FLP+GKL+RLLMPPAGTIAIVQFRD T+ARAAFT
Sbjct: 180 PSERDECVMLVKNFPFGTTKEELAELFLPFGKLQRLLMPPAGTIAIVQFRDMTAARAAFT 239

Query: 586 KLSYK 590
           K+  K
Sbjct: 240 KIPTK 244

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 5/44 (11%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEF 810
           VKN PF  T++++ ELF  FG+L+ + +P      A   A V+F
Sbjct: 190 VKNFPFGTTKEELAELFLPFGKLQRLLMP-----PAGTIAIVQF 228

>CAGL0E03245g complement(299236..300513) similar to sp|P27476
           Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, start by
           similarity
          Length = 425

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 90/186 (48%), Gaps = 12/186 (6%)

Query: 659 DGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRT 718
           DG   ++F+  L++S  ++ L   F+   G V A+V  +     +G   S G+G+V+F  
Sbjct: 172 DGEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYE-----RGTDRSRGYGYVDFED 226

Query: 719 KEQANAVIAAMDGTVIDGHKIQLKLSHRQAS------QSXXXXXXXXXXXXXXXVKNLPF 772
           K  A   +  M G  IDG  I + +S  + +      +                + NL F
Sbjct: 227 KSYAEKAVKEMHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSF 286

Query: 773 EATRKDVFELFNSFGQLKSVRVPKKFD-KSARGFAFVEFLLPKEAENAMDQLHGVHLLGR 831
            A R +++E+F  FG++ SVR+P   + +  +GF +V++    +A+ A++ L G ++  R
Sbjct: 287 NADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDNR 346

Query: 832 RLVMQY 837
            + + Y
Sbjct: 347 PVRLDY 352

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 45/89 (50%), Gaps = 5/89 (5%)

Query: 656 DVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVE 715
           D+   P+ ++F+ NL+F+    N+ + F  F   +  ++ T P+ +        GFG+V+
Sbjct: 270 DIPSEPSDTLFLGNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQ-----PKGFGYVQ 324

Query: 716 FRTKEQANAVIAAMDGTVIDGHKIQLKLS 744
           + + + A   + A+ G  ID   ++L  S
Sbjct: 325 YTSIDDAKKALEALQGEYIDNRPVRLDYS 353

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFK---DSKNAVNA 402
           LFL N+ + +  ++  ++F  FGE+  V +     T Q KGF YV +    D+K A+ A
Sbjct: 279 LFLGNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEA 337

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 49/102 (48%), Gaps = 11/102 (10%)

Query: 317 DTKKEEQPERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHV 376
           D ++E  P++A   KTD E A         +F+  + ++  +E  ++ F   G +    V
Sbjct: 159 DEEEESSPKKA---KTDGEPAT--------VFVGRLSWSIDDEWLKQEFEHIGGVVAARV 207

Query: 377 ALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418
             +  T +S+G+ YV F+D   A  A  E+  +   GR +++
Sbjct: 208 MYERGTDRSRGYGYVDFEDKSYAEKAVKEMHGKEIDGRPINV 249

>KLLA0C11495g complement(990832..992169) some similarities with
           sp|P27476 Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, hypothetical
           start
          Length = 445

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 89/185 (48%), Gaps = 12/185 (6%)

Query: 660 GPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTK 719
           G   +IF+  L++S  ++ L   F+   G + A+V  +     +G   S G+G+V+F  K
Sbjct: 193 GEPATIFVGRLSWSIDDEWLKTEFEPIGGVISARVMYE-----RGTDRSRGYGYVDFEDK 247

Query: 720 EQANAVIAAMDGTVIDGHKIQLKLSHRQAS------QSXXXXXXXXXXXXXXXVKNLPFE 773
             A   I  M G  IDG  I   +S  + +      ++               + NL FE
Sbjct: 248 SYAEKAIKEMHGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFE 307

Query: 774 ATRKDVFELFNSFGQLKSVRVPKKFD-KSARGFAFVEFLLPKEAENAMDQLHGVHLLGRR 832
           A R +++E+F  +G++ SVR+P   + +  +GF +V++   ++A  A + L G ++  R 
Sbjct: 308 ADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGEYINNRP 367

Query: 833 LVMQY 837
           + + Y
Sbjct: 368 VRLDY 372

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 656 DVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVE 715
           DV   P+ ++F+ NL+F     NL + F  +   V  ++ T P+ +        GFG+V+
Sbjct: 290 DVPSEPSDTLFLGNLSFEADRDNLYEIFGKYGEIVSVRIPTHPETEQ-----PKGFGYVQ 344

Query: 716 FRTKEQANAVIAAMDGTVIDGHKIQLKLS 744
           + + E A      + G  I+   ++L  S
Sbjct: 345 YGSIEDATKAFEGLQGEYINNRPVRLDYS 373

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LFL N+ + +  ++  ++F  +GE+  V +     T Q KGF YV +   ++A  A+  L
Sbjct: 299 LFLGNLSFEADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGL 358

Query: 407 DKQIFQGRLLHI 418
             +    R + +
Sbjct: 359 QGEYINNRPVRL 370

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 47/100 (47%), Gaps = 4/100 (4%)

Query: 319 KKEEQPERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVAL 378
           K ++  E++  +K   ELA E       +F+  + ++  +E  +  F P G +    V  
Sbjct: 174 KADDDEEKSESKKPKTELAGEPAT----IFVGRLSWSIDDEWLKTEFEPIGGVISARVMY 229

Query: 379 DTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418
           +  T +S+G+ YV F+D   A  A  E+  +   GR ++ 
Sbjct: 230 ERGTDRSRGYGYVDFEDKSYAEKAIKEMHGKEIDGRPINC 269

>Scas_621.10
          Length = 415

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 92/185 (49%), Gaps = 11/185 (5%)

Query: 659 DGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRT 718
           +G   +IF+  L++S  ++ L   F+   G V A+V  +     +G   S G+G+V+F  
Sbjct: 158 EGEPATIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIME-----RGTDRSRGYGYVDFED 212

Query: 719 KEQANAVIAAMDGTVIDGHKIQLKLSHRQAS-----QSXXXXXXXXXXXXXXXVKNLPFE 773
           K  A   I  M G  IDG +I + +S  + +     ++               + NL F 
Sbjct: 213 KSYAEKAIKEMQGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFN 272

Query: 774 ATRKDVFELFNSFGQLKSVRVPKKFD-KSARGFAFVEFLLPKEAENAMDQLHGVHLLGRR 832
           A R  + ELF+ +G++ SVR+P   + +  +GF +V++   ++A+ A++ L G ++  R 
Sbjct: 273 ADRDAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRP 332

Query: 833 LVMQY 837
           + + Y
Sbjct: 333 VRLDY 337

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 43/89 (48%), Gaps = 5/89 (5%)

Query: 656 DVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVE 715
           DV   P+ ++F+ NL+F+     +++ F  +   +  ++ T P+ +        GFG+V+
Sbjct: 255 DVPSEPSETLFLGNLSFNADRDAISELFSKYGEIISVRIPTHPETEQP-----KGFGYVQ 309

Query: 716 FRTKEQANAVIAAMDGTVIDGHKIQLKLS 744
           +   E A   +  + G  ID   ++L  S
Sbjct: 310 YTNVEDAKKALEGLQGEYIDNRPVRLDYS 338

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LFL N+ + +  +   +LFS +GE+  V +     T Q KGF YV + + ++A  A   L
Sbjct: 264 LFLGNLSFNADRDAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGL 323

Query: 407 DKQIFQGRLLHI 418
             +    R + +
Sbjct: 324 QGEYIDNRPVRL 335

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 8/89 (8%)

Query: 330 QKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFA 389
           QKT+ E A         +F+  + ++  +E  +K F   G +    V ++  T +S+G+ 
Sbjct: 155 QKTEGEPAT--------IFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYG 206

Query: 390 YVLFKDSKNAVNAYVELDKQIFQGRLLHI 418
           YV F+D   A  A  E+  +   GR +++
Sbjct: 207 YVDFEDKSYAEKAIKEMQGKEIDGREINV 235

>YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar
           protein involved in processing 20S to 18S rRNA, has 2
           RNA recognition (RRM) domains and is member of GAR
           (glycine/arginine-rich repeats) family of proteins [1245
           bp, 414 aa]
          Length = 414

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 86/180 (47%), Gaps = 10/180 (5%)

Query: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722
            +IF+  L++S  ++ L   F+   G + A+V        +G   S G+G+V+F  K  A
Sbjct: 168 ATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIY-----ERGTDRSRGYGYVDFENKSYA 222

Query: 723 NAVIAAMDGTVIDGHKIQLKLSHRQAS----QSXXXXXXXXXXXXXXXVKNLPFEATRKD 778
              I  M G  IDG  I   +S  + +    ++               + NL F A R  
Sbjct: 223 EKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDA 282

Query: 779 VFELFNSFGQLKSVRVPKKFD-KSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQY 837
           +FELF   G++ SVR+P   + +  +GF +V+F   ++A+ A+D L G ++  R + + +
Sbjct: 283 IFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDF 342

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 5/89 (5%)

Query: 656 DVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVE 715
           D    P+ ++F+ NL+F+     + + F      V  ++ T P+ +        GFG+V+
Sbjct: 260 DTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQ-----PKGFGYVQ 314

Query: 716 FRTKEQANAVIAAMDGTVIDGHKIQLKLS 744
           F   E A   + A+ G  ID   ++L  S
Sbjct: 315 FSNMEDAKKALDALQGEYIDNRPVRLDFS 343

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LFL N+ + +  +   +LF+  GE+  V +     T Q KGF YV F + ++A  A   L
Sbjct: 269 LFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDAL 328

Query: 407 DKQIFQGRLLHI 418
             +    R + +
Sbjct: 329 QGEYIDNRPVRL 340

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 38/80 (47%)

Query: 339 EKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKN 398
           E+  +   +F+  + ++  +E  +K F   G +    V  +  T +S+G+ YV F++   
Sbjct: 162 EETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSY 221

Query: 399 AVNAYVELDKQIFQGRLLHI 418
           A  A  E+  +   GR ++ 
Sbjct: 222 AEKAIQEMQGKEIDGRPINC 241

>AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH]
           complement(628898..630088) [1191 bp, 396 aa]
          Length = 396

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 86/186 (46%), Gaps = 12/186 (6%)

Query: 659 DGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRT 718
           DG   +IF+  L++S  ++ L   F    G V A+V  +     +G   S G+G+V+F  
Sbjct: 163 DGQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYE-----RGTDKSRGYGYVDFED 217

Query: 719 KEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXX------VKNLPF 772
              A   +  M G  IDG  I   +S  + + +                     + NL F
Sbjct: 218 VSYAEKAVKEMHGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSF 277

Query: 773 EATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAENAMDQLHGVHLLGR 831
            A R  +FELF+  G + SVR+P   + +  +GF +V++   +EA+ A+D L G ++  R
Sbjct: 278 NADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDALQGEYIDNR 337

Query: 832 RLVMQY 837
            + + +
Sbjct: 338 PVRIDF 343

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 48/95 (50%), Gaps = 5/95 (5%)

Query: 656 DVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVE 715
           D    P+ ++F+ NL+F+     L + F      +  ++ T P+  +Q K    GFG+V+
Sbjct: 261 DTPSQPSDTLFLGNLSFNADRDALFELFSKHGNVISVRIPTHPE-SNQPK----GFGYVQ 315

Query: 716 FRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQ 750
           + + E+A A + A+ G  ID   +++  S  +  Q
Sbjct: 316 YGSVEEAQAALDALQGEYIDNRPVRIDFSSPRPPQ 350

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 32/72 (44%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LFL N+ + +  +   +LFS  G +  V +     + Q KGF YV +   + A  A   L
Sbjct: 270 LFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDAL 329

Query: 407 DKQIFQGRLLHI 418
             +    R + I
Sbjct: 330 QGEYIDNRPVRI 341

 Score = 33.5 bits (75), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 46/100 (46%), Gaps = 1/100 (1%)

Query: 320 KEEQPERAVPQKTDEELAIEKIN-QTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVAL 378
           KEE  +R+   + D     +K + Q   +F+  + ++  +E  +  F   G +    V  
Sbjct: 141 KEESKKRSAESEDDAVAKKQKTDGQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIY 200

Query: 379 DTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418
           +  T +S+G+ YV F+D   A  A  E+  +   GR ++ 
Sbjct: 201 ERGTDKSRGYGYVDFEDVSYAEKAVKEMHGKEIDGRAINC 240

>Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement
          Length = 421

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 88/187 (47%), Gaps = 12/187 (6%)

Query: 658 IDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFR 717
           + G   +IF+  L++S  ++ L   F    G V A+V  +     +G   S G+G+V+F 
Sbjct: 168 LTGEPATIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYE-----RGSDRSRGYGYVDFE 222

Query: 718 TKEQANAVIAAMDGTVIDGHKIQLKLSHRQAS------QSXXXXXXXXXXXXXXXVKNLP 771
            K  A   +  M G  IDG  I   +S  + +      ++               + NL 
Sbjct: 223 DKHYAEKAVKEMHGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLS 282

Query: 772 FEATRKDVFELFNSFGQLKSVRVPKKFD-KSARGFAFVEFLLPKEAENAMDQLHGVHLLG 830
           F A R ++FE+F+  G++ SVR+P   + +  +GF +V++    +A+ A + L G ++  
Sbjct: 283 FNADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDN 342

Query: 831 RRLVMQY 837
           R + + Y
Sbjct: 343 RPVRLDY 349

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 5/89 (5%)

Query: 656 DVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVE 715
           DV   P+ ++F+ NL+F+    NL + F      +  ++ T P+ +        GFG+V+
Sbjct: 267 DVPSQPSDTLFLGNLSFNADRDNLFEIFSQHGEVISVRIPTHPETEQ-----PKGFGYVQ 321

Query: 716 FRTKEQANAVIAAMDGTVIDGHKIQLKLS 744
           + + + A     A+ G  ID   ++L  S
Sbjct: 322 YGSIDDAKKAFEALQGEYIDNRPVRLDYS 350

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LFL N+ + +  ++  ++FS  GE+  V +     T Q KGF YV +    +A  A+  L
Sbjct: 276 LFLGNLSFNADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEAL 335

Query: 407 DKQIFQGRLLHI 418
             +    R + +
Sbjct: 336 QGEYIDNRPVRL 347

>YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding protein
           of cytoplasm and nucleus, part of the 3'-end
           RNA-processing complex (cleavage factor I), involved in
           translation termination with Sup35p, has 4 RNA
           recognition (RRM) domains [1734 bp, 577 aa]
          Length = 577

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 81/172 (47%), Gaps = 7/172 (4%)

Query: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723
           +IFIKNL+    N+ L D F VF   + +++ T  + K      S GFGFV F  +  A 
Sbjct: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGK------SKGFGFVHFEEEGAAK 180

Query: 724 AVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVFELF 783
             I A++G +++G +I +   H    +                VKN+  E T +   ELF
Sbjct: 181 EAIDALNGMLLNGQEIYVA-PHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELF 239

Query: 784 NSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVM 835
             FG + S  + K  D   +GF FV +   ++A  A++ L+   L G +L +
Sbjct: 240 AKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 82/182 (45%), Gaps = 15/182 (8%)

Query: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722
            ++++KN+N  TT++   + F  F   V A ++   D K +G      FGFV +   E A
Sbjct: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKG------FGFVNYEKHEDA 272

Query: 723 NAVIAAMDGTVIDGHKIQLKLSHRQ---------ASQSXXXXXXXXXXXXXXXVKNLPFE 773
              + A++ + ++G K+ +  + ++           ++               VKNL   
Sbjct: 273 VKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDS 332

Query: 774 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833
              + + E F  +G + S +V +  +  ++GF FV F  P+EA  A+ + +   + G+ L
Sbjct: 333 VDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392

Query: 834 VM 835
            +
Sbjct: 393 YV 394

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LF++N+  +  +E   + F+P+G +    V + T  G+SKGF +V F   + A  A  E 
Sbjct: 324 LFVKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFSTPEEATKAITEK 382

Query: 407 DKQIFQGRLLHILPGEEKKSHR 428
           ++QI  G+ L++   + K   R
Sbjct: 383 NQQIVAGKPLYVAIAQRKDVRR 404

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 41/87 (47%)

Query: 342 NQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVN 401
           N +  L++ ++  +  E     +FSP G +  + V  D  T  S G+AYV F D +    
Sbjct: 35  NSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRK 94

Query: 402 AYVELDKQIFQGRLLHILPGEEKKSHR 428
           A  +L+    +GRL  I+  +   S R
Sbjct: 95  AIEQLNYTPIKGRLCRIMWSQRDPSLR 121

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722
           V++F+KNL+ S  ++ L + F  +     A+V    + K      S GFGFV F T E+A
Sbjct: 322 VNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGK------SKGFGFVCFSTPEEA 375

Query: 723 NAVIAAMDGTVIDGHKIQLKLSHRQ 747
              I   +  ++ G  + + ++ R+
Sbjct: 376 TKAITEKNQQIVAGKPLYVAIAQRK 400

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 15/92 (16%)

Query: 2   SRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFGF 61
           + + VK +    TD+  +E F K              GP  I    + +D +G+ + FGF
Sbjct: 219 TNLYVKNINSETTDEQFQELFAK-------------FGP--IVSASLEKDADGKLKGFGF 263

Query: 62  IGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93
           + Y   EDA  AVE  N S +N  K+ V  A+
Sbjct: 264 VNYEKHEDAVKAVEALNDSELNGEKLYVGRAQ 295

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 344 TGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAY 403
           +G +F++N+      +     FS FG++    +A D   G+SKGF +V F++   A  A 
Sbjct: 125 SGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAI 183

Query: 404 VELDKQIFQGRLLHILP 420
             L+  +  G+ +++ P
Sbjct: 184 DALNGMLLNGQEIYVAP 200

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVS 90
           I   KI  D NG+S+ FGF+ +  E  A +A++  NG  +N  +I V+
Sbjct: 152 ILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVA 199

 Score = 36.6 bits (83), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%)

Query: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93
           IT  K++R  NG+S+ FGF+ +   E+A  A+   N   +    + V++A+
Sbjct: 348 ITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           V +L    +   ++++F+  G + S+RV +    K++ G+A+V F   +    A++QL+ 
Sbjct: 42  VGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNY 101

Query: 826 VHLLGR 831
             + GR
Sbjct: 102 TPIKGR 107

>CAGL0L11792g 1259275..1261014 highly similar to sp|P04147
           Saccharomyces cerevisiae YER165w PAB1 mRNA
           polyadenylate-binding protein, start by similarity
          Length = 579

 Score = 68.9 bits (167), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 83/172 (48%), Gaps = 7/172 (4%)

Query: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723
           +IFIKNL+    N+ L D F VF   + ++V T       GK  S GFG+V F   E A+
Sbjct: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATD----ETGK--SKGFGYVHFEEDESAS 177

Query: 724 AVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVFELF 783
             I A++G +++G +I +   H    +                +KN+  E T K+  EL 
Sbjct: 178 EAIDALNGMLLNGQEIYVG-PHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELV 236

Query: 784 NSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVM 835
             FG+  SV + +  +   +GF FV F+  ++A   +++L+     G+ L +
Sbjct: 237 AKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYV 288

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 95/429 (22%), Positives = 168/429 (39%), Gaps = 68/429 (15%)

Query: 332 TDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYV 391
           T+EE   E +  +  L++ ++  +  E     +FSP G +  + V  D  T  S G+AYV
Sbjct: 24  TNEENQSETV--SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYV 81

Query: 392 LFKDSKNAVNAYVELDKQIFQGRLLHILPGEEKKSHR---LDEFDLKNMPLKKQKELKRK 448
            F D   A  A  +L+    +G+L  I+  +   S R        +KN+      ++  K
Sbjct: 82  NFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNL----HPDIDNK 137

Query: 449 AAASRQTFSWNSLYMNQDAVLGSVAAKLGLEKSQLIDAENSSSAVKQALAEAHVIGD--- 505
           A     TFS     ++            G       + E++S A+  AL    + G    
Sbjct: 138 AL--YDTFSVFGNILSSKVATDETGKSKGFGYVHFEEDESASEAI-DALNGMLLNGQEIY 194

Query: 506 VRKYFESKGVDLTKFSQLKS--TNQRDDKVILVKNFPFGTTREELGEMFLPYGKLERLLM 563
           V  +   K  + +KF ++K+  TN      + +KN    TT +E  E+   +GK + +++
Sbjct: 195 VGPHLSKKERE-SKFEEMKANFTN------VYIKNINTETTDKEFEELVAKFGKTDSVVL 247

Query: 564 --PPAG---TIAIVQFRDTTSARAAFTKLSYKRFKDGIIYLERGPKDCFTKPAEADDLIN 618
              P G       V F +   A     +L+   FK   +Y+ R  K              
Sbjct: 248 ERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKK------------- 294

Query: 619 NTSAKEEENPVEVKPSSNDLMEANKDVTEGSSNAHDEDVIDGPTVSIFIKNLNFSTTNQN 678
                                E  +++ +       E +     +++FIKNL+ S  ++ 
Sbjct: 295 --------------------YERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKK 334

Query: 679 LTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANAVIAAMDGTVIDGHK 738
           L + F  +     A+V T  + K      S GFGFV F T E+A   I   +  ++ G  
Sbjct: 335 LEEEFAPYGTITSAKVMTTENGK------SKGFGFVCFSTPEEATKAITEKNQQIVAGKP 388

Query: 739 IQLKLSHRQ 747
           + + ++ R+
Sbjct: 389 LYVAIAQRK 397

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 87/193 (45%), Gaps = 15/193 (7%)

Query: 643 KDVTEGSSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKH 702
           +D  EG++  +  + +   + S+++ +L+ S +  +L D F       V+ ++   D   
Sbjct: 18  QDKQEGTNEENQSETV---SASLYVGDLDPSVSEAHLYDIFSPIG--AVSSIRVCRDAIT 72

Query: 703 QGKTLSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXX 762
           +    S+G+ +V F   + A   I  ++ T I G   ++  S R  S             
Sbjct: 73  K---TSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPS-------LRKKGA 122

Query: 763 XXXXVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQ 822
               +KNL  +   K +++ F+ FG + S +V       ++GF +V F   + A  A+D 
Sbjct: 123 GNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFEEDESASEAIDA 182

Query: 823 LHGVHLLGRRLVM 835
           L+G+ L G+ + +
Sbjct: 183 LNGMLLNGQEIYV 195

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LF++N+  +  ++   + F+P+G +    V + T  G+SKGF +V F   + A  A  E 
Sbjct: 321 LFIKNLDDSIDDKKLEEEFAPYGTITSAKV-MTTENGKSKGFGFVCFSTPEEATKAITEK 379

Query: 407 DKQIFQGRLLHILPGEEKKSHR 428
           ++QI  G+ L++   + K   R
Sbjct: 380 NQQIVAGKPLYVAIAQRKDVRR 401

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 76/182 (41%), Gaps = 15/182 (8%)

Query: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722
            +++IKN+N  TT++   +    F       ++  P+ +++G      FGFV F   E A
Sbjct: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKG------FGFVNFVNHEDA 269

Query: 723 NAVIAAMDGTVIDGHKIQLKLSHRQAS---------QSXXXXXXXXXXXXXXXVKNLPFE 773
              +  ++ T   G  + +  + ++           ++               +KNL   
Sbjct: 270 VKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDS 329

Query: 774 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833
              K + E F  +G + S +V    +  ++GF FV F  P+EA  A+ + +   + G+ L
Sbjct: 330 IDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389

Query: 834 VM 835
            +
Sbjct: 390 YV 391

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVS 90
           I   K+  D  G+S+ FG++ +  +E A +A++  NG  +N  +I V 
Sbjct: 149 ILSSKVATDETGKSKGFGYVHFEEDESASEAIDALNGMLLNGQEIYVG 196

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 28/51 (54%)

Query: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93
           IT  K++   NG+S+ FGF+ +   E+A  A+   N   +    + V++A+
Sbjct: 345 ITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 395

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 44  TDVKIL-RDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93
           TD  +L R   GE++ FGF+ + N EDA   VE  N +      + V+ A+
Sbjct: 242 TDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQ 292

>Scas_576.7
          Length = 575

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 80/165 (48%), Gaps = 7/165 (4%)

Query: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723
           +IFIKNL+    N+ L + F VF   + +++ T       GK  S GFGFV F  +  A 
Sbjct: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATD----ETGK--SKGFGFVHFEHESSAK 177

Query: 724 AVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVFELF 783
             I A++G +++G +I +   H    +                VKN+  E T ++  ELF
Sbjct: 178 EAIDALNGMLLNGQEIYVA-PHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELF 236

Query: 784 NSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHL 828
             +G + S  + K  D   +GF FV+F   ++A  A+++L+G   
Sbjct: 237 AKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEF 281

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 101/416 (24%), Positives = 158/416 (37%), Gaps = 70/416 (16%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           L++  +  T  E     +FSP G +  + V  D  T  S G+AYV F D +    A  +L
Sbjct: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96

Query: 407 DKQIFQGRLLHIL-----PGEEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSWNSL 461
           +    +GRL  I+     P   KK        +KN+      ++  KA      F   S+
Sbjct: 97  NYTPIKGRLCRIMWSQRDPALRKKGS--GNIFIKNL----HPDIDNKA-----LFETFSV 145

Query: 462 YMNQDAVLGSVAAKLGLEKSQ---LIDAENSSSAVKQAL--AEAHVIGDVRKYFESKGVD 516
           + N   +L S  A     KS+    +  E+ SSA K+A+      ++     Y       
Sbjct: 146 FGN---ILSSKIATDETGKSKGFGFVHFEHESSA-KEAIDALNGMLLNGQEIYVAPHLTR 201

Query: 517 LTKFSQLKSTNQRDDKVILVKNFPFGTTREELGEMFLPYG-----KLERLLMPPAGTIAI 571
             + SQL+ T      V  VKN    TT EE  E+F  YG      LE+           
Sbjct: 202 KERDSQLEETKAHFTNV-YVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGF 260

Query: 572 VQFRDTTSARAAFTKLSYKRFKDGIIYLERGPKDCFTKPAEADDLINNTSAKEEENPVEV 631
           V F     A  A  +L+   FKD  +++ R  K                           
Sbjct: 261 VDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKY------------------------- 295

Query: 632 KPSSNDLMEANKDVTEGSSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVV 691
                + M+  K   E S     E +     V++F+KNL+ S  ++ L + F  +     
Sbjct: 296 -----ERMQELKKQYEAS---RLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITS 347

Query: 692 AQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQ 747
            +V    + K      S GFGFV F T E+A   I   +  ++ G  + + ++ R+
Sbjct: 348 VRVMRTDNGK------SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 397

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LF++N+  +  +E  ++ F+P+G +  V V + T  G+SKGF +V F   + A  A  E 
Sbjct: 321 LFVKNLDDSIDDEKLKEEFAPYGTITSVRV-MRTDNGKSKGFGFVCFSTPEEATKAITEK 379

Query: 407 DKQIFQGRLLHILPGEEKKSHR 428
           ++QI  G+ L++   + K   R
Sbjct: 380 NQQIVAGKPLYVAIAQRKDVRR 401

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 80/182 (43%), Gaps = 15/182 (8%)

Query: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722
            ++++KN+N  TT++   + F  +   + + ++   D K +G      FGFV+F   E A
Sbjct: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKG------FGFVDFEKHEDA 269

Query: 723 NAVIAAMDGTVIDGHKIQLKLSHRQAS---------QSXXXXXXXXXXXXXXXVKNLPFE 773
              +  ++GT      + +  + ++           ++               VKNL   
Sbjct: 270 AKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDS 329

Query: 774 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833
              + + E F  +G + SVRV +  +  ++GF FV F  P+EA  A+ + +   + G+ L
Sbjct: 330 IDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389

Query: 834 VM 835
            +
Sbjct: 390 YV 391

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%)

Query: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVS 90
           I   KI  D  G+S+ FGF+ + +E  A +A++  NG  +N  +I V+
Sbjct: 149 ILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVA 196

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 15/90 (16%)

Query: 4   IIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFGFIG 63
           + VK L   + D+ L+E F           A  G+    IT V+++R  NG+S+ FGF+ 
Sbjct: 321 LFVKNLDDSIDDEKLKEEF-----------APYGT----ITSVRVMRTDNGKSKGFGFVC 365

Query: 64  YRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93
           +   E+A  A+   N   +    + V++A+
Sbjct: 366 FSTPEEATKAITEKNQQIVAGKPLYVAIAQ 395

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 779 VFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQY 837
           ++++F+  G + S+RV +    K++ G+A+V F   +  + A++QL+   + GR   + +
Sbjct: 51  LYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMW 110

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 52/117 (44%), Gaps = 18/117 (15%)

Query: 50  RDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPRVPQPMKEKRR 109
           +  +G+ + FGF+ +   EDA  AVE  NG+      + VS A             +K+ 
Sbjct: 249 KTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRA-------------QKKY 295

Query: 110 EALKRFREKEEKLLQEENRKKKKVDENKHSNIDDEIRKNKQLQEFMETMKPSSQVTS 166
           E ++  +++ E    E+  K + V+     N+DD I   K  +EF     P   +TS
Sbjct: 296 ERMQELKKQYEASRLEKMAKYQGVNLFV-KNLDDSIDDEKLKEEFA----PYGTITS 347

>AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH]
           (978634..980391) [1758 bp, 585 aa]
          Length = 585

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 83/172 (48%), Gaps = 7/172 (4%)

Query: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723
           +I+IKNL+ +  N++L + F  F   +  +V T  +       +S GFGFV F  +  A 
Sbjct: 127 NIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDEN------GVSRGFGFVHFENESDAR 180

Query: 724 AVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVFELF 783
             I A+DG +++  ++ + L H                     VKN+  E ++++  ELF
Sbjct: 181 DAIEAVDGMLMNDQEVYVAL-HVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELF 239

Query: 784 NSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVM 835
             +G++ S  + K  +   RGF FV F     A  A+D+L+ +   G++L +
Sbjct: 240 GKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYV 291

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 103/442 (23%), Positives = 170/442 (38%), Gaps = 79/442 (17%)

Query: 325 ERAVPQKTDEELAIEKINQTG-RLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTG 383
           E+  P  T+ E    K+  +G  L++  +  T  E     +FSP G +  + V  D  T 
Sbjct: 19  EQTAPTTTESETP--KVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITN 76

Query: 384 QSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHILPGEEKKSHR---LDEFDLKNM-PL 439
            S G+AYV F D +    A  +L+  + +G+   I+  +   S R        +KN+ P 
Sbjct: 77  TSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPA 136

Query: 440 KKQKELKRKAAASRQTFS--WNSLYMNQDAVLGSVAAKLGLEKSQLIDAENSSSAVKQAL 497
              K L        +TFS   N L          V+   G      +  EN S A + A+
Sbjct: 137 IDNKSL-------HETFSTFGNILSCKVATDENGVSRGFG-----FVHFENESDA-RDAI 183

Query: 498 --AEAHVIGDVRKYFE---SKGVDLTKFSQLKS--TNQRDDKVILVKNFPFGTTREELGE 550
              +  ++ D   Y     SK    +K  ++K+  TN      + VKN    T++EE  E
Sbjct: 184 EAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTN------VYVKNIDQETSQEEFEE 237

Query: 551 MFLPYGKLERLLMPPAG-----TIAIVQFRDTTSARAAFTKLSYKRFKDGIIYLERGPKD 605
           +F  YGK+   ++             V F D  +A  A  +L+   FK   +Y+ R  K 
Sbjct: 238 LFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKK 297

Query: 606 CFTKPAEADDLINNTSAKEEENPVEVKPSSNDLMEANKDVTEGSSNAHDEDVIDGPTVSI 665
                                             E  +++ +    A  E +     V++
Sbjct: 298 ---------------------------------YERLQELKKQYEAARLEKLAKYQGVNL 324

Query: 666 FIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANAV 725
           F+KNL+ S  ++ L + F  F     A+V             S GFGFV F T E+A   
Sbjct: 325 FVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGN------SRGFGFVCFSTPEEATKA 378

Query: 726 IAAMDGTVIDGHKIQLKLSHRQ 747
           I   +  ++ G  + + ++ R+
Sbjct: 379 ITEKNQQIVAGKPLYVAIAQRK 400

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 11/105 (10%)

Query: 1   MSRIIVKGLPVYLT----DDNLREHFTKRLRQKHSHQAVNG-------SGPDLITDVKIL 49
           ++  ++KG P  +     D +LR+  +  +  K+ H A++        S    I   K+ 
Sbjct: 99  LNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVA 158

Query: 50  RDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKS 94
            D NG SR FGF+ + NE DA DA+E  +G  +N  ++ V++  S
Sbjct: 159 TDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVS 203

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LF++N+  +  +E  ++ F+PFG +    V  D  TG S+GF +V F   + A  A  E 
Sbjct: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEK 382

Query: 407 DKQIFQGRLLHILPGEEKKSHR 428
           ++QI  G+ L++   + K+  R
Sbjct: 383 NQQIVAGKPLYVAIAQRKEVRR 404

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93
           IT  K++RD  G SR FGF+ +   E+A  A+   N   +    + V++A+
Sbjct: 348 ITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 77/182 (42%), Gaps = 15/182 (8%)

Query: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722
            ++++KN++  T+ +   + F  + G + + V  K     +GK    GFGFV F     A
Sbjct: 219 TNVYVKNIDQETSQEEFEELFGKY-GKITSAVLEK---DSEGKL--RGFGFVNFEDHAAA 272

Query: 723 NAVIAAMDGTVIDGHKIQLKLSHRQAS---------QSXXXXXXXXXXXXXXXVKNLPFE 773
              +  ++     G K+ +  + ++           ++               VKNL   
Sbjct: 273 AKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDS 332

Query: 774 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833
              + + E F  FG + S +V +    ++RGF FV F  P+EA  A+ + +   + G+ L
Sbjct: 333 IDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392

Query: 834 VM 835
            +
Sbjct: 393 YV 394

>Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement
          Length = 589

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 80/172 (46%), Gaps = 7/172 (4%)

Query: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723
           +IFIKNL+ +  N+ L D F VF   +  ++ T       G   S GFGFV F  +  A 
Sbjct: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD----EAGN--SKGFGFVHFEEEYSAK 182

Query: 724 AVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVFELF 783
             + A++G +++G ++ +   H                     VKN+  E T+++   LF
Sbjct: 183 EAVDAINGMLLNGQEVYVA-PHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALF 241

Query: 784 NSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVM 835
             FG++ S  + +  +   RGF F+ F   + A  A+D+L+      +RL +
Sbjct: 242 TQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYV 293

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 112/460 (24%), Positives = 176/460 (38%), Gaps = 88/460 (19%)

Query: 310 TEQNESLDTKKEEQPERAVPQKTDEELAIEKIN-QTGRLFLRNILYTSKEEDFRKLFSPF 368
            EQ E L    ++Q     P  T+ E A  K++  +  L++  +  T  E     LFSP 
Sbjct: 9   AEQLEQLKINDDQQ---TAPTSTESENA--KVDTSSASLYVGELDPTVTEALLYDLFSPI 63

Query: 369 GELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHILPGEEKKSHR 428
           G +  + V  D  T  S G+AYV F D      A  +L+    +GR   I+  +   S R
Sbjct: 64  GSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDPSLR 123

Query: 429 ---LDEFDLKNM-PLKKQKELKRKAAASRQTFS-WNSLYMNQDAV--------LGSVAAK 475
                   +KN+ P    K L         TFS + ++   + A          G V  +
Sbjct: 124 KKGSGNIFIKNLHPAIDNKAL-------HDTFSVFGNILSCKIATDEAGNSKGFGFVHFE 176

Query: 476 LGLEKSQLIDAENSSSAVKQALAEAHVIGDVRKYFESKGVDLTKFSQLKS--TNQRDDKV 533
                 + +DA N      Q   E +V   V     SK    +K  + KS  TN      
Sbjct: 177 EEYSAKEAVDAINGMLLNGQ---EVYVAPHV-----SKKDRQSKLEEAKSNFTN------ 222

Query: 534 ILVKNFPFGTTREELGEMFLPYGKLERLLM------PPAGTIAIVQFRDTTSARAAFTKL 587
           I VKN    TT+EE   +F  +GK+   ++       P G    + F D  SA  A  +L
Sbjct: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRG-FGFINFEDHESAAKAVDEL 281

Query: 588 SYKRFKDGIIYLERGPKDCFTKPAEADDLINNTSAKEEENPVEVKPSSNDLMEANKDVTE 647
           +   FK   +Y+ R  K                                   E  +++ +
Sbjct: 282 NDTDFKSQRLYVGRAQKK---------------------------------YERLQELRK 308

Query: 648 GSSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTL 707
               +  E +     V++F+KNL+ S  ++ L D F  F     A+V  + D  +     
Sbjct: 309 QYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKV-MRDDAGN----- 362

Query: 708 SMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQ 747
           S GFGFV F T E+A   I   +  ++ G  + + ++ R+
Sbjct: 363 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 402

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LF++N+  +  +E  R  F+PFG +    V  D   G SKGF +V F   + A  A  E 
Sbjct: 326 LFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFGFVCFSTPEEATKAITEK 384

Query: 407 DKQIFQGRLLHILPGEEKKSHR 428
           ++QI  G+ L++   + K   R
Sbjct: 385 NQQIVAGKPLYVAIAQRKDVRR 406

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 74/182 (40%), Gaps = 15/182 (8%)

Query: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722
            +I++KN++  TT +     F  F     A ++   + K +G      FGF+ F   E A
Sbjct: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRG------FGFINFEDHESA 274

Query: 723 NAVIAAMDGTVIDGHKIQLKLSH---------RQASQSXXXXXXXXXXXXXXXVKNLPFE 773
              +  ++ T     ++ +  +          R+  +                VKNL   
Sbjct: 275 AKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDS 334

Query: 774 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833
              + + + F  FG + S +V +    +++GF FV F  P+EA  A+ + +   + G+ L
Sbjct: 335 IDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 394

Query: 834 VM 835
            +
Sbjct: 395 YV 396

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 48/101 (47%), Gaps = 11/101 (10%)

Query: 1   MSRIIVKGLPVYLT----DDNLREHFTKRLRQKHSHQAV-NGSGPDL------ITDVKIL 49
           ++   +KG P  +     D +LR+  +  +  K+ H A+ N +  D       I   KI 
Sbjct: 101 LNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIA 160

Query: 50  RDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVS 90
            D  G S+ FGF+ +  E  A +AV+  NG  +N  ++ V+
Sbjct: 161 TDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVA 201

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%)

Query: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93
           IT  K++RD  G S+ FGF+ +   E+A  A+   N   +    + V++A+
Sbjct: 350 ITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 400

>YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similarity
           to Pes4p and Pab1p in the N-terminal region, contains
           four RNA recognition (RRM) domains [1980 bp, 659 aa]
          Length = 659

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 83/330 (25%), Positives = 146/330 (44%), Gaps = 22/330 (6%)

Query: 294 IKESEAETREKSSSYATE-QNESLDTKKEEQPERAVPQKTDEELAIEKINQTGRLFLRNI 352
           +K  +AE +EK+S    + +N + + K++EQ       K   +  I K ++T  LF+ N+
Sbjct: 59  VKLKDAEVKEKNSLKKYDCKNATQEKKEQEQVFEKTVAKGSVQKYITKTSKTNSLFIGNL 118

Query: 353 LYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQ 412
             T  EE  RK+F  +   E   V  D  T +S G+ Y+ FKD  +A +A  E +  +F 
Sbjct: 119 KSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEFNYTVFF 178

Query: 413 GRLLHILPGEEKKSHRLD---EFDLKNMPLKKQKELKRKAAASRQTF-SWNSLYMNQDAV 468
           G+ + I+P  +    R +        N+PL+  +   R        + +  S  + +   
Sbjct: 179 GQEVKIMPSMKNTLFRKNIGTNVFFSNLPLENPQLTTRSFYLIMIEYGNVLSCLLERRKN 238

Query: 469 LGSVAAKLGLEKSQLIDAENSSSAV-KQALAEAHVIGDVRKYFESK------GVDLTKFS 521
           +G V     +    +I   N+      + +   H   +VR   E        G D+    
Sbjct: 239 IGFVYFDNDISARNVIKKYNNQEFFGNKIICGLHFDKEVRTRPEFTKRKKMIGSDIVIED 298

Query: 522 QLKSTNQRDD----KVILVKNFPFGTTREELGEMFLPYGKLERLLMP--PAGTI--AIVQ 573
           +L ++N   D    K ILVKN P  TT+EE+ + F   G ++ + +    A T   A V 
Sbjct: 299 ELLASNNLSDNARSKTILVKNLPSDTTQEEVLDYFSTIGPIKSVFISEKQANTPHKAFVT 358

Query: 574 FRDTTSARAAFTKLSYKRFKDGIIYLERGP 603
           +++   ++ A   L+   FK+  I++  GP
Sbjct: 359 YKNEEESKKAQKCLNKTIFKNHTIWV--GP 386

 Score = 33.9 bits (76), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 57/122 (46%), Gaps = 11/122 (9%)

Query: 333 DEELAIEKINQTGR---LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFA 389
           DE LA   ++   R   + ++N+   + +E+    FS  G ++ V ++   +   +   A
Sbjct: 298 DELLASNNLSDNARSKTILVKNLPSDTTQEEVLDYFSTIGPIKSVFIS--EKQANTPHKA 355

Query: 390 YVLFKDSKNAVNAYVELDKQIFQGRLLHILPGEEKKSH------RLDEFDLKNMPLKKQK 443
           +V +K+ + +  A   L+K IF+   + + PG++K  H      +  +  LKN+     K
Sbjct: 356 FVTYKNEEESKKAQKCLNKTIFKNHTIWVGPGKDKPVHNQIGTNKKTKVYLKNLSFNCNK 415

Query: 444 EL 445
           E 
Sbjct: 416 EF 417

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 69/177 (38%), Gaps = 20/177 (11%)

Query: 662 TVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQ 721
           T S+FI NL  + T + L   FK +  F  A+V      K      S+G+G++ F+ K  
Sbjct: 110 TNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKK-----SLGYGYLNFKDKND 164

Query: 722 ANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFE---ATRKD 778
           A +     + TV  G ++++  S +                      NLP E    T + 
Sbjct: 165 AESARKEFNYTVFFGQEVKIMPSMKNT-------LFRKNIGTNVFFSNLPLENPQLTTRS 217

Query: 779 VFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVM 835
            + +   +G + S  + ++     +   FV F     A N + + +     G +++ 
Sbjct: 218 FYLIMIEYGNVLSCLLERR-----KNIGFVYFDNDISARNVIKKYNNQEFFGNKIIC 269

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLH 824
           VKNLP + T+++V + F++ G +KSV + +K   +    AFV +   +E++ A   L+
Sbjct: 317 VKNLPSDTTQEEVLDYFSTIGPIKSVFISEKQANTPHK-AFVTYKNEEESKKAQKCLN 373

>KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces
           cerevisiae YER165w PAB1 mRNA polyadenylate-binding
           protein, start by similarity
          Length = 592

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 78/162 (48%), Gaps = 7/162 (4%)

Query: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723
           +IFIKNL+ +  N+ L + F  F   +  +V    +        S GFGFV F+ +  A 
Sbjct: 139 NIFIKNLHPAIDNKALHETFSTFGEVLSCKVALDENGN------SRGFGFVHFKEESDAK 192

Query: 724 AVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVFELF 783
             I A++G +++G ++ + + H                     VKN+  E T ++  +LF
Sbjct: 193 DAIEAVNGMLMNGLEVYVAM-HVPKKDRISKLEEAKANFTNIYVKNIDVETTDEEFEQLF 251

Query: 784 NSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           + +G++ S  + K  +   +GF FV F+    A  A+++L+G
Sbjct: 252 SQYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELNG 293

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 96/424 (22%), Positives = 157/424 (37%), Gaps = 76/424 (17%)

Query: 342 NQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVN 401
           N    L++  +     E     +FSP G +  + V  D  T  S G+AYV + D +    
Sbjct: 47  NNNASLYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKK 106

Query: 402 AYVELDKQIFQGRLLHILPGEEKKSHR---LDEFDLKNM-PLKKQKELKRKAAASRQTFS 457
           A  EL+     GR   I+  E   + R        +KN+ P    K L        +TFS
Sbjct: 107 AIQELNYAEINGRPCRIMWSERDPAIRKKGSGNIFIKNLHPAIDNKAL-------HETFS 159

Query: 458 WNSLYMNQDAVLGSVAAKLGL------EKSQLIDAENSSSAVKQALAEAHVIGDVRKYFE 511
                ++    L       G       E+S   DA  + + +     E +V   V     
Sbjct: 160 TFGEVLSCKVALDENGNSRGFGFVHFKEESDAKDAIEAVNGMLMNGLEVYVAMHV----- 214

Query: 512 SKGVDLTKFSQLKS--TNQRDDKVILVKNFPFGTTREELGEMFLPYGKLERLLM------ 563
            K   ++K  + K+  TN      I VKN    TT EE  ++F  YG++    +      
Sbjct: 215 PKKDRISKLEEAKANFTN------IYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEG 268

Query: 564 PPAGTIAIVQFRDTTSARAAFTKLSYKRFKDGIIYLERGPKDCFTKPAEADDLINNTSAK 623
            P G    V F D  +A  A  +L+ K FK   +Y+ R  K                   
Sbjct: 269 KPKG-FGFVNFVDHNAAAKAVEELNGKEFKSQALYVGRAQKK------------------ 309

Query: 624 EEENPVEVKPSSNDLMEANKDVTEGSSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRF 683
                           E  +++ +       E +     V++FIKNL+ S  ++ L + F
Sbjct: 310 ---------------YERAEELKKQYEQYRLEKLAKFQGVNLFIKNLDDSIDDEKLKEEF 354

Query: 684 KVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKL 743
             +     A+V        +G   S GFGFV F + E+A   +   +  ++ G  + + +
Sbjct: 355 APYGTITSARVMR----DQEGN--SKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAI 408

Query: 744 SHRQ 747
           + R+
Sbjct: 409 AQRK 412

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 53/101 (52%), Gaps = 3/101 (2%)

Query: 330 QKTDEELAIEKIN--QTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKG 387
           +K  E+  +EK+   Q   LF++N+  +  +E  ++ F+P+G +    V  D + G SKG
Sbjct: 317 KKQYEQYRLEKLAKFQGVNLFIKNLDDSIDDEKLKEEFAPYGTITSARVMRD-QEGNSKG 375

Query: 388 FAYVLFKDSKNAVNAYVELDKQIFQGRLLHILPGEEKKSHR 428
           F +V F   + A  A  E ++QI  G+ L++   + K   R
Sbjct: 376 FGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQRKDVRR 416

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSM 91
           +   K+  D NG SR FGF+ ++ E DA DA+E  NG  +N  ++ V+M
Sbjct: 164 VLSCKVALDENGNSRGFGFVHFKEESDAKDAIEAVNGMLMNGLEVYVAM 212

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 58/123 (47%), Gaps = 7/123 (5%)

Query: 708 SMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXV 767
           S+G+ +V +   E     I  ++   I+G   ++  S R  +                 +
Sbjct: 90  SLGYAYVNYTDYEAGKKAIQELNYAEINGRPCRIMWSERDPA-------IRKKGSGNIFI 142

Query: 768 KNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVH 827
           KNL      K + E F++FG++ S +V    + ++RGF FV F    +A++A++ ++G+ 
Sbjct: 143 KNLHPAIDNKALHETFSTFGEVLSCKVALDENGNSRGFGFVHFKEESDAKDAIEAVNGML 202

Query: 828 LLG 830
           + G
Sbjct: 203 MNG 205

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 76/182 (41%), Gaps = 15/182 (8%)

Query: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722
            +I++KN++  TT++     F  +   V A ++   + K +G      FGFV F     A
Sbjct: 231 TNIYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEGKPKG------FGFVNFVDHNAA 284

Query: 723 NAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXX---------VKNLPFE 773
              +  ++G       + +  + ++  ++                        +KNL   
Sbjct: 285 AKAVEELNGKEFKSQALYVGRAQKKYERAEELKKQYEQYRLEKLAKFQGVNLFIKNLDDS 344

Query: 774 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833
              + + E F  +G + S RV +  + +++GF FV F  P+EA  AM + +   + G+ L
Sbjct: 345 IDDEKLKEEFAPYGTITSARVMRDQEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPL 404

Query: 834 VM 835
            +
Sbjct: 405 YV 406

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 30/51 (58%)

Query: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93
           IT  +++RD+ G S+ FGF+ + + E+A  A+   N   +    + V++A+
Sbjct: 360 ITSARVMRDQEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQ 410

>Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement
          Length = 464

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 82/209 (39%), Gaps = 37/209 (17%)

Query: 660 GPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTK 719
            P   +FI NL +S   Q L D FK     + A VK   D        S G+G V ++TK
Sbjct: 258 APGYEVFIANLPYSVNWQALKDMFKECGDVLRADVKLDRD------GYSRGYGVVYYKTK 311

Query: 720 EQANAVI-----AAMDGTVIDGHKIQL--------------------------KLSHRQA 748
           E+    I       ++G V+D H+ +L                          ++     
Sbjct: 312 EEVQVAIERYNGYELEGRVLDVHEGKLGPASEHQQQQEQFQPQDDEPVLDFAPQIHESLN 371

Query: 749 SQSXXXXXXXXXXXXXXXVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFV 808
           ++                V NLP+   + D+F+LF + G++    +   ++    G A V
Sbjct: 372 TEFTEMATGGGDQSSTIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVV 431

Query: 809 EFLLPKEAENAMDQLHGVHLLGRRLVMQY 837
           E+  P +AE  + +L+  +  GR L + Y
Sbjct: 432 EYDNPADAEVCISRLNSYNYGGRDLDISY 460

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/176 (21%), Positives = 69/176 (39%), Gaps = 13/176 (7%)

Query: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723
           SIF+ NL +    ++L + F      V A + T        +    G G VEF   +  +
Sbjct: 163 SIFVGNLTYDCQPEDLKEYFSQIGEVVRADIITS-------RGHHRGMGTVEFTNADDVD 215

Query: 724 AVIAAMDGTVIDGHKIQLKL------SHRQASQSXXXXXXXXXXXXXXXVKNLPFEATRK 777
             I   DG+ +   +I ++       S R   +                + NLP+    +
Sbjct: 216 EAIRRFDGSTLLDREIFVRQDNPPPESMRAPPRERRPRIQASAPGYEVFIANLPYSVNWQ 275

Query: 778 DVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833
            + ++F   G +    V    D  +RG+  V +   +E + A+++ +G  L GR L
Sbjct: 276 ALKDMFKECGDVLRADVKLDRDGYSRGYGVVYYKTKEEVQVAIERYNGYELEGRVL 331

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 38/77 (49%), Gaps = 7/77 (9%)

Query: 518 TKFSQLKSTNQRDDKVILVKNFPFGTTREELGEMFLPYGKLERLLM------PPAGTIAI 571
           T+F+++ +        I V N P+ T + +L ++F   GK+ R  +       P+G  A+
Sbjct: 372 TEFTEMATGGGDQSSTIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGA-AV 430

Query: 572 VQFRDTTSARAAFTKLS 588
           V++ +   A    ++L+
Sbjct: 431 VEYDNPADAEVCISRLN 447

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 8/76 (10%)

Query: 342 NQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNA-- 399
           N +  +F+ N+ Y  + ED ++ FS  GE+  V   + T  G  +G   V F ++ +   
Sbjct: 159 NYSNSIFVGNLTYDCQPEDLKEYFSQIGEV--VRADIITSRGHHRGMGTVEFTNADDVDE 216

Query: 400 ----VNAYVELDKQIF 411
                +    LD++IF
Sbjct: 217 AIRRFDGSTLLDREIF 232

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +F+ N+ Y+   +  + +F   G++    V LD R G S+G+  V +K  +    A    
Sbjct: 263 VFIANLPYSVNWQALKDMFKECGDVLRADVKLD-RDGYSRGYGVVYYKTKEEVQVAIERY 321

Query: 407 DKQIFQGRLLHILPG 421
           +    +GR+L +  G
Sbjct: 322 NGYELEGRVLDVHEG 336

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 2/42 (4%)

Query: 38  SGPDLITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNG 79
            G  L  DVK+  DR+G SR +G + Y+ +E+   A+E +NG
Sbjct: 284 CGDVLRADVKL--DRDGYSRGYGVVYYKTKEEVQVAIERYNG 323

>KLLA0F07799g complement(734889..736463) similar to sp|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, start by
           similarity
          Length = 524

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 61/131 (46%), Gaps = 19/131 (14%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +F+ N+ +   EE   K F P G++E V +  D++T   KGFAYV FKD ++   A +  
Sbjct: 361 VFVGNLDFEEVEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKALLLH 420

Query: 407 DKQIFQGRLLHILPGEEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSWNSLYMNQD 466
           +K+I +G          KK+ +L     KNM         RKA  ++ +   N L   Q 
Sbjct: 421 EKKIHEG----------KKARKLRISRCKNM---------RKAQGNQSSLQNNKLNDQQR 461

Query: 467 AVLGSVAAKLG 477
             LG     LG
Sbjct: 462 TKLGRAKKVLG 472

>Scas_637.2
          Length = 377

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 72/171 (42%), Gaps = 8/171 (4%)

Query: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723
            IFI NL+F  T ++L D F      V A+V +     ++G+  S G G VEF     A 
Sbjct: 79  GIFIGNLSFDATEEDLRDFFSQVGEVVNAEVMS-----YRGR--SKGMGTVEFTNPADAE 131

Query: 724 AVIAAMDGTVIDGHKIQLKLSHRQ-ASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVFEL 782
             I   +G    G  I +K       S+                V NLP+  T +++ ++
Sbjct: 132 EAIRQYNGVPFMGRDIFVKQDQPPPGSRQEFKSSEPTQQGYEAFVVNLPYSITWQNLKDI 191

Query: 783 FNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833
           F   G +    V   ++  +RGF  V +   ++   A+D  +G  L GR L
Sbjct: 192 FRECGDVIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRIL 242

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 826
           + NL F+AT +D+ + F+  G++ +  V   +   ++G   VEF  P +AE A+ Q +GV
Sbjct: 82  IGNLSFDATEEDLRDFFSQVGEVVNAEV-MSYRGRSKGMGTVEFTNPADAEEAIRQYNGV 140

Query: 827 HLLGRRLVMQ 836
             +GR + ++
Sbjct: 141 PFMGRDIFVK 150

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 75/205 (36%), Gaps = 39/205 (19%)

Query: 666 FIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANAV 725
           F+ NL +S T QNL D F+     + A V+      + G   S GFG V +  +E     
Sbjct: 175 FVVNLPYSITWQNLKDIFRECGDVIRADVELD----YNG--YSRGFGSVIYANEEDMFKA 228

Query: 726 IAAMDGTVIDGHKIQLK---------------------------------LSHRQASQSX 752
           I + +G  ++G  ++++                                 L         
Sbjct: 229 IDSFNGAELEGRILEVREGKFNHPRDTFDDRRDFDDRRDFDDVPKEEEPVLPPAHNPSFT 288

Query: 753 XXXXXXXXXXXXXXVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLL 812
                           NLP   T  D+++LF S G++    +      ++ G A VE+  
Sbjct: 289 EGVSGDGERNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYDETGTSTGAAVVEYAS 348

Query: 813 PKEAENAMDQLHGVHLLGRRLVMQY 837
              A+  +++L+G +  GR L + Y
Sbjct: 349 QDAADVCINKLNGYNYGGRDLHITY 373

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 45/84 (53%), Gaps = 3/84 (3%)

Query: 335 ELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFK 394
           E  +EK ++ G +F+ N+ + + EED R  FS  GE+  V+  + +  G+SKG   V F 
Sbjct: 69  ESGVEKHHENG-IFIGNLSFDATEEDLRDFFSQVGEV--VNAEVMSYRGRSKGMGTVEFT 125

Query: 395 DSKNAVNAYVELDKQIFQGRLLHI 418
           +  +A  A  + +   F GR + +
Sbjct: 126 NPADAEEAIRQYNGVPFMGRDIFV 149

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 43/89 (48%), Gaps = 15/89 (16%)

Query: 5   IVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFGFIGY 64
            V  LP  +T  NL++ F +              G  +  DV++  D NG SR FG + Y
Sbjct: 175 FVVNLPYSITWQNLKDIFRE-------------CGDVIRADVEL--DYNGYSRGFGSVIY 219

Query: 65  RNEEDAFDAVEYFNGSFINTSKIEVSMAK 93
            NEED F A++ FNG+ +    +EV   K
Sbjct: 220 ANEEDMFKAIDSFNGAELEGRILEVREGK 248

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 47/102 (46%), Gaps = 4/102 (3%)

Query: 320 KEEQPERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALD 379
           K++QP    P    E  + E   Q    F+ N+ Y+   ++ + +F   G++    V LD
Sbjct: 150 KQDQPP---PGSRQEFKSSEPTQQGYEAFVVNLPYSITWQNLKDIFRECGDVIRADVELD 206

Query: 380 TRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHILPG 421
              G S+GF  V++ + ++   A    +    +GR+L +  G
Sbjct: 207 Y-NGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRILEVREG 247

>CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 380

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 92/208 (44%), Gaps = 27/208 (12%)

Query: 649 SSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVK------------- 695
           S+   +  V D     ++I NL+F TT +++T        F+V + K             
Sbjct: 99  SAKESESSVKDSRKNGVWIGNLSFDTTKEDITR-------FIVGKTKGTDVEITEEDLVR 151

Query: 696 -TKPDPKHQGKTL-SMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHR---QASQ 750
              P  K+ GK + + GF +V+F+T+EQ  A I  +  + ++G  + +K S     +  +
Sbjct: 152 VNMPLAKNDGKQIKNKGFCYVDFKTQEQVEAAIK-LSESQLNGRNLLIKNSKSYEGRPDK 210

Query: 751 SXXXXXXXXXXXXXXXVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVE 809
           +               V NL F+ T + + + F   G++  +R+    D    +GFAFV+
Sbjct: 211 TDLVSMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVD 270

Query: 810 FLLPKEAENAMDQLHGVHLLGRRLVMQY 837
           F   + A NA+       + GR L M++
Sbjct: 271 FKNEEGATNALKDKSCRKIAGRPLRMEF 298

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 54/96 (56%), Gaps = 1/96 (1%)

Query: 329 PQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGF 388
           P KTD  +++ K   +  LF+ N+ + + +E  RK F   GE+ ++ +A    +G+ KGF
Sbjct: 208 PDKTDL-VSMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGF 266

Query: 389 AYVLFKDSKNAVNAYVELDKQIFQGRLLHILPGEEK 424
           A+V FK+ + A NA  +   +   GR L +  GE++
Sbjct: 267 AFVDFKNEEGATNALKDKSCRKIAGRPLRMEFGEDR 302

>Sklu_1790.3 YOL041C, Contig c1790 1701-3122
          Length = 473

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 1/73 (1%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +F+ N+ +   EE+  K FSP GE+E + +  D++T   KGFAYV FKD ++   A +  
Sbjct: 309 VFIGNLDFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKALLLN 368

Query: 407 DKQI-FQGRLLHI 418
           +K+I   GR L +
Sbjct: 369 EKKINGNGRKLRV 381

>AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W
           (MIP6) - SH] (605004..607040) [2037 bp, 678 aa]
          Length = 678

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 80/186 (43%), Gaps = 26/186 (13%)

Query: 659 DGPT------VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFG 712
           D PT      V++FI +L+   T +NL D F  F  FV A++    + K      S+G+G
Sbjct: 106 DSPTLTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKK-----SLGYG 160

Query: 713 FVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPF 772
           ++ F  +E A  VI   +   I G ++++  S R +                    NLP 
Sbjct: 161 YLNFSNEEDAERVIEEFNYIPIFGREVRIMPSLRNS-------FYRKNIGTNVFFSNLPL 213

Query: 773 E---ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLL 829
           E    T +  ++ F  FG++ S ++ ++     +   FV F     A+ A+ + +G    
Sbjct: 214 ENLALTTRVFYDAFKKFGKILSCKLDRR-----KNIGFVYFEKDSAAKQAIAEYNGKEFF 268

Query: 830 GRRLVM 835
           G  ++ 
Sbjct: 269 GNNILC 274

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 826
           +KNLP       + + F+  G +KS+       K +  +AF+ F    +A++A+D L+  
Sbjct: 329 IKNLPLNPDSDLLLDYFSQIGPVKSI-FTSNVSKLSSAWAFITFQKGSDAQDAIDNLNHS 387

Query: 827 HLLGRRL 833
            LLGR +
Sbjct: 388 QLLGRPI 394

>YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein
           involved in mRNA export, binds poly(A)+ RNA and
           single-stranded G-strand telomere sequence, has three
           RNA recognition (RRM) domains [1284 bp, 427 aa]
          Length = 427

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 68/174 (39%), Gaps = 11/174 (6%)

Query: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723
           SIF++NL F  T ++L + F      V A + T        K    G G VEF   E   
Sbjct: 123 SIFVRNLTFDCTPEDLKELFGTVGEVVEADIITS-------KGHHRGMGTVEFTKNESVQ 175

Query: 724 AVIAAMDGTVIDGHKIQLKLSHRQASQ----SXXXXXXXXXXXXXXXVKNLPFEATRKDV 779
             I+  DG +    K+ ++  +         S               + NLP+    + +
Sbjct: 176 DAISKFDGALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSL 235

Query: 780 FELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833
            ++F   G +    V   F+  +RGF  V +    E   A+D  +G+ + GR L
Sbjct: 236 KDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVL 289

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 72/356 (20%), Positives = 133/356 (37%), Gaps = 84/356 (23%)

Query: 522 QLKSTNQRDDKVILVKNFPFGTTREELGEMFLPYGKL-ERLLMPPAG---TIAIVQFRDT 577
           Q  +T +  +  I V+N  F  T E+L E+F   G++ E  ++   G    +  V+F   
Sbjct: 112 QFDATKRNFENSIFVRNLTFDCTPEDLKELFGTVGEVVEADIITSKGHHRGMGTVEFTKN 171

Query: 578 TSARAAFTKLSYKRFKDGIIYLERGPKDCFTKPAEADDLINNTSAKEEENPVEVKPSSND 637
            S + A +K       DG ++++R                     +++  P E       
Sbjct: 172 ESVQDAISKF------DGALFMDR-----------------KLMVRQDNPPPEA------ 202

Query: 638 LMEANKDVTEGSSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTK 697
                    E S  A  E++ +G    +FI NL +S   Q+L D FK   G V+     +
Sbjct: 203 -------AKEFSKKATREEIDNG--FEVFIINLPYSMNWQSLKDMFKE-CGHVL-----R 247

Query: 698 PDPKHQGKTLSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLK------------LSH 745
            D +      S GFG V + T+++    I   +G  ++G  ++++             + 
Sbjct: 248 ADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRFNKRKNNDRYNQ 307

Query: 746 RQ------------------------ASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVFE 781
           R+                        A++                  NLPF   R D+F+
Sbjct: 308 RREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNCFIYCSNLPFSTARSDLFD 367

Query: 782 LFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQY 837
           LF   G++ +  +  + +    G A VE+    +A+  + +L+  +  G  L + Y
Sbjct: 368 LFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLNNYNYGGCSLQISY 423

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 45/255 (17%), Positives = 89/255 (34%), Gaps = 62/255 (24%)

Query: 339 EKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKN 398
           E+I+    +F+ N+ Y+   +  + +F   G +    V LD   G S+GF  V++     
Sbjct: 213 EEIDNGFEVFIINLPYSMNWQSLKDMFKECGHVLRADVELDF-NGFSRGFGSVIYPTEDE 271

Query: 399 AVNAYVELDKQIFQGRLLHILPGEEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSW 458
            + A    +    +GR+L +  G   K    D ++ +   L+  +               
Sbjct: 272 MIRAIDTFNGMEVEGRVLEVREGRFNKRKNNDRYNQRREDLEDTR--------------- 316

Query: 459 NSLYMNQDAVLGSVAAKLGLEKSQLIDAENSSSAVKQALAEAHVIGDVRKYFESKGVDLT 518
                           + GL +   +  + +++   + +              + G D  
Sbjct: 317 --------------GTEPGLAQDAAVHIDETAAKFTEGV--------------NPGGDRN 348

Query: 519 KFSQLKSTNQRDDKVILVKNFPFGTTREELGEMFLPYGKLERLLMPP-----AGTIAIVQ 573
            F             I   N PF T R +L ++F P GK+    + P        +A+V+
Sbjct: 349 CF-------------IYCSNLPFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVE 395

Query: 574 FRDTTSARAAFTKLS 588
           + +   A     KL+
Sbjct: 396 YENLVDADFCIQKLN 410

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 46/104 (44%), Gaps = 16/104 (15%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +F+RN+ +    ED ++LF   GE+ E  +   T  G  +G   V F  +++  +A  + 
Sbjct: 124 IFVRNLTFDCTPEDLKELFGTVGEVVEADII--TSKGHHRGMGTVEFTKNESVQDAISKF 181

Query: 407 DKQIFQGRLLHILPGEEKKSHRLDEFDLKNMPLKKQKELKRKAA 450
           D  +F  R L +         R D     N P +  KE  +KA 
Sbjct: 182 DGALFMDRKLMV---------RQD-----NPPPEAAKEFSKKAT 211

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 4/88 (4%)

Query: 38  SGPDLITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFAD 97
            G  L  DV++  D NG SR FG + Y  E++   A++ FNG  +    +EV   +   +
Sbjct: 242 CGHVLRADVEL--DFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGR--FN 297

Query: 98  PRVPQPMKEKRREALKRFREKEEKLLQE 125
            R       +RRE L+  R  E  L Q+
Sbjct: 298 KRKNNDRYNQRREDLEDTRGTEPGLAQD 325

>Scas_635.7
          Length = 581

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 60/110 (54%), Gaps = 19/110 (17%)

Query: 324 PERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTG 383
           P+R++P+        E+ ++TG++F+  I    + ++F   F+ +G + +  + LD  TG
Sbjct: 267 PKRSIPR--------EEQDKTGKIFVGGIGTDVRPKEFEDFFAQYGTIIDAQLMLDKDTG 318

Query: 384 QSKGFAYVLFKDSKNAV-----NAYVELDKQIFQGRLLHILPGEEKKSHR 428
           +S+GF +V + DS +AV     N Y+E     F+G+ + I   E + + R
Sbjct: 319 RSRGFGFVTY-DSGDAVDRVCQNKYIE-----FKGKQIEIKRAEPRHNQR 362

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 50/89 (56%), Gaps = 8/89 (8%)

Query: 328 VPQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKG 387
           VP K D    I K N   ++F+  + + + E+  +  FS +G + E+ +  D  TG+S+G
Sbjct: 185 VPVKAD----ISKDNC--KMFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRG 238

Query: 388 FAYVLFKDSKNAVNAYVELDKQIFQGRLL 416
           F ++ F++  ++V+  V+  + I  G+++
Sbjct: 239 FGFLTFEN-PSSVDEVVKT-QHILDGKVI 265

>CAGL0M03795g complement(428607..430148) highly similar to sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 513

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 54/95 (56%), Gaps = 9/95 (9%)

Query: 324 PERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTG 383
           P+RA+P+        E+ ++TG++F+  +    + ++F + FS +G + +  + LD  TG
Sbjct: 201 PKRAIPR--------EEQDKTGKIFVGGLGTDVRPKEFEEYFSQWGTIIDAQLMLDKDTG 252

Query: 384 QSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418
           +S+GF +V + DS +A     E   + F+G+ + I
Sbjct: 253 RSRGFGFVTY-DSPDAAEKVCESRYREFKGKQIEI 286

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 65/115 (56%), Gaps = 9/115 (7%)

Query: 313 NESLDTKKEEQPERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELE 372
           N++ ++++ E  E A  ++   +L+ E      ++F+  + + + E+  R+ FS +G + 
Sbjct: 102 NQTQNSEQRESIEEANRRQVKADLSRENC----KMFIGGLNWETTEDGLREYFSKYGNVV 157

Query: 373 EVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLL---HILPGEEK 424
           E+ +  D  TG+S+GF ++ F D+ ++V+  V+  + I  G+++     +P EE+
Sbjct: 158 ELKIMKDPNTGRSRGFGFLSF-DAPSSVDEVVKT-QHILDGKVIDPKRAIPREEQ 210

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 62/161 (38%), Gaps = 27/161 (16%)

Query: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722
             +FI  LN+ TT   L + F  +   V  ++   P+        S GFGF+ F      
Sbjct: 130 CKMFIGGLNWETTEDGLREYFSKYGNVVELKIMKDPN-----TGRSRGFGFLSFDAPSSV 184

Query: 723 NAVIAA---MDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFEATRKDV 779
           + V+     +DG VID  +   +    +  +                V  L  +   K+ 
Sbjct: 185 DEVVKTQHILDGKVIDPKRAIPREEQDKTGK--------------IFVGGLGTDVRPKEF 230

Query: 780 FELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFLLPKEAE 817
            E F+ +G +   ++    DK    +RGF FV +  P  AE
Sbjct: 231 EEYFSQWGTIIDAQL--MLDKDTGRSRGFGFVTYDSPDAAE 269

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 16/64 (25%)

Query: 2   SRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRN-GESRRFG 60
            ++ + GL    T+D LRE+F+K                  + ++KI++D N G SR FG
Sbjct: 130 CKMFIGGLNWETTEDGLREYFSKYGN---------------VVELKIMKDPNTGRSRGFG 174

Query: 61  FIGY 64
           F+ +
Sbjct: 175 FLSF 178

>CAGL0E01947g 193225..194583 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 452

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 55/95 (57%), Gaps = 9/95 (9%)

Query: 324 PERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTG 383
           P+RA+P+        E+ ++TG++F+  I    + ++F + F+ +G + +  + LD  TG
Sbjct: 193 PKRAIPR--------EEQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQLMLDKDTG 244

Query: 384 QSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418
           +S+GF ++ + D+ +AV+   +     F+GR + I
Sbjct: 245 RSRGFGFITY-DTPDAVDKVCQNKFIDFKGRKIEI 278

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 50/82 (60%), Gaps = 5/82 (6%)

Query: 346 RLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVE 405
           ++F+  + + + E+  R  FS +G++EE+ +  D  TG+S+GF ++ F +S ++V+  V+
Sbjct: 123 KMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTF-ESASSVDEVVK 181

Query: 406 LDKQIFQGRLL---HILPGEEK 424
             + I  G+++     +P EE+
Sbjct: 182 T-QHILDGKVIDPKRAIPREEQ 202

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 55/119 (46%), Gaps = 15/119 (12%)

Query: 625 EENPVEVK--PSSNDLMEANKDVTEGSSNAHDEDV---IDGPTVSIFIKNLNFSTTNQNL 679
           EE+P + K   SSN  +++  +V  G  N  D  V   +   +  +FI  LN+ TT   L
Sbjct: 81  EESPDKSKEEKSSNASVDSGTNVQSG--NTGDRTVKADLSKDSCKMFIGGLNWETTEDGL 138

Query: 680 TDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANAVIAA---MDGTVID 735
            D F  +    V ++K   DP       S GFGF+ F +    + V+     +DG VID
Sbjct: 139 RDYFSKYG--KVEELKIMKDP---ATGRSRGFGFLTFESASSVDEVVKTQHILDGKVID 192

>Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement
          Length = 396

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 1/101 (0%)

Query: 329 PQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGF 388
           P K D  +A+ K   +  LF+ N+ + + +E  RK F   GE+ +V +A    +G+ KGF
Sbjct: 214 PDKNDL-IAMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGF 272

Query: 389 AYVLFKDSKNAVNAYVELDKQIFQGRLLHILPGEEKKSHRL 429
           A++ FKD K    A  +   +   GR L +  GE++   ++
Sbjct: 273 AFIDFKDEKGPTEALTDKSCRKIAGRPLRMEFGEDRSKRQV 313

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 86/194 (44%), Gaps = 29/194 (14%)

Query: 665 IFIKNLNFSTTNQNLTDRFKVFTGFVVAQVK----------------TKPDPKHQGKTL- 707
           +++ NL+F T+ ++L         F+VA+ K                  P  ++ GK + 
Sbjct: 119 VWVGNLSFDTSKEDLIR-------FIVAKTKDLEGESKVEEDSIIRVNLPLAQNDGKKIR 171

Query: 708 SMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHR---QASQSXXXXXXXXXXXXX 764
           + GF +++F+ KEQ NAVI  +  + ++G  + +K S     +  ++             
Sbjct: 172 NKGFAYMDFKNKEQMNAVI-GLSESQLNGRNMLIKNSSSYEGRPDKNDLIAMSKNPPSRI 230

Query: 765 XXVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAENAMDQL 823
             V NL F+ T + + + F   G++  VR+    D    +GFAF++F   K    A+   
Sbjct: 231 LFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEALTDK 290

Query: 824 HGVHLLGRRLVMQY 837
               + GR L M++
Sbjct: 291 SCRKIAGRPLRMEF 304

>YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylated
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           [1605 bp, 534 aa]
          Length = 534

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 49/78 (62%), Gaps = 9/78 (11%)

Query: 324 PERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTG 383
           P+RA+P+  DE+      ++TG++F+  I    + ++F + FS +G + +  + LD  TG
Sbjct: 230 PKRAIPR--DEQ------DKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTG 281

Query: 384 QSKGFAYVLFKDSKNAVN 401
           QS+GF +V + DS +AV+
Sbjct: 282 QSRGFGFVTY-DSADAVD 298

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 35/77 (45%), Gaps = 8/77 (10%)

Query: 662 TVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQ 721
           +  +FI  LN+ TT  NL + F  +    V  +K   DP       S GFGF+ F     
Sbjct: 158 SCKMFIGGLNWDTTEDNLREYFGKYG--TVTDLKIMKDP---ATGRSRGFGFLSFEKPSS 212

Query: 722 ANAVIAA---MDGTVID 735
            + V+     +DG VID
Sbjct: 213 VDEVVKTQHILDGKVID 229

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 16/74 (21%), Positives = 45/74 (60%), Gaps = 2/74 (2%)

Query: 343 QTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNA 402
           ++ ++F+  + + + E++ R+ F  +G + ++ +  D  TG+S+GF ++ F +  ++V+ 
Sbjct: 157 ESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSF-EKPSSVDE 215

Query: 403 YVELDKQIFQGRLL 416
            V+  + I  G+++
Sbjct: 216 VVKT-QHILDGKVI 228

 Score = 37.0 bits (84), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 16/64 (25%)

Query: 2   SRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRD-RNGESRRFG 60
            ++ + GL    T+DNLRE+F K                  +TD+KI++D   G SR FG
Sbjct: 159 CKMFIGGLNWDTTEDNLREYFGKY---------------GTVTDLKIMKDPATGRSRGFG 203

Query: 61  FIGY 64
           F+ +
Sbjct: 204 FLSF 207

>Kwal_55.21960
          Length = 597

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 55/95 (57%), Gaps = 9/95 (9%)

Query: 324 PERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTG 383
           P+RA+P+        E+ ++TG++F+  I    + ++F + FS +G + +  + LD  TG
Sbjct: 280 PKRAIPR--------EEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTG 331

Query: 384 QSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418
           +S+GF ++ + D+ +AV+   E     F+G+ + I
Sbjct: 332 RSRGFGFITY-DTPDAVDRVCENKFIEFKGKRIEI 365

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 50/82 (60%), Gaps = 5/82 (6%)

Query: 346 RLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVE 405
           ++F+  + + + E++ +  FS +G++ ++ +  D  TG+S+GF ++ F ++ ++V+  V+
Sbjct: 210 KMFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEA-SSVDEVVK 268

Query: 406 LDKQIFQGRLL---HILPGEEK 424
             + I  G+++     +P EE+
Sbjct: 269 T-QHILDGKVIDPKRAIPREEQ 289

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 16/65 (24%)

Query: 1   MSRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDR-NGESRRF 59
           + ++ + GL    T+DNL+++F+K  +               +TD+KI+RD   G SR F
Sbjct: 208 ICKMFIGGLNWETTEDNLKDYFSKYGQ---------------VTDLKIMRDNATGRSRGF 252

Query: 60  GFIGY 64
           GF+ +
Sbjct: 253 GFLTF 257

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 32/76 (42%), Gaps = 8/76 (10%)

Query: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722
             +FI  LN+ TT  NL D F  +      QV      +      S GFGF+ F      
Sbjct: 209 CKMFIGGLNWETTEDNLKDYFSKY-----GQVTDLKIMRDNATGRSRGFGFLTFAEASSV 263

Query: 723 NAVIAA---MDGTVID 735
           + V+     +DG VID
Sbjct: 264 DEVVKTQHILDGKVID 279

>Kwal_56.23486
          Length = 587

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LF++N+  +  +E  ++ F+PFG +  V V  D   G SKGF +V F   + A  A  E 
Sbjct: 326 LFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGSSKGFGFVCFSTPEEATKAITEK 384

Query: 407 DKQIFQGRLLHILPGEEKKSHR 428
           ++QI  G+ L++   + K+  R
Sbjct: 385 NQQIVAGKPLYVAIAQRKEVRR 406

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 54/101 (53%), Gaps = 9/101 (8%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           ++++NI   +K+++F KLFS +G +    +  D   G+ +GF +V F+D   A  A  EL
Sbjct: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEEL 281

Query: 407 DKQIFQGRLLHILPGEEKKSHRLDEFDLKNMPLKKQKELKR 447
           +   F G+ L++    +KK  RL E       LKKQ E  R
Sbjct: 282 NDTDFNGQKLYVGRA-QKKYERLQE-------LKKQYESSR 314

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 77/182 (42%), Gaps = 15/182 (8%)

Query: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722
            ++++KN++  T        F  +     A ++T     ++GK    GFGFV F     A
Sbjct: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETD----NEGKL--RGFGFVNFEDHNAA 274

Query: 723 NAVIAAMDGTVIDGHKIQLKLSHRQAS---------QSXXXXXXXXXXXXXXXVKNLPFE 773
              +  ++ T  +G K+ +  + ++           +S               VKNL   
Sbjct: 275 AKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDS 334

Query: 774 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833
              + + E F  FG + SV+V +    S++GF FV F  P+EA  A+ + +   + G+ L
Sbjct: 335 IDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 394

Query: 834 VM 835
            +
Sbjct: 395 YV 396

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 48/109 (44%), Gaps = 3/109 (2%)

Query: 320 KEEQPERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALD 379
           ++EQP    P  TD E + +    +  L++  +  +  E     LFSP G +  + V  D
Sbjct: 18  QDEQP--TGPTSTDSE-STKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRD 74

Query: 380 TRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHILPGEEKKSHR 428
             T  S G+AYV F D      A  +L+    +GR   I+  +   S R
Sbjct: 75  AITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDPSLR 123

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 69/169 (40%), Gaps = 12/169 (7%)

Query: 662 TVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQ 721
           + S+++  L+ S T   L D F       V+ ++   D   +    S+G+ +V F     
Sbjct: 39  SASLYVGELDPSVTEALLYDLFSPIGS--VSSIRVCRDAITK---TSLGYAYVNFHDHNA 93

Query: 722 ANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVFE 781
               I  ++ T I G   ++  S R  S                 +KNL      K + +
Sbjct: 94  GTTAIEKLNYTPIKGRPCRIMWSQRDPS-------LRKKGSGNVFIKNLHPAIDNKALHD 146

Query: 782 LFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLG 830
            F+ FG + S ++       +R F FV F   + A+ A+D ++G+ L G
Sbjct: 147 TFSVFGNILSCKIATDETGKSRKFGFVHFEEEEAAKEAIDAINGMLLNG 195

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722
           V++F+KNL+ S  ++ L + F  F    +  VK   D     K    GFGFV F T E+A
Sbjct: 324 VNLFVKNLDDSIDDEKLQEEFAPFG--TITSVKVMRDDAGSSK----GFGFVCFSTPEEA 377

Query: 723 NAVIAAMDGTVIDGHKIQLKLSHRQ 747
              I   +  ++ G  + + ++ R+
Sbjct: 378 TKAITEKNQQIVAGKPLYVAIAQRK 402

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%)

Query: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93
           IT VK++RD  G S+ FGF+ +   E+A  A+   N   +    + V++A+
Sbjct: 350 ITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 400

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 11/96 (11%)

Query: 6   VKGLPVYLT----DDNLREHFTKRLRQKHSHQAV-NGSGPDL------ITDVKILRDRNG 54
           +KG P  +     D +LR+  +  +  K+ H A+ N +  D       I   KI  D  G
Sbjct: 106 IKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETG 165

Query: 55  ESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVS 90
           +SR+FGF+ +  EE A +A++  NG  +N  ++ V+
Sbjct: 166 KSRKFGFVHFEEEEAAKEAIDAINGMLLNGLEVYVA 201

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 100/236 (42%), Gaps = 33/236 (13%)

Query: 344 TGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAY 403
           +G +F++N+      +     FS FG +    +A D  TG+S+ F +V F++ + A  A 
Sbjct: 127 SGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFEEEEAAKEAI 185

Query: 404 VELDKQIFQGRLLHILPGEEKK--SHRLDEFD-------LKNM-PLKKQKELKRKAAASR 453
             ++  +  G  +++ P   KK    +LDE         +KN+ P  KQ E ++  +   
Sbjct: 186 DAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFS--- 242

Query: 454 QTFSWNSLYMNQDA-----VLGSV------AAKLGLEKSQLIDAENSSSAVKQALAEAHV 502
           Q  +  S  +  D        G V      AA   +E+    D       V +A  +   
Sbjct: 243 QYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYER 302

Query: 503 IGDVRKYFESKGVDLTKFSQLKSTNQRDDKVILVKNFPFGTTREELGEMFLPYGKL 558
           + +++K +ES    + K ++ +  N      + VKN       E+L E F P+G +
Sbjct: 303 LQELKKQYESS--RMEKLAKYQGVN------LFVKNLDDSIDDEKLQEEFAPFGTI 350

>AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH]
           complement(18862..19482) [621 bp, 206 aa]
          Length = 206

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 55/110 (50%), Gaps = 14/110 (12%)

Query: 321 EEQPERA------VPQKTDEELAIEKINQTGRLFLRNILYTSK------EEDFRKLFSPF 368
           +EQP+ A      +PQ+       +K  Q  R  L  I+Y S+      E +    F+ F
Sbjct: 44  DEQPQPAAAGHTILPQQPARRSGAKK--QAARTDLSGIIYISRLPHGFHERELSTYFAQF 101

Query: 369 GELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418
           G+L++V +A + +TG S+ +A++ F +  +AV A   +   +  G LL +
Sbjct: 102 GDLKQVRLARNKKTGNSRHYAFIEFANPDDAVVAQETMHNYLLMGHLLQV 151

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           +  LP     +++   F  FG LK VR+ + K   ++R +AF+EF  P +A  A + +H 
Sbjct: 82  ISRLPHGFHERELSTYFAQFGDLKQVRLARNKKTGNSRHYAFIEFANPDDAVVAQETMHN 141

Query: 826 VHLLGRRL 833
             L+G  L
Sbjct: 142 YLLMGHLL 149

>YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylated
           RNA-binding protein of nucleus and cytoplasm, contains
           three RNA recognition (RRM) domains and three
           Gln/Asn-rich regions [1362 bp, 453 aa]
          Length = 453

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 94/223 (42%), Gaps = 23/223 (10%)

Query: 626 ENPVEVKPSSND--LMEANKDVTEGSSNAHDEDVIDGPTVS---------IFIKNLNFST 674
           E P    PSS     +E N +  E +   +D  V+    ++         +++ NL+ + 
Sbjct: 27  EAPASADPSSEQSVAVEGNSEQAEDNQGENDPSVVPANAITGGRETSDRVLYVGNLDKAI 86

Query: 675 TNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANAVIAAMDGTVI 734
           T   L   F+V  G  +A +K   D  ++    ++ + FVE+     AN  +  ++G  I
Sbjct: 87  TEDILKQYFQV--GGPIANIKIMIDKNNK----NVNYAFVEYHQSHDANIALQTLNGKQI 140

Query: 735 DGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVFELFNSFGQLKSVRV 794
           + + +++  + +    S               V     + T ++ F+ F S+  L    +
Sbjct: 141 ENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVD----DETLRNAFKDFPSY--LSGHVM 194

Query: 795 PKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQY 837
                 S+RG+ FV F    +A+NAMD + G  L GR L + +
Sbjct: 195 WDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINW 237

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%)

Query: 344 TGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAY 403
           T  LF+ ++     +E  R  F  F      HV  D +TG S+G+ +V F    +A NA 
Sbjct: 161 TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAM 220

Query: 404 VELDKQIFQGRLLHI 418
             +  Q   GR L I
Sbjct: 221 DSMQGQDLNGRPLRI 235

 Score = 33.1 bits (74), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 40/80 (50%), Gaps = 15/80 (18%)

Query: 13  LTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFGFIGYRNEEDAFD 72
           +T+D L+++F                GP  I ++KI+ D+N ++  + F+ Y    DA  
Sbjct: 86  ITEDILKQYFQV-------------GGP--IANIKIMIDKNNKNVNYAFVEYHQSHDANI 130

Query: 73  AVEYFNGSFINTSKIEVSMA 92
           A++  NG  I  + ++++ A
Sbjct: 131 ALQTLNGKQIENNIVKINWA 150

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 42/103 (40%), Gaps = 7/103 (6%)

Query: 324 PERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTG 383
           P +  PQ  D  +       T   ++ NI + + E D   LF  FG +      LD +  
Sbjct: 321 PPQVNPQAVDHIIRSAPPRVT-TAYIGNIPHFATEADLIPLFQNFGFI------LDFKHY 373

Query: 384 QSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHILPGEEKKS 426
             KG  ++ +   + A    V L    FQGR L    G+E+ +
Sbjct: 374 PEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERSN 416

>Scas_565.8
          Length = 322

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 46/86 (53%), Gaps = 7/86 (8%)

Query: 344 TGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTG------QSKGFAYVLFKDSK 397
           T +L   N+ + + + +  +L  PFG++  V    ++  G       S G+AYV+F+  +
Sbjct: 16  THKLVFTNVRFNTSDAELEELLKPFGKVS-VLTPTESLFGFRGTKVVSIGYAYVIFETPQ 74

Query: 398 NAVNAYVELDKQIFQGRLLHILPGEE 423
            A  A+ EL K  F+GR L+I P EE
Sbjct: 75  LAATAFNELHKTEFKGRTLYIKPYEE 100

>KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1 CF Ib (RNA3
           Cleavage factor Ib), hypothetical start
          Length = 570

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 55/95 (57%), Gaps = 9/95 (9%)

Query: 324 PERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTG 383
           P+RA+P+        E+ ++TG++F+  I    + ++F + FS +G + +  + LD  TG
Sbjct: 257 PKRAIPR--------EEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQLMLDKDTG 308

Query: 384 QSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418
           +S+GF ++ + D+ +AV+   +     F+G+ + I
Sbjct: 309 RSRGFGFITY-DTPDAVDRVCQNKFIEFKGKQIEI 342

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 96/195 (49%), Gaps = 40/195 (20%)

Query: 241 EEKMISISNLKDTDIGLVNDDANSDEKENE--------KRRNLAQDEKVSDLDWFKQRRV 292
           ++++ S +N  D+++   ND A ++ KEN         +   + Q   + D+   +Q   
Sbjct: 101 QQQVASSNNQPDSNLASNNDKAENNNKENYSASVPEMLQMPQMPQMPGMPDMSQLQQ--- 157

Query: 293 RIKESEAETREKSSSYATEQNESLDTKKEEQPERAVPQKTDEELAIEKINQTGRLFLRNI 352
            ++++ ++ ++ +S +                    P+    +L+ + IN   ++F+  +
Sbjct: 158 -LQQTMSQLQQTASQHE-------------------PKAIKADLSRD-IN---KMFIGGL 193

Query: 353 LYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQ 412
            + + EE  R  FS +G + EV +  DT TG+S+GF ++ F+++ ++V+  V+  + I  
Sbjct: 194 NWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENA-SSVDEVVKT-QHILD 251

Query: 413 GRLL---HILPGEEK 424
           G+++     +P EE+
Sbjct: 252 GKVIDPKRAIPREEQ 266

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 8/74 (10%)

Query: 665 IFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANA 724
           +FI  LN+ TT + L D F  +    VA+VK     K      S GFGF+ F      + 
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYG--AVAEVKIM---KDTATGRSRGFGFLTFENASSVDE 242

Query: 725 VIAA---MDGTVID 735
           V+     +DG VID
Sbjct: 243 VVKTQHILDGKVID 256

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 16/67 (23%)

Query: 1   MSRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDR-NGESRRF 59
           ++++ + GL    T++ LR++F+K                  + +VKI++D   G SR F
Sbjct: 185 INKMFIGGLNWETTEEGLRDYFSKY---------------GAVAEVKIMKDTATGRSRGF 229

Query: 60  GFIGYRN 66
           GF+ + N
Sbjct: 230 GFLTFEN 236

>KLLA0A05346g 485886..488510 some similarities with sp|P53316
           Saccharomyces cerevisiae YGR250c singleton, hypothetical
           start
          Length = 874

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%)

Query: 341 INQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAV 400
           +N  G L++R I     +ED   +F+ FG +  + + LD+ T +S GF +V +     A 
Sbjct: 187 LNHPGNLYVRGIPKNLTKEDLVPIFAKFGPILVLKIILDSNTNESMGFGFVSYALGSQAS 246

Query: 401 NAYVELDKQIFQGRLLHILPGEEKKSHRLDEFD 433
           N   EL+  +  G  L +    E+K      FD
Sbjct: 247 NCIKELNGNLMNGSPLFVNYHVERKERERIHFD 279

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 101/240 (42%), Gaps = 37/240 (15%)

Query: 4   IIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRN-GESRRFGFI 62
           + V+G+P  LT ++L   F K              GP L+  +KI+ D N  ES  FGF+
Sbjct: 193 LYVRGIPKNLTKEDLVPIFAKF-------------GPILV--LKIILDSNTNESMGFGFV 237

Query: 63  GYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPRVPQPMKEKRREALKRFREKEEKL 122
            Y     A + ++  NG+ +N S +       F +  V +  KE+ R    ++++ E   
Sbjct: 238 SYALGSQASNCIKELNGNLMNGSPL-------FVNYHVER--KERERIHFDQWKQNE--- 285

Query: 123 LQEENRKKKKVDENKHSNIDDEIRKNKQLQE--FMETMK---PSSQVTSWEKVGIDKSIE 177
            QEE+ K K V      N+     +NK L     +E  K   P  ++ S+     +    
Sbjct: 286 -QEESTKFKGVFV---GNLPIFTTENKLLTPSIVLEKFKKALPDCEMVSYFFPKTNSQTN 341

Query: 178 DEKLKREEEDSSVQGNSLLAHALALKEENNKDEAPNLVIENESDDEYSALNRNRDEDQED 237
            E  + +E+  S     L A +  +K ++N DE      E   D +   + ++ D   ED
Sbjct: 342 VEYSETDEDSKSESPLHLNAESFPVKSKHNSDETNKRNNEKIEDPQLKTIEKHHDNGDED 401

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAENAMDQLHG 825
           V+ +P   T++D+  +F  FG +  +++    + + + GF FV + L  +A N + +L+G
Sbjct: 195 VRGIPKNLTKEDLVPIFAKFGPILVLKIILDSNTNESMGFGFVSYALGSQASNCIKELNG 254

Query: 826 VHLLGRRLVMQY 837
             + G  L + Y
Sbjct: 255 NLMNGSPLFVNY 266

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 708 SMGFGFVEFRTKEQANAVIAAMDGTVIDGHKI 739
           SMGFGFV +    QA+  I  ++G +++G  +
Sbjct: 231 SMGFGFVSYALGSQASNCIKELNGNLMNGSPL 262

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 18/79 (22%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRV-----------------PKKFDKSARGFAFVE 809
           VK+LP +   +D+++ F  FG++ S ++                  + F KS +G+ FV 
Sbjct: 734 VKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKS-KGYGFVC 792

Query: 810 FLLPKEAENAMDQLHGVHL 828
           F  P +A  AM    G+ L
Sbjct: 793 FQNPLDASRAMYHTDGLKL 811

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 34/80 (42%), Gaps = 15/80 (18%)

Query: 343 QTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVAL---------------DTRTGQSKG 387
           Q   L+++++    ++ED  + F  FGE+    +                 D   G+SKG
Sbjct: 728 QESNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKG 787

Query: 388 FAYVLFKDSKNAVNAYVELD 407
           + +V F++  +A  A    D
Sbjct: 788 YGFVCFQNPLDASRAMYHTD 807

>KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 391

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LF+ N+ + + E+  RK F   GE+  + +A    TG+ KGFA++ FKD   A NA  + 
Sbjct: 229 LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDFKDETGATNALKDK 288

Query: 407 DKQIFQGRLLHILPGEEKKSHRL 429
             +    R + +  GE++   ++
Sbjct: 289 SCRKIASRPIRMEYGEDRSKRQV 311

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/219 (21%), Positives = 91/219 (41%), Gaps = 36/219 (16%)

Query: 647 EGSS---NAHDEDVIDGPT----VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVK---- 695
           EGSS   N  +E +   P       +++ N+ F T  +++         F+VA+ K    
Sbjct: 92  EGSSEETNVEEEKITSKPNKEKKFGVWVGNMAFDTVKEDIIR-------FIVAKTKENDE 144

Query: 696 ------------TKPDPKHQGKTL-SMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLK 742
                         P  K+  K L + GF +++F+T++Q  AV+  +  + ++G  + +K
Sbjct: 145 GGAITEKDIVRINMPLTKNDNKKLRNKGFAYIDFKTEKQMEAVV-GLSESALNGRNLLIK 203

Query: 743 LSHR---QASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFD 799
            +     +  ++               V NL F+ T   + + F   G++  +R+    D
Sbjct: 204 NAGSYEGRPDKNDLVAASKNPPSRILFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFED 263

Query: 800 KS-ARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQY 837
               +GFAF++F     A NA+       +  R + M+Y
Sbjct: 264 TGKCKGFAFIDFKDETGATNALKDKSCRKIASRPIRMEY 302

>CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces
           cerevisiae YFR023w PES4 DNA-directed DNA polymerase
           epsilon suppressor, hypothetical start
          Length = 602

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 85/199 (42%), Gaps = 30/199 (15%)

Query: 645 VTEGSSNAHDEDVIDGPT----------VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQV 694
           V++ SS +   +++D  T          +++F+ NL    T++ LT+ FKV+  F+ A+V
Sbjct: 36  VSDASSRSETLEIVDIRTENLGTNVQNNIALFVGNLAEEITSERLTEMFKVYKSFISAKV 95

Query: 695 KTKPDPKHQGKTLSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXX 754
            T  D        S+G G++ F  KE A       +   I G +I++  S R +      
Sbjct: 96  CTNADDNR-----SLGHGYINFGNKEDAERATEDFNYNKIMGKEIRIMPSIRDS------ 144

Query: 755 XXXXXXXXXXXXVKNLPFE---ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFL 811
                         NLP +    T +  +++F  +G + SV++      S++   FV F 
Sbjct: 145 -VYRKNFGTNIFFSNLPLQKEKLTHRMFYDIFRKYGNVLSVKL-----DSSKNIGFVYFE 198

Query: 812 LPKEAENAMDQLHGVHLLG 830
               A + + + +    LG
Sbjct: 199 DDTIARDVIKEFNNKEFLG 217

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/143 (20%), Positives = 58/143 (40%), Gaps = 18/143 (12%)

Query: 704 GKTLSMGFGF-VEFRTKEQANAVIAAMDGTVI--------DGHKIQLKLSHRQASQSXXX 754
           G  +S G  F  E R K   +  I+ +D  +I        D +K+++K+   + +     
Sbjct: 217 GNIISCGLHFDKELRKKPNFDKQISKLDDDIIIEKEKEIFDSNKVEIKIDKDKVA----- 271

Query: 755 XXXXXXXXXXXXVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPK 814
                       +KNLP +    ++  +F+  G +KSV +    +     +AFV +    
Sbjct: 272 ----IIQPNGIFIKNLPLDTNNNEILAIFSEVGPIKSVFLSPLNESREYLWAFVTYKDKA 327

Query: 815 EAENAMDQLHGVHLLGRRLVMQY 837
             E A+   +G  +  R + + +
Sbjct: 328 SVEKAISLFNGKAIGNRNVFVTH 350

>ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH]
           (140625..141752) [1128 bp, 375 aa]
          Length = 375

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 43/78 (55%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LF+ N+ + + +E  +K F   GE+ ++ +A    +G+ KGFA+V F+D   A  A  + 
Sbjct: 218 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDR 277

Query: 407 DKQIFQGRLLHILPGEEK 424
             +   GR L +  GE++
Sbjct: 278 SCRAIAGRPLRMEYGEDR 295

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 82/187 (43%), Gaps = 16/187 (8%)

Query: 665 IFIKNLNFSTTNQNLTDRFKV--FTGFVVAQVK-------TKPDPKHQGKTL-SMGFGFV 714
           ++I N+ F TT + L  RF V    G    +V          P  K+ GK + + GF +V
Sbjct: 107 VWIGNMAFDTTQEELR-RFVVSKTAGMEAGEVTDADIVRVNMPLAKNDGKQIKNKGFAYV 165

Query: 715 EFRTKEQANAVIAAMDGTVIDGHKIQLKLSHR---QASQSXXXXXXXXXXXXXXXVKNLP 771
           +F T  Q +AVI   +   ++G  + +K +     + +++               V NL 
Sbjct: 166 DFATSAQMDAVIGLSEAQ-LNGRNLLIKNAKSYDGRPAKNDLISMSKNPPSRILFVGNLS 224

Query: 772 FEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAENAMDQLHGVHLLG 830
           F+ T + + + F   G++  +R+    D    +GFAFV+F     A  A+       + G
Sbjct: 225 FDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDRSCRAIAG 284

Query: 831 RRLVMQY 837
           R L M+Y
Sbjct: 285 RPLRMEY 291

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 49/110 (44%), Gaps = 20/110 (18%)

Query: 632 KPSSNDLMEANKDVTEGSSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVV 691
           +P+ NDL+  +K+                P+  +F+ NL+F TT++ L   F+     V 
Sbjct: 200 RPAKNDLISMSKN---------------PPSRILFVGNLSFDTTDELLKKHFQHCGEIVK 244

Query: 692 AQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQL 741
            ++ T  D    GK    GF FV+FR +  A A +       I G  +++
Sbjct: 245 IRMATFQD---SGKC--KGFAFVDFRDEAGATAALTDRSCRAIAGRPLRM 289

>YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein
           required for ribosome biogenesis, contains three
           canonical RNA recognition motif (RRM) domains and one
           degenerate RNA recognition motif (RRM) domain [2058 bp,
           685 aa]
          Length = 685

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 44/89 (49%), Gaps = 15/89 (16%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDS-------KNA 399
           +F+RN+ Y + EE     FS FG ++     +D  TG +KG A+V FKD        KNA
Sbjct: 292 VFVRNVPYDATEESLAPHFSKFGSVKYALPVIDKSTGLAKGTAFVAFKDQYTYNECIKNA 351

Query: 400 VNAYVE--------LDKQIFQGRLLHILP 420
             A           + + +++GR+L I P
Sbjct: 352 PAAGSTSLLIGDDVMPEYVYEGRVLSITP 380

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/226 (18%), Positives = 85/226 (37%), Gaps = 40/226 (17%)

Query: 642 NKDVTEGSSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPK 701
           N +V   + +  ++D +D  T  +F++++    T++ L D F  F     A V    + +
Sbjct: 7   NVEVPSSNVSKQNDDGLDMKT--LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKR 64

Query: 702 HQGKTLSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXX 761
                 S GFGFV F  ++     +A    T  +GH +++ ++ R+              
Sbjct: 65  ------SRGFGFVSFAVEDDTKEALAKARKTKFNGHILRVDIAKRRDRSKKTSEVVEKST 118

Query: 762 XXXXX---------------------------VKNLPFEATRKDVFEL---FNSFGQLKS 791
                                           ++N+P+    +D  +L   F  +G +  
Sbjct: 119 PESSEKITGQNNEDEDDADGEDSMLKGKPKLIIRNMPWSC--RDPVKLKKIFGRYGTVVE 176

Query: 792 VRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQY 837
             +P+K D    GFAFV          A++    + + GR++ + +
Sbjct: 177 ATIPRKRDGKLCGFAFVTMKKISNCRIALENTKDLKIDGRKVAVDF 222

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 43/97 (44%), Gaps = 7/97 (7%)

Query: 322 EQPERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTR 381
           E P   V ++ D+ L ++       LF+R+I     +E     FS F  ++   V  DT 
Sbjct: 9   EVPSSNVSKQNDDGLDMKT------LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDT- 61

Query: 382 TGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418
             +S+GF +V F    +   A  +  K  F G +L +
Sbjct: 62  NKRSRGFGFVSFAVEDDTKEALAKARKTKFNGHILRV 98

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 42/93 (45%), Gaps = 15/93 (16%)

Query: 1   MSRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFG 60
           M  + V+ +P  +TD+ L + F+     KH+                +++D N  SR FG
Sbjct: 25  MKTLFVRSIPQDVTDEQLADFFSNFAPIKHAV---------------VVKDTNKRSRGFG 69

Query: 61  FIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93
           F+ +  E+D  +A+     +  N   + V +AK
Sbjct: 70  FVSFAVEDDTKEALAKARKTKFNGHILRVDIAK 102

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 6/64 (9%)

Query: 519 KFSQLKSTNQRDDKVILVKNFPFGTTREELGEMFLPYGKLERLL------MPPAGTIAIV 572
           K S+ K+ N+R+D  + V+N P+  T E L   F  +G ++  L         A   A V
Sbjct: 277 KESKRKAQNKREDFSVFVRNVPYDATEESLAPHFSKFGSVKYALPVIDKSTGLAKGTAFV 336

Query: 573 QFRD 576
            F+D
Sbjct: 337 AFKD 340

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLK-SVRVPKKFDKSARGFAFVEF 810
           V+N+P++AT + +   F+ FG +K ++ V  K    A+G AFV F
Sbjct: 294 VRNVPYDATEESLAPHFSKFGSVKYALPVIDKSTGLAKGTAFVAF 338

>AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH]
           complement(232080..234269) [2190 bp, 729 aa]
          Length = 729

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/195 (20%), Positives = 75/195 (38%), Gaps = 27/195 (13%)

Query: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723
           ++F++N+ F  T+  LTD F  F     A +K     K    + S GFGFV F  +    
Sbjct: 17  TLFVRNIPFDATDAELTDFFSQF-----APIKHAVIVKDNAGS-SRGFGFVSFAVESDTQ 70

Query: 724 AVIAAMDGTVIDGHKIQLKLSHR--------------------QASQSXXXXXXXXXXXX 763
           A +     T   G  +++ ++ R                    + + +            
Sbjct: 71  AALDKGRKTQFKGRLLRVDVAKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKP 130

Query: 764 XXXVKNLPFEATRKDVF-ELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQ 822
              ++N+P+         ++F  FG +    +P+K D    GFAFV          A+++
Sbjct: 131 KLIIRNMPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEE 190

Query: 823 LHGVHLLGRRLVMQY 837
             G+ + GR + + +
Sbjct: 191 CKGLKIDGREVAVDF 205

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 86/225 (38%), Gaps = 32/225 (14%)

Query: 525 STNQRDDKVILVKNFPFGTTREELGEMFLPYGKLERLLMPP--AGT---IAIVQFRDTTS 579
           S N  D K + V+N PF  T  EL + F  +  ++  ++    AG+      V F   + 
Sbjct: 9   SKNGLDLKTLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESD 68

Query: 580 ARAAFTKLSYKRFKDGIIYLERGPKDCFTKPAEADDLINNTSAKEEENPVEVKPSSNDLM 639
            +AA  K    +FK  ++ ++   +   +K  + D+    TSA++ E P         LM
Sbjct: 69  TQAALDKGRKTQFKGRLLRVDVAKRRERSK--KGDEAEAQTSAEDAEKPTTAPEGDEALM 126

Query: 640 EANKDVTEGSSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPD 699
                                    + I+N+ +S   ++ T   K+F  F V    + P 
Sbjct: 127 RGKP--------------------KLIIRNMPWSC--RDPTKLKKIFGRFGVVAEASIPR 164

Query: 700 PKHQGKTLSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLS 744
            K  GK    GF FV  +        I    G  IDG ++ +  +
Sbjct: 165 -KADGKLC--GFAFVTMKKLSNCRKAIEECKGLKIDGREVAVDFA 206

>Sklu_2182.3 YDR432W, Contig c2182 3920-5035
          Length = 371

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 8/76 (10%)

Query: 344 TGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAY 403
           T RLF+R   +  +E +  ++FSPFG ++EV +          GFA+V F++S++A  A 
Sbjct: 74  TTRLFVRPFPFDVQESELNEIFSPFGPMKEVKIL--------NGFAFVEFEESESAAKAI 125

Query: 404 VELDKQIFQGRLLHIL 419
            E++ + F  + L ++
Sbjct: 126 DEVNGKTFANQPLEVV 141

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 7/71 (9%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 826
           V+  PF+    ++ E+F+ FG +K V++         GFAFVEF   + A  A+D+++G 
Sbjct: 79  VRPFPFDVQESELNEIFSPFGPMKEVKI-------LNGFAFVEFEESESAAKAIDEVNGK 131

Query: 827 HLLGRRLVMQY 837
               + L + Y
Sbjct: 132 TFANQPLEVVY 142

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 534 ILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFTKLSYKRFK 593
           + V+ FPF     EL E+F P+G ++ + +      A V+F ++ SA  A  +++ K F 
Sbjct: 77  LFVRPFPFDVQESELNEIFSPFGPMKEVKI--LNGFAFVEFEESESAAKAIDEVNGKTFA 134

Query: 594 D 594
           +
Sbjct: 135 N 135

>Scas_701.3
          Length = 321

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 39/60 (65%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +F+  + Y + E + +KLF  FGE+E++ +  D  T +SKG+A+++F D  ++  A+ E+
Sbjct: 108 IFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKEI 167

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 43/73 (58%), Gaps = 4/73 (5%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQL-- 823
           +  LP++ T  ++ +LF  FG+++ +R+ + K    ++G+AF+ FL P  ++ A  ++  
Sbjct: 110 IGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKEIGV 169

Query: 824 -HGVHLLGRRLVM 835
             G+ + GR  ++
Sbjct: 170 HRGIDIKGRTCIV 182

>Kwal_33.14463
          Length = 393

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LF+ N+ + + +E  +K F   G++ ++ +A    TG+ KGFA+V FKD +   NA  + 
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDK 296

Query: 407 DKQIFQGRLLHILPGEEK 424
             +   GR L +  GE++
Sbjct: 297 TCRKIAGRPLRMEFGEDR 314

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 85/187 (45%), Gaps = 15/187 (8%)

Query: 665 IFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTK---------PDPKHQGKTL-SMGFGFV 714
           ++I NL+F T+ ++L   F   T  +    + +         P  ++ GK + + GF  +
Sbjct: 125 VWIGNLSFDTSKEDLCRFFVAKTKELDESCRIEESDIVRVNLPLAQNDGKQIKNKGFAHM 184

Query: 715 EFRTKEQANAVIAAMDGTVIDGHKIQLKLSHR---QASQSXXXXXXXXXXXXXXXVKNLP 771
            F+T+EQ NAV+ A+  + ++G  + +K S     +  ++               V NL 
Sbjct: 185 NFKTQEQMNAVV-ALSESHLNGRNLLIKDSSSFDGRPDKNDLISMSKNPPSRILFVGNLS 243

Query: 772 FEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAENAMDQLHGVHLLG 830
           F+ T + + + F   G +  +R+    D    +GFAFV+F   +   NA+       + G
Sbjct: 244 FDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDKTCRKIAG 303

Query: 831 RRLVMQY 837
           R L M++
Sbjct: 304 RPLRMEF 310

>YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein
           that may be involved in coping with heat stresses,
           contains one RNA recognition (RRM) domain [663 bp, 220
           aa]
          Length = 220

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 63/114 (55%), Gaps = 9/114 (7%)

Query: 309 ATEQNESLDTKKEEQPERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPF 368
            T + + L+ KK+   +++  +KT EE        +G +++  + +   E++  K F+ F
Sbjct: 62  GTHKIKRLNPKKQANEKKSKDKKTLEEY-------SGIIYVSRLPHGFHEKELSKYFAQF 114

Query: 369 GELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLH--ILP 420
           G+L+EV +A + +TG S+ + ++ F + ++A+ A   ++  +  G LL   +LP
Sbjct: 115 GDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQESMNNYLLMGHLLQVRVLP 168

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           V  LP     K++ + F  FG LK VR+ + K   ++R + F+EF+  ++A  A + ++ 
Sbjct: 95  VSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQESMNN 154

Query: 826 VHLLGRRL 833
             L+G  L
Sbjct: 155 YLLMGHLL 162

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 43  ITDVKILRDR-NGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEV 89
           + +V++ R++  G SR +GF+ + N+EDA  A E  N   +    ++V
Sbjct: 117 LKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQESMNNYLLMGHLLQV 164

>YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein
           important for the synthesis of 25S pre-rRNA [1380 bp,
           459 aa]
          Length = 459

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKD 395
           +F+ N+ +   EE   K F P G++E V +  D++T   KGFAYV FKD
Sbjct: 281 IFVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKD 329

>KLLA0F23650g 2210563..2211501 some similarities with sp|P53927
           Saccharomyces cerevisiae YNL110c singleton, hypothetical
           start
          Length = 312

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 45/80 (56%), Gaps = 8/80 (10%)

Query: 349 LRNILYTS------KEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNA 402
           L  ILY S      KE +  K FS FG+L++V +A + +TG S+ +A++ + +  +AV A
Sbjct: 181 LSGILYISRLPQGFKERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFLEYINKDDAVVA 240

Query: 403 YVELDKQIFQGRLL--HILP 420
              ++  +  G LL   +LP
Sbjct: 241 QESMNNYLLMGHLLKVKVLP 260

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           +  LP     +++ + F+ FG LK VR+ + K   ++R +AF+E++   +A  A + ++ 
Sbjct: 187 ISRLPQGFKERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFLEYINKDDAVVAQESMNN 246

Query: 826 VHLLGRRL 833
             L+G  L
Sbjct: 247 YLLMGHLL 254

>Sklu_2353.5 YIL061C, Contig c2353 10817-11575
          Length = 252

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 37/60 (61%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +F+  + Y   E + +K FS FGE+E+V V  D  T +S+G+A+++F+D   +  A  E+
Sbjct: 59  VFIGRLPYEVTEVELQKHFSRFGEIEKVRVVRDKSTSKSRGYAFIVFRDETGSRAACKEI 118

 Score = 35.8 bits (81), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 10/76 (13%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFLLPKEAENAMDQL 823
           +  LP+E T  ++ + F+ FG+++ VRV +  DKS   +RG+AF+ F     +  A  ++
Sbjct: 61  IGRLPYEVTEVELQKHFSRFGEIEKVRVVR--DKSTSKSRGYAFIVFRDETGSRAACKEI 118

Query: 824 HGVH----LLGRRLVM 835
            GVH    + GR +++
Sbjct: 119 -GVHRGLDIQGRSVIV 133

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 42/90 (46%), Gaps = 11/90 (12%)

Query: 532 KVILVKNFPFGTTREELGEMFLPYGKLERLLM------PPAGTIAIVQFRDTTSARAAFT 585
           + + +   P+  T  EL + F  +G++E++ +        +   A + FRD T +RAA  
Sbjct: 57  RTVFIGRLPYEVTEVELQKHFSRFGEIEKVRVVRDKSTSKSRGYAFIVFRDETGSRAACK 116

Query: 586 KLSYKRFKD-----GIIYLERGPKDCFTKP 610
           ++   R  D      I+ +ERG    + KP
Sbjct: 117 EIGVHRGLDIQGRSVIVDIERGRTVKYFKP 146

>CAGL0L03806g 438388..439155 similar to sp|P53927 Saccharomyces
           cerevisiae YNL110c, hypothetical start
          Length = 255

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 62/120 (51%), Gaps = 21/120 (17%)

Query: 310 TEQN----ESLDTKKEEQPERAVPQKTDEELAIEKINQTGRL---FLRNILYTSKEEDFR 362
           TEQ+    + LDT K+++  +    K D++  I  I   GRL   F         E +  
Sbjct: 95  TEQSGHHIKKLDTSKKQKATK----KDDKDSDISGIIYVGRLPKGF--------HERELS 142

Query: 363 KLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI--LP 420
           K FS FG+L+EV +A + +TG S+ + +V F ++ ++  AY  ++  +  G LL +  LP
Sbjct: 143 KYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDSRVAYDTMNNYLLMGHLLQVRLLP 202

 Score = 33.1 bits (74), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           V  LP     +++ + F+ FG LK VR+ + K   ++R + FV+F+   ++  A D ++ 
Sbjct: 129 VGRLPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDSRVAYDTMNN 188

Query: 826 VHLLGRRL 833
             L+G  L
Sbjct: 189 YLLMGHLL 196

>ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH]
           complement(569855..569857,569915..570874) [963 bp, 320
           aa]
          Length = 320

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 56/97 (57%), Gaps = 1/97 (1%)

Query: 311 EQNESLDTKKEEQPERAVPQKTDE-ELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFG 369
           E+ ++++++KE++ E  + +   E +  I+  +    +F+  + Y   E + +K F  FG
Sbjct: 72  EELKTINSRKEQELEEELAKWAPENDTNIQGTDPFRTIFVGRLHYDVDELELQKHFIKFG 131

Query: 370 ELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           E+E V +  D  T + +G+A+VLF+D + +  AY E+
Sbjct: 132 EIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYREI 168

>ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH]
           complement(408687..410267) [1581 bp, 526 aa]
          Length = 526

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 58/118 (49%), Gaps = 16/118 (13%)

Query: 343 QTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNA 402
           + G++F+  I    + ++F + FS +G + +  + LD  TG+S+GF ++ + DS +AV+ 
Sbjct: 245 KAGKIFVAGIGPDVRPKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITY-DSPDAVDR 303

Query: 403 YVELDKQIFQGRLLHILPGEEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSWNS 460
             +     F+G+ + I   E               P + QK+    A+ + Q FS N+
Sbjct: 304 VCQNKFIEFKGKRIEIKRAE---------------PRQVQKQRTTNASPTGQPFSLNT 346

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 45/71 (63%), Gaps = 2/71 (2%)

Query: 346 RLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVE 405
           ++F+  + + + E++ R+ FS +G + EV +  D  TG+S+GF ++ F D+ ++V+  V+
Sbjct: 164 KMFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADA-SSVDEVVK 222

Query: 406 LDKQIFQGRLL 416
             + I  G+++
Sbjct: 223 T-QHILDGKVI 232

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 16/65 (24%)

Query: 1   MSRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRD-RNGESRRF 59
           ++++ + GL    T+DNLRE+F+K                  +T+VKI+RD   G SR F
Sbjct: 162 INKMFIGGLNWETTEDNLREYFSKYGN---------------VTEVKIMRDGTTGRSRGF 206

Query: 60  GFIGY 64
           GF+ +
Sbjct: 207 GFLSF 211

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 73/174 (41%), Gaps = 26/174 (14%)

Query: 665 IFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKT-LSMGFGFVEFRTKEQAN 723
           +FI  LN+ TT  NL + F  +    V +VK   D    G T  S GFGF+ F      +
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGN--VTEVKIMRD----GTTGRSRGFGFLSFADASSVD 218

Query: 724 AVIAA---MDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVF 780
            V+     +DG VID  +       R+A +                V  +  +   K+  
Sbjct: 219 EVVKTQHILDGKVIDPKESDPTGRARKAGK--------------IFVAGIGPDVRPKEFE 264

Query: 781 ELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833
           E F+ +G +   ++    D   +RGF F+ +  P +A + + Q   +   G+R+
Sbjct: 265 EFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDSP-DAVDRVCQNKFIEFKGKRI 317

>CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces
           cerevisiae YCL011c GBP2 or sp|P38922 Saccharomyces
           cerevisiae YNL004w HRB1, hypothetical start
          Length = 419

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 78/204 (38%), Gaps = 35/204 (17%)

Query: 661 PTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKE 720
           P   +FI NL +S T Q L D F+     + A ++            S GFG V + T+E
Sbjct: 220 PMFEVFIVNLPYSMTWQTLKDLFREAGDVIRADIEL------DRNGFSRGFGTVFYGTQE 273

Query: 721 QANAVIAAMDGTVIDGHKIQLKLSHRQ-------------------------ASQSXXXX 755
           +    I   +G  +DG  +Q++                               SQ     
Sbjct: 274 EMFNAIERFNGFDVDGRILQVREGKNSTGYQAPYQAPPPPQEQEIEMEPPTGPSQFTENV 333

Query: 756 XXXXXXXXXXXVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSA--RGFAFVEFLLP 813
                        NLP      D+++LF + G+++   +  KFD+S    G A +E+   
Sbjct: 334 VGGGERSTLIYCSNLPLTTATGDLYDLFETIGRVRHAEL--KFDESGAPTGIAVIEYENV 391

Query: 814 KEAENAMDQLHGVHLLGRRLVMQY 837
           ++A+  + +L+  +  G  L + Y
Sbjct: 392 EDADFCIQRLNNYNYGGCDLDISY 415

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 826
           + NL F+AT +D+ + F   G++    +     +  RG   VEF  P+  +NA+   +GV
Sbjct: 123 IGNLSFDATPEDLHDFFGQAGEVLRADIITSRGRH-RGMGTVEFTSPEGVDNAIRDFNGV 181

Query: 827 HLLGRRLVMQ 836
             +GR L ++
Sbjct: 182 EFMGRPLFVR 191

 Score = 37.0 bits (84), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 15/94 (15%)

Query: 1   MSRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFG 60
           M  + +  LP  +T   L++ F +             +G  +  D+++  DRNG SR FG
Sbjct: 221 MFEVFIVNLPYSMTWQTLKDLFRE-------------AGDVIRADIEL--DRNGFSRGFG 265

Query: 61  FIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKS 94
            + Y  +E+ F+A+E FNG  ++   ++V   K+
Sbjct: 266 TVFYGTQEEMFNAIERFNGFDVDGRILQVREGKN 299

 Score = 33.5 bits (75), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +F+ N+ Y+   +  + LF   G++    + LD R G S+GF  V +   +   NA    
Sbjct: 224 VFIVNLPYSMTWQTLKDLFREAGDVIRADIELD-RNGFSRGFGTVFYGTQEEMFNAIERF 282

Query: 407 DKQIFQGRLLHI 418
           +     GR+L +
Sbjct: 283 NGFDVDGRILQV 294

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 4/82 (4%)

Query: 339 EKI--NQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDS 396
           EKI  N    +F+ N+ + +  ED    F   GE+  +   + T  G+ +G   V F   
Sbjct: 111 EKIDRNYDNSIFIGNLSFDATPEDLHDFFGQAGEV--LRADIITSRGRHRGMGTVEFTSP 168

Query: 397 KNAVNAYVELDKQIFQGRLLHI 418
           +   NA  + +   F GR L +
Sbjct: 169 EGVDNAIRDFNGVEFMGRPLFV 190

>Scas_666.11
          Length = 224

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 58/110 (52%), Gaps = 11/110 (10%)

Query: 351 NILYTSK------EEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYV 404
           +ILY S+      E +  K FS FG+L+EV +A + +TG S+ + ++ F +  +A  A  
Sbjct: 94  SILYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDDANIAQD 153

Query: 405 ELDKQIFQGRLLHI--LPGEEK--KSHRLDEFDLKNMPLKKQ-KELKRKA 449
            ++  +  G LL +  LP   K  K ++  +     M +KK  KELK +A
Sbjct: 154 AMNNYLVMGHLLQVRLLPKGAKIEKLYKYKKRAFTQMKIKKTAKELKERA 203

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 708 SMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKL 743
           S  +GF+EF  K+ AN    AM+  ++ GH +Q++L
Sbjct: 134 SRHYGFIEFANKDDANIAQDAMNNYLVMGHLLQVRL 169

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           V  LP     +++ + F+ FG LK VR+ + K   ++R + F+EF    +A  A D ++ 
Sbjct: 98  VSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDDANIAQDAMNN 157

Query: 826 V----HLLGRRLV 834
                HLL  RL+
Sbjct: 158 YLVMGHLLQVRLL 170

>CAGL0D05236g 499006..500337 weakly similar to sp|P43607
           Saccharomyces cerevisiae YFR032c, hypothetical start
          Length = 443

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 346 RLFLRNILYTSKEEDFRKLFSPF---GELEEVHVALDTRTGQSK--GFAYVLFKDSKNAV 400
           R+++ N+ Y+S EED R+    F     L   H     R  +++  G AYV F  S+ AV
Sbjct: 5   RIYIANVSYSSSEEDLREFLKDFNFSSVLIPCHTVRRFRRNEARSFGIAYVDFTSSEEAV 64

Query: 401 NAYVELDKQIFQGRLLHI 418
            A  EL+ + F GR+L +
Sbjct: 65  RAVEELNGKEFGGRVLRV 82

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 41/74 (55%), Gaps = 8/74 (10%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVP----KKFDKS-AR--GFAFVEFLLPKEAENA 819
           + N+ + ++ +D+ E    F    SV +P    ++F ++ AR  G A+V+F   +EA  A
Sbjct: 8   IANVSYSSSEEDLREFLKDF-NFSSVLIPCHTVRRFRRNEARSFGIAYVDFTSSEEAVRA 66

Query: 820 MDQLHGVHLLGRRL 833
           +++L+G    GR L
Sbjct: 67  VEELNGKEFGGRVL 80

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 8/84 (9%)

Query: 42  LITDVKILRDRNGESRRFG--FIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPR 99
           LI    + R R  E+R FG  ++ + + E+A  AVE  NG       + V     +   +
Sbjct: 33  LIPCHTVRRFRRNEARSFGIAYVDFTSSEEAVRAVEELNGKEFGGRVLRVRTHNPY---Q 89

Query: 100 VPQPMKEK---RREALKRFREKEE 120
            P+P+KE+   + + LK+F + E+
Sbjct: 90  PPKPIKERFGTKLQQLKKFAKYED 113

>Scas_717.41
          Length = 379

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 53/99 (53%), Gaps = 18/99 (18%)

Query: 344 TGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAY 403
           T RLF+R   +  +E +  ++F+PFG ++EV +          GFA+V F+++ +A  A 
Sbjct: 82  TTRLFVRPFPFDVQEAELNEIFTPFGPMKEVKIL--------NGFAFVEFEEADSAAKAI 133

Query: 404 VELDKQIFQGRLLHI----LPGEEKKSHRLDEFDLKNMP 438
            E++ + F  + L +    LP    K +RL    L+N+P
Sbjct: 134 EEVNGKTFANQPLEVVYSKLP---VKRYRL---TLRNLP 166

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 7/71 (9%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 826
           V+  PF+    ++ E+F  FG +K V++         GFAFVEF     A  A+++++G 
Sbjct: 87  VRPFPFDVQEAELNEIFTPFGPMKEVKI-------LNGFAFVEFEEADSAAKAIEEVNGK 139

Query: 827 HLLGRRLVMQY 837
               + L + Y
Sbjct: 140 TFANQPLEVVY 150

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 534 ILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFTKLSYKRFK 593
           + V+ FPF     EL E+F P+G ++ + +      A V+F +  SA  A  +++ K F 
Sbjct: 85  LFVRPFPFDVQEAELNEIFTPFGPMKEVKI--LNGFAFVEFEEADSAAKAIEEVNGKTFA 142

Query: 594 D 594
           +
Sbjct: 143 N 143

>CAGL0L12672g complement(1359637..1361685) similar to sp|P37838
           Saccharomyces cerevisiae YPL043w nucleolar protein,
           start by similarity
          Length = 682

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 15/93 (16%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSK--------- 397
           +F+RN+ Y + EE     FS FG ++     +D  TG +KG A+V FKD K         
Sbjct: 292 VFVRNVPYDATEESLFDHFSKFGPVKYALPVIDKNTGLAKGTAFVAFKDEKTYKYCVDNS 351

Query: 398 ---NAVNAYVE---LDKQIFQGRLLHILPGEEK 424
               A +  +    L + +++GR+L + P  E+
Sbjct: 352 PQTGATSLLIGDDVLPEYVYEGRVLAVTPTLER 384

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 75/203 (36%), Gaps = 35/203 (17%)

Query: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723
           ++F++++  S T++ L D F  F     A V    + K      S GFGFV F  ++   
Sbjct: 23  TLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKK------SRGFGFVSFAVEDDTK 76

Query: 724 AVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXX----------------- 766
             +     T +DG ++++ ++ R+                                    
Sbjct: 77  IALKEARKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDE 136

Query: 767 -----------VKNLPFEATRKDVF-ELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPK 814
                      ++N+P+         ++F  +G +    +P+K D    GFAFV      
Sbjct: 137 SSLLKGKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKIS 196

Query: 815 EAENAMDQLHGVHLLGRRLVMQY 837
             + A++    + + GR++ + +
Sbjct: 197 NCKKALEDTKNLTIDGRKVAVDF 219

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 30/45 (66%), Gaps = 1/45 (2%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLK-SVRVPKKFDKSARGFAFVEF 810
           V+N+P++AT + +F+ F+ FG +K ++ V  K    A+G AFV F
Sbjct: 294 VRNVPYDATEESLFDHFSKFGPVKYALPVIDKNTGLAKGTAFVAF 338

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/93 (21%), Positives = 47/93 (50%), Gaps = 15/93 (16%)

Query: 1  MSRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFG 60
          M  + V+ +P  +TD+ L + F+     +H+                +++D N +SR FG
Sbjct: 21 MKTLFVRSIPESVTDEQLADFFSNFAPIRHAV---------------VVKDVNKKSRGFG 65

Query: 61 FIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93
          F+ +  E+D   A++    + ++ ++++V +A+
Sbjct: 66 FVSFAVEDDTKIALKEARKTKLDGAQLKVDIAR 98

>Sklu_2407.3 YNL110C, Contig c2407 3664-4329 reverse complement
          Length = 221

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 64/113 (56%), Gaps = 13/113 (11%)

Query: 351 NILYTSK------EEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYV 404
           +I+Y S+      E +  K FS FG+L++V +A + +TG S+ +A++ F +  +A+ A  
Sbjct: 92  SIIYVSRLPQGFHERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFIEFVNKDDALVAQD 151

Query: 405 ELDKQIFQGRLLH--ILPGEEKKSHRLDEFD---LKNMPLKKQ-KELKRKAAA 451
            ++  +  G LL   +LP + KK  +L ++     +  P+KK  +ELK +A A
Sbjct: 152 TMNNYLILGHLLKVVVLP-KGKKIEKLFKYKKRVYQETPVKKDVEELKERARA 203

 Score = 36.2 bits (82), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           V  LP     +++ + F+ FG LK VR+ + K   ++R +AF+EF+   +A  A D ++ 
Sbjct: 96  VSRLPQGFHERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFIEFVNKDDALVAQDTMNN 155

Query: 826 VHLLGRRL 833
             +LG  L
Sbjct: 156 YLILGHLL 163

>Kwal_33.15208
          Length = 186

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 56/123 (45%), Gaps = 8/123 (6%)

Query: 299 AETREKSSSYATEQNESLDTKKEEQPERAVPQKTDEELAIEKINQTGRLFLRNILYTSKE 358
           AE   ++S     Q    +   E+ P  +     D E++      T  +F+ NI  +   
Sbjct: 13  AEIAAEASRLKNIQQRMANALDEQSPGISAKCDNDREVS------TRSVFVGNISQSITA 66

Query: 359 EDFRKLFS-PFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLH 417
           E+ + LF      +  V + ++   G +KGFAYV F   K+ V A VELD   F GR L 
Sbjct: 67  EELQLLFKDVVSCVNRVEIQVNRVNGLTKGFAYVEFAQPKD-VTAAVELDNVDFHGRRLR 125

Query: 418 ILP 420
           ++P
Sbjct: 126 VVP 128

>Kwal_26.7179
          Length = 456

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +F+ N+ +   EE+  K F   G++E V +  D++T   KGFAYV F+D +  VN  + L
Sbjct: 295 VFVGNLDFEETEENLWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQT-VNKALLL 353

Query: 407 DKQIFQG 413
           D Q   G
Sbjct: 354 DGQKLNG 360

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 11/94 (11%)

Query: 656 DVIDGPTV-----SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMG 710
           D +  PT      S+F+ NL+F  T +NL   F       +  V+   D K     +  G
Sbjct: 281 DSVTHPTQHDNKRSVFVGNLDFEETEENLWKHFG--KSGDIEYVRLIRDSKTN---MGKG 335

Query: 711 FGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLS 744
           F +V+FR  +  N  +  +DG  ++G   +L+++
Sbjct: 336 FAYVQFRDFQTVNKAL-LLDGQKLNGTGRKLRVT 368

>Kwal_0.250
          Length = 216

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 69/168 (41%), Gaps = 27/168 (16%)

Query: 661 PTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKE 720
           P   IFI NL +ST+ Q+L D FK           T+ D K      S GFG V F T +
Sbjct: 58  PGYEIFIANLPYSTSWQSLKDLFK------ACGNPTRADVKLDRNGRSKGFGTVIFETID 111

Query: 721 QANAVIAAMDGTVIDGHKIQLK----------------LSHRQASQSXXXXXXXXXXXXX 764
           +A   +       ++G  ++LK                +S   A Q+             
Sbjct: 112 EARTALDKFQHFDLEGRILELKRGYGPWEEEPSPVSADVSTTIAPQT-ENASGEGHKSNT 170

Query: 765 XXVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSAR--GFAFVEF 810
             V NLP+   + D+++LF + G ++  R   K+D+  +  G A V +
Sbjct: 171 IYVDNLPYATAQSDLYDLFETIGVVE--RAELKYDRKVKPTGAAIVSY 216

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 51/98 (52%), Gaps = 11/98 (11%)

Query: 336 LAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFK- 394
           L +E+ +    +F+ N+ Y++  +  + LF   G      V LD R G+SKGF  V+F+ 
Sbjct: 51  LTLERFHPGYEIFIANLPYSTSWQSLKDLFKACGNPTRADVKLD-RNGRSKGFGTVIFET 109

Query: 395 --DSKNAVNAYVELDKQIFQGRLLHI----LPGEEKKS 426
             +++ A++ +   D    +GR+L +     P EE+ S
Sbjct: 110 IDEARTALDKFQHFD---LEGRILELKRGYGPWEEEPS 144

 Score = 33.1 bits (74), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 4/72 (5%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSAR--GFAFVEFLLPKEAENAMDQLH 824
           + NLP+  + + + +LF + G     R   K D++ R  GF  V F    EA  A+D+  
Sbjct: 64  IANLPYSTSWQSLKDLFKACGN--PTRADVKLDRNGRSKGFGTVIFETIDEARTALDKFQ 121

Query: 825 GVHLLGRRLVMQ 836
              L GR L ++
Sbjct: 122 HFDLEGRILELK 133

>Scas_316.1
          Length = 483

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 15/89 (16%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDS-------KNA 399
           +F+RN+ Y + EE     FS FG+++     +D  TG +KG A+V F+D         NA
Sbjct: 244 IFVRNVPYDATEESLAAHFSKFGQVKYALPVIDRTTGLAKGTAFVAFRDHMTYKYCIDNA 303

Query: 400 VNAYVE--------LDKQIFQGRLLHILP 420
             A           L + +++GR+L I P
Sbjct: 304 PAAGSTSLLIGDDVLPEYVYEGRVLSISP 332

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 29/45 (64%), Gaps = 1/45 (2%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLK-SVRVPKKFDKSARGFAFVEF 810
           V+N+P++AT + +   F+ FGQ+K ++ V  +    A+G AFV F
Sbjct: 246 VRNVPYDATEESLAAHFSKFGQVKYALPVIDRTTGLAKGTAFVAF 290

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 767 VKNLPFEATRKDVFE-LFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           ++N+P+     +  + +F+ FG +    +PKK D    GFAFV          A++    
Sbjct: 86  IRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRDGKLCGFAFVTMKKLSNCTIALENTKD 145

Query: 826 VHLLGRRLVMQY 837
           + + GR + + +
Sbjct: 146 LKIDGRSVAVDF 157

>Kwal_26.8458
          Length = 219

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 6/77 (7%)

Query: 349 LRNILYTSK------EEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNA 402
           L  I+Y S+      E +  K FS FG+L EV +A + +TG S+ + +V F + +++  A
Sbjct: 88  LSGIIYVSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDSFVA 147

Query: 403 YVELDKQIFQGRLLHIL 419
              +   +  G LL ++
Sbjct: 148 QETMHNYLLMGHLLQVV 164

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           V  LP     +++ + F+ FG L+ VR+ + K   ++R + FVEF+  +++  A + +H 
Sbjct: 94  VSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDSFVAQETMHN 153

Query: 826 VHLLGRRL 833
             L+G  L
Sbjct: 154 YLLMGHLL 161

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 43  ITDVKILRDR-NGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEV 89
           + +V++ R++  G SR +GF+ + N+ED+F A E  +   +    ++V
Sbjct: 116 LREVRLARNKKTGNSRHYGFVEFVNKEDSFVAQETMHNYLLMGHLLQV 163

>Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement
          Length = 697

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 15/95 (15%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSK-------NA 399
           +F+RN+ Y + +E     F  FG ++     LD  TG +KG A+V FK  +       NA
Sbjct: 300 IFVRNVPYDATQESLESHFGKFGPVKYALPVLDKETGLAKGTAFVAFKTEEAFSECVDNA 359

Query: 400 VNAYVE--------LDKQIFQGRLLHILPGEEKKS 426
            +A           L + +++GR+L I P  +++S
Sbjct: 360 PSAASTSLLISDDVLPQYVYEGRILSITPSLDRES 394

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/206 (19%), Positives = 81/206 (39%), Gaps = 23/206 (11%)

Query: 647 EGSSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKT 706
           +G   + ++D +D  T  +F++++ F   ++   D F  F   +   V  K   K     
Sbjct: 12  DGLKQSPNDDGLDMKT--LFVRSIPFDANDEEFADFFSQFAP-IKHSVIVKDSEKQ---- 64

Query: 707 LSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQ--------------ASQSX 752
            S GFGFV F  ++     +A           +++ ++ R+               S   
Sbjct: 65  -SRGFGFVSFAVEDDTKEALAQARKAKFKNRLLRIDIAKRRERSKRNEPRQESEHKSYKE 123

Query: 753 XXXXXXXXXXXXXXVKNLPFEATRKDVFE-LFNSFGQLKSVRVPKKFDKSARGFAFVEFL 811
                         ++N+P+      V + LF+ FG +   ++PKK      GFAFV   
Sbjct: 124 SNEEELMKGKPKLIIRNMPWSCRDAAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMK 183

Query: 812 LPKEAENAMDQLHGVHLLGRRLVMQY 837
                + A+++   + + GR++ + +
Sbjct: 184 KLSACKRAIEEGKDMKIDGRQVAIDF 209

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLK-SVRVPKKFDKSARGFAFVEF 810
           V+N+P++AT++ +   F  FG +K ++ V  K    A+G AFV F
Sbjct: 302 VRNVPYDATQESLESHFGKFGPVKYALPVLDKETGLAKGTAFVAF 346

>Scas_558.1
          Length = 435

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 74/356 (20%), Positives = 132/356 (37%), Gaps = 83/356 (23%)

Query: 534 ILVKNFPFGTTREELGEMFLPYGKLERL-LMPPAG---TIAIVQFRDTTSARAAFTKLSY 589
           I V N  +  T E+L + F   G++ R  ++   G    +  V+F ++     A  +   
Sbjct: 107 IFVGNLTYDCTPEDLRDYFSGIGEVVRADIITSKGHHRGMGTVEFTNSRDVEEAIRQYDS 166

Query: 590 KRFKDGIIYL--ERGPKDCFTKPAEADDLINNTSAKEEENPVE--VKPSSNDLMEANKDV 645
             F D  I++  +  P D               + + E  P      PSS       +D+
Sbjct: 167 SYFMDRQIFVRQDNPPPD---------------NGRNERTPSRRTTAPSSR-----QQDI 206

Query: 646 TEGSSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGK 705
           + G+ +    ++  G    IF+ NL +S   Q L D FK     + A V+        G+
Sbjct: 207 SSGAYSMQ-SNMKQG--YEIFVANLPYSINWQALKDMFKECGDVMRADVELD----RAGR 259

Query: 706 TLSMGFGFVEFRTKEQANAVIAAMDGTVIDG--------------------HKIQLKLSH 745
             S GFG V FRT++     I   +   +DG                    H+ Q  +++
Sbjct: 260 --SRGFGTVIFRTRDDMERAIDRYNRFEVDGRTLDVREGHSNNRNDDMNIQHQTQNAMTN 317

Query: 746 RQASQSXXXXXXXXXXXXXXX----------------------VKNLPFEATRKDVFELF 783
              S +                                       NLP    R D+++LF
Sbjct: 318 DATSDATSNERSLPTQPSEPASNRTSTFTEGVVEGGERNTLIYCSNLPPSTARSDLYDLF 377

Query: 784 NSFGQLKSVRVPKKFDKSAR--GFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQY 837
            S G++++  +  K+D++    G A VEF+   +A+  +++L+  +  G  L + Y
Sbjct: 378 ESIGKVRNAEL--KYDRNGETTGVAIVEFISQDDADVCIERLNKYNYGGCDLEISY 431

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 4/82 (4%)

Query: 339 EKINQ--TGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDS 396
           EK+N+     +F+ N+ Y    ED R  FS  GE+  V   + T  G  +G   V F +S
Sbjct: 97  EKVNRNYANSIFVGNLTYDCTPEDLRDYFSGIGEV--VRADIITSKGHHRGMGTVEFTNS 154

Query: 397 KNAVNAYVELDKQIFQGRLLHI 418
           ++   A  + D   F  R + +
Sbjct: 155 RDVEEAIRQYDSSYFMDRQIFV 176

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 49/93 (52%), Gaps = 9/93 (9%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFK---DSKNAVNAY 403
           +F+ N+ Y+   +  + +F   G++    V LD R G+S+GF  V+F+   D + A++ Y
Sbjct: 223 IFVANLPYSINWQALKDMFKECGDVMRADVELD-RAGRSRGFGTVIFRTRDDMERAIDRY 281

Query: 404 VELDKQIFQGRLLHILPGEEKKSHRLDEFDLKN 436
              +     GR L +  G    ++R D+ ++++
Sbjct: 282 NRFE---VDGRTLDVREGH--SNNRNDDMNIQH 309

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 55/252 (21%), Positives = 98/252 (38%), Gaps = 35/252 (13%)

Query: 512 SKGVDLTKFSQLKSTNQRDDKVILVKNFPFGTTREELGEMFLPYGKLER--LLMPPAG-- 567
           S+  D++  +    +N +    I V N P+    + L +MF   G + R  + +  AG  
Sbjct: 201 SRQQDISSGAYSMQSNMKQGYEIFVANLPYSINWQALKDMFKECGDVMRADVELDRAGRS 260

Query: 568 -TIAIVQFRDTTSARAAFTKLSYKRFK-DG-IIYLERGPKDCF---------TKPAEADD 615
                V FR       A  +  Y RF+ DG  + +  G  +           T+ A  +D
Sbjct: 261 RGFGTVIFRTRDDMERAIDR--YNRFEVDGRTLDVREGHSNNRNDDMNIQHQTQNAMTND 318

Query: 616 LINNTSAKEEENPVE-VKPSSNDLMEANKDVTEGSSNAHDEDVIDGPTVSIFIKNLNFST 674
             ++ ++ E   P +  +P+SN      + V EG                I+  NL  ST
Sbjct: 319 ATSDATSNERSLPTQPSEPASNRTSTFTEGVVEGGER----------NTLIYCSNLPPST 368

Query: 675 TNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANAVIAAMDGTVI 734
              +L D F+       A++K        G+T   G   VEF +++ A+  I  ++    
Sbjct: 369 ARSDLYDLFESIGKVRNAELKY----DRNGET--TGVAIVEFISQDDADVCIERLNKYNY 422

Query: 735 DGHKIQLKLSHR 746
            G  +++  + R
Sbjct: 423 GGCDLEISYAKR 434

>KLLA0B00847g complement(65983..66792) similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35 translation
           initiation factor eIF3 (p33 subunit) singleton, start by
           similarity
          Length = 269

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 362 RKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLH 417
           R+L  PFGE+  V V  +  TG+S+G AYV F+  + A  A   L+ + F   +LH
Sbjct: 202 RELLFPFGEIPRVFVVKNPETGRSRGVAYVTFQTEEIAAQALKLLEGRGFMNFMLH 257

>YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1
           snRNA-associated protein with RNA recognition (RRM)
           domain, homologous to human 70 kDa U1 snRNP protein [903
           bp, 300 aa]
          Length = 300

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 38/60 (63%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +F+  + Y   E + +K F  FGE+E++ +  D  T +SKG+A+++FKD  ++  A+ E+
Sbjct: 109 IFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEI 168

 Score = 33.1 bits (74), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 37/62 (59%), Gaps = 2/62 (3%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           +  LP++    ++ + F  FG+++ +R+ K K  + ++G+AF+ F  P  ++ A  ++ G
Sbjct: 111 IGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEI-G 169

Query: 826 VH 827
           VH
Sbjct: 170 VH 171

>KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces
           cerevisiae YPL043w NOP4 nucleolar protein, start by
           similarity
          Length = 685

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 37/67 (55%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 826
           V+ +PFE+T ++    F+ F  +K   + K  + ++RGF FV F +  + + A++Q    
Sbjct: 19  VRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGEGASRGFGFVSFAVEDDTKTALNQARKT 78

Query: 827 HLLGRRL 833
             +GR L
Sbjct: 79  KFMGRLL 85

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 48/96 (50%), Gaps = 17/96 (17%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVE- 405
           +F+RN+ Y + +E   + F  FG ++     +D  TG +KG A+V F+ S++A N  +  
Sbjct: 298 IFVRNVPYDATQESLERHFGVFGPVKYALPVIDKETGLAKGTAFVAFR-SEDAYNDCLNN 356

Query: 406 ---------------LDKQIFQGRLLHILPGEEKKS 426
                            + +++GR+L I P  +++S
Sbjct: 357 APATGSTSLLISDDVSPEYVYEGRVLAISPTLDRES 392

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 47/219 (21%), Positives = 82/219 (37%), Gaps = 26/219 (11%)

Query: 530 DDKVILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFTKLSY 589
           D K + V+  PF +T EE G  F  +  ++  ++           +D   A   F  +S+
Sbjct: 13  DLKTLFVRGVPFESTDEEFGNFFSQFSPIKHAVI----------VKDGEGASRGFGFVSF 62

Query: 590 KRFKDGIIYLERGPKDCFTKPAEADDLIN---NTSAKEEENPVEVKPSSNDLMEANKDVT 646
               D    L +  K  F       D+      +  K++ + V   PS +++ +      
Sbjct: 63  AVEDDTKTALNQARKTKFMGRLLRIDIAKRRERSRGKKDADEVSSAPSVDNVKD-----E 117

Query: 647 EGSSNAHDEDVIDGPTVSIFIKNLNFSTTNQN-LTDRFKVFTGFVVAQVKTKPDPKHQGK 705
           E S    D D++ G    + I+N+ +S  +   L   F ++   V A +  K D +    
Sbjct: 118 EESKPEDDNDLMKGKP-KLIIRNMPWSCRDPTKLKKIFGLYGTVVEATIPRKRDGRL--- 173

Query: 706 TLSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLS 744
               GF FV         A I       IDG K+ +  +
Sbjct: 174 ---CGFAFVTMNRISNCKAAIEGTKDLKIDGRKVAVDFA 209

>Kwal_27.11832
          Length = 686

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 86/207 (41%), Gaps = 25/207 (12%)

Query: 648 GSSNAHD-EDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKT 706
           G SN+   +D++D  T  +F++++ F  T++ L + F        A V  K D K+    
Sbjct: 7   GESNSSSRKDLLDMKT--LFVRSIPFDATDEELANYFSNLAPIKHA-VIVKDDQKN---- 59

Query: 707 LSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQ---------------ASQS 751
            S GFGFV F  ++     +     T   G  +++ ++ R+                S  
Sbjct: 60  -SRGFGFVSFAVEDDTKDALDKARKTKFKGRLLRVDIAKRRDRTKKDQNAAAGSEDTSGP 118

Query: 752 XXXXXXXXXXXXXXXVKNLPFEATRKDVF-ELFNSFGQLKSVRVPKKFDKSARGFAFVEF 810
                          V+N+P+     D   ++F  +G +   ++PK+ D    GFAFV  
Sbjct: 119 QDKEDELLGGKPKLIVRNMPWSVRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTM 178

Query: 811 LLPKEAENAMDQLHGVHLLGRRLVMQY 837
                 + A+++   + + GR++ + +
Sbjct: 179 KKLASCKIAIEESKSLKIGGRQVAVDF 205

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 15/90 (16%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKD----------- 395
           +F+RN+ Y + +E   + F+ FG ++      D  TG +KG A+V+F+            
Sbjct: 293 VFVRNVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSAFVVFQTQEAFDECVNNA 352

Query: 396 -SKNAVNAYVELD---KQIFQGRLLHILPG 421
            +    +  +  D   + ++ GR+L I P 
Sbjct: 353 PASGTTSLLISDDVPYRYVYDGRILSIAPA 382

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LF+R+I + + +E+    FS    ++   +  D +   S+GF +V F    +  +A  + 
Sbjct: 23  LFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQK-NSRGFGFVSFAVEDDTKDALDKA 81

Query: 407 DKQIFQGRLLHI 418
            K  F+GRLL +
Sbjct: 82  RKTKFKGRLLRV 93

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 30/45 (66%), Gaps = 1/45 (2%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLK-SVRVPKKFDKSARGFAFVEF 810
           V+N+P++AT++ + E FN FG +K ++ V  K    A+G AFV F
Sbjct: 295 VRNVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSAFVVF 339

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 40/93 (43%), Gaps = 15/93 (16%)

Query: 1  MSRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFG 60
          M  + V+ +P   TD+ L  +F+     KH+                I++D    SR FG
Sbjct: 20 MKTLFVRSIPFDATDEELANYFSNLAPIKHAV---------------IVKDDQKNSRGFG 64

Query: 61 FIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93
          F+ +  E+D  DA++    +      + V +AK
Sbjct: 65 FVSFAVEDDTKDALDKARKTKFKGRLLRVDIAK 97

>YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with
           similarity to Rlf6p, contains three RNA recognition
           motif (RRM) domains [1290 bp, 429 aa]
          Length = 429

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 71/330 (21%), Positives = 122/330 (36%), Gaps = 68/330 (20%)

Query: 534 ILVKNFPFGTTREELGEMFLPYGKLERL-LMPPAG---TIAIVQFRDTTSARAAFTKLSY 589
           I V N  + +T E+L E F   GK+ R  ++   G    +  V+F ++     A      
Sbjct: 138 IFVGNLTYDSTPEDLTEFFSQIGKVVRADIITSRGHHRGMGTVEFTNSDDVDRAI----- 192

Query: 590 KRFKDGIIYLERGPKDCFTKPAEADDLINNTSAKEEENPVEVKPSSNDLMEANK-DVTEG 648
            R  DG  +++R     F +               ++NP    P SN++ E    D  E 
Sbjct: 193 -RQYDGAFFMDR---KIFVR---------------QDNP----PPSNNIKERKALDRGEL 229

Query: 649 SSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLS 708
             N    +VI        +KNL  S   Q L D FK       A V+        G  +S
Sbjct: 230 RHNRKTHEVI--------VKNLPASVNWQALKDIFKECGNVAHADVEL------DGDGVS 275

Query: 709 MGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLS---------------------HRQ 747
            G G V F   +  +  I   +G  I+G+ + +K                       + +
Sbjct: 276 TGSGTVSFYDIKDLHRAIEKYNGYSIEGNVLDVKSKESVHNHSDGDDVDIPMDDSPVNEE 335

Query: 748 ASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAF 807
           A +                  NLPF   + D+++LF + G++ +  +      +  G A 
Sbjct: 336 ARKFTENVVGGGERNRLIYCSNLPFSTAKSDLYDLFETIGKVNNAELRYDSKGAPTGIAV 395

Query: 808 VEFLLPKEAENAMDQLHGVHLLGRRLVMQY 837
           VE+    +A+  +++L+  +  G  L + Y
Sbjct: 396 VEYDNVDDADVCIERLNNYNYGGCDLDISY 425

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 66/177 (37%), Gaps = 14/177 (7%)

Query: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723
           SIF+ NL + +T ++LT+ F      V A + T        +    G G VEF   +  +
Sbjct: 137 SIFVGNLTYDSTPEDLTEFFSQIGKVVRADIITS-------RGHHRGMGTVEFTNSDDVD 189

Query: 724 AVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXX-------XXXXXXXXXVKNLPFEATR 776
             I   DG      KI ++  +   S +                      VKNLP     
Sbjct: 190 RAIRQYDGAFFMDRKIFVRQDNPPPSNNIKERKALDRGELRHNRKTHEVIVKNLPASVNW 249

Query: 777 KDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833
           + + ++F   G +    V    D  + G   V F   K+   A+++ +G  + G  L
Sbjct: 250 QALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYNGYSIEGNVL 306

>YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           and a glutamine-rich region [2019 bp, 672 aa]
          Length = 672

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 347 LFLRNILYTSKEEDFRKLF-SPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVE 405
           LF+ ++  T+ E D   LF + F  ++ V V  D  TG S+ F +V F D      A +E
Sbjct: 194 LFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDERRRALIE 253

Query: 406 LDKQIFQGRLLHI 418
           +  + FQGR L +
Sbjct: 254 MSGKWFQGRALRV 266

>Kwal_47.18572
          Length = 363

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 42/76 (55%), Gaps = 8/76 (10%)

Query: 344 TGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAY 403
           T RLF+R   +  ++ +  ++F PFG ++EV +          GFA+V F+++ +A  A 
Sbjct: 81  TTRLFVRPFPFDVQDSELNEIFGPFGPMKEVKIL--------NGFAFVEFEEADSAARAI 132

Query: 404 VELDKQIFQGRLLHIL 419
            E++ + F  + L ++
Sbjct: 133 EEVNGKTFANQPLEVV 148

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 7/71 (9%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 826
           V+  PF+    ++ E+F  FG +K V++         GFAFVEF     A  A+++++G 
Sbjct: 86  VRPFPFDVQDSELNEIFGPFGPMKEVKI-------LNGFAFVEFEEADSAARAIEEVNGK 138

Query: 827 HLLGRRLVMQY 837
               + L + Y
Sbjct: 139 TFANQPLEVVY 149

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 534 ILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFTKLSYKRFK 593
           + V+ FPF     EL E+F P+G ++ + +      A V+F +  SA  A  +++ K F 
Sbjct: 84  LFVRPFPFDVQDSELNEIFGPFGPMKEVKI--LNGFAFVEFEEADSAARAIEEVNGKTFA 141

Query: 594 D 594
           +
Sbjct: 142 N 142

>Scas_376.1
          Length = 404

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 85/189 (44%), Gaps = 20/189 (10%)

Query: 665 IFIKNLNFSTTNQNLTDRFKVFTGFV----VAQVKTK-------PDPKHQGKTL-SMGFG 712
           ++I NL F TT + L    K+FT       V +V  +       P   + GK + + GF 
Sbjct: 129 VWIGNLTFDTTKEEL---IKLFTAKTRENEVGKVTEEDIVRVHMPLAHNDGKKIKNKGFC 185

Query: 713 FVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHR---QASQSXXXXXXXXXXXXXXXVKN 769
           +++F+T EQ  ++I  +  + ++G  + +K S     +  ++               V N
Sbjct: 186 YMDFKTNEQMESIIK-LSESQLNGRNMLIKDSKSYEGRPDKNDLVSLSKNPPSRILFVGN 244

Query: 770 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAENAMDQLHGVHL 828
           L F+ T + + + F   G++  +R+    D    +GFAF++F   + A NA+       +
Sbjct: 245 LSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALKDKTCRKI 304

Query: 829 LGRRLVMQY 837
             R + M+Y
Sbjct: 305 AARPIRMEY 313

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 46/87 (52%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LF+ N+ + + +E  +K F   GE+ ++ +A    +G+ KGFA++ F+  + A NA  + 
Sbjct: 240 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALKDK 299

Query: 407 DKQIFQGRLLHILPGEEKKSHRLDEFD 433
             +    R + +  GE++   ++   D
Sbjct: 300 TCRKIAARPIRMEYGEDRSKRQVKRRD 326

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 43/202 (21%), Positives = 80/202 (39%), Gaps = 43/202 (21%)

Query: 534 ILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFTKLSYKRFK 593
           + + N  F TT+EEL ++F    +           +  V   D             K+ K
Sbjct: 129 VWIGNLTFDTTKEELIKLFTAKTR--------ENEVGKVTEEDIVRVHMPLAHNDGKKIK 180

Query: 594 D-GIIYLERGPKDCFTKPAEADDLINNTSAK--------EEENPVEVKPSSNDLMEANKD 644
           + G  Y++      F    + + +I  + ++        ++    E +P  NDL+  +K 
Sbjct: 181 NKGFCYMD------FKTNEQMESIIKLSESQLNGRNMLIKDSKSYEGRPDKNDLVSLSK- 233

Query: 645 VTEGSSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQG 704
                         + P+  +F+ NL+F TT++ L   F+     V  ++ T  D    G
Sbjct: 234 --------------NPPSRILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQD---SG 276

Query: 705 KTLSMGFGFVEFRTKEQANAVI 726
           K    GF F++FR++E A   +
Sbjct: 277 KC--KGFAFIDFRSEEGATNAL 296

>CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces
           cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
           processing factor CF I, hypothetical start
          Length = 280

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 40/70 (57%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           ++L +I Y   EE    L S  G +  + +  D++TG+SKG+A+V ++D +++ +A   L
Sbjct: 18  VYLGSIPYDQTEEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNL 77

Query: 407 DKQIFQGRLL 416
           +      RLL
Sbjct: 78  NGYQLGSRLL 87

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFLLPKEAENAMDQL 823
           + ++P++ T + + +L ++ G + S+++   FD     ++G+AFV++   + + +A+  L
Sbjct: 20  LGSIPYDQTEEQILDLCSNVGPVVSLKM--MFDSQTGKSKGYAFVQYQDLESSASAVRNL 77

Query: 824 HGVHLLGRRLVMQY 837
           +G  L  R L   Y
Sbjct: 78  NGYQLGSRLLKCGY 91

>CAGL0H03861g complement(361189..362520) similar to sp|P38922
           Saccharomyces cerevisiae YNL004w HRB1, start by
           similarity
          Length = 443

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 63/277 (22%), Positives = 107/277 (38%), Gaps = 72/277 (25%)

Query: 323 QPERAV-PQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTR 381
           +P++AV PQK   EL I            N+ Y+   +  + +F  FG++ + +V +D+ 
Sbjct: 205 KPKKAVKPQKKGYELMI-----------LNLPYSISWQTLKTMFKEFGDVLKANVEVDS- 252

Query: 382 TGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHILPGEEKKSHRLDEFDLKNMPLKK 441
           TG S G   V+FK+ ++ V AY   +    +G++L +                     + 
Sbjct: 253 TGMSIGVGNVIFKNQEDMVKAYEHFNGFEIEGKVLEV---------------------RG 291

Query: 442 QKELKRKAAASRQTFSWNSLYMNQDAVLGSVAAKLGLEKSQLIDAENSSSAVKQALAEAH 501
           Q     + +++R+T        N+D  +    A+ G EK+   D  +   A  Q      
Sbjct: 292 QIPDPTQISSTRKTDDLTVNQDNEDIEMDIDTAEGGDEKALKADVSSDGGARAQ------ 345

Query: 502 VIGDVRKYFESKGVDLTKFSQLKSTNQRD-DKVILVKNFPFGTTREELGEMFLPYGKLER 560
                            KFS        D  K+IL  N P  TT  +L ++F   GK++ 
Sbjct: 346 ----------------NKFSSDDYVKTEDKSKIILCDNLPGATTEGDLYDLFETLGKVKT 389

Query: 561 LLMPPAGTI----------AIVQFRDTTSARAAFTKL 587
                AG I          AIV + +   A   + +L
Sbjct: 390 -----AGFINTDNAGETVSAIVIYNEQDDAEVCYGRL 421

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 65/189 (34%), Gaps = 24/189 (12%)

Query: 662 TVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQ 721
           T SIF+ NL +  T ++L D F      V A + T        +    G G VEF + E+
Sbjct: 106 TNSIFVGNLTYDCTPEDLKDFFSQVGKVVRADIITS-------RGHHRGMGTVEFTSGEE 158

Query: 722 ANAVIAAMDGTVIDGHKIQLK-----------------LSHRQASQSXXXXXXXXXXXXX 764
            +  I   DG  +   +I ++                   H                   
Sbjct: 159 VDEAIRKFDGAYLMNRQIFVRQDNPPPESSSTHSSGSNSGHTTNVTKPKKAVKPQKKGYE 218

Query: 765 XXVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLH 824
             + NLP+  + + +  +F  FG +    V       + G   V F   ++   A +  +
Sbjct: 219 LMILNLPYSISWQTLKTMFKEFGDVLKANVEVDSTGMSIGVGNVIFKNQEDMVKAYEHFN 278

Query: 825 GVHLLGRRL 833
           G  + G+ L
Sbjct: 279 GFEIEGKVL 287

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 38/71 (53%), Gaps = 3/71 (4%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSA-RGFAFVEFLLPKEAENAMDQLHG 825
           V NL ++ T +D+ + F+  G++  VR      +   RG   VEF   +E + A+ +  G
Sbjct: 111 VGNLTYDCTPEDLKDFFSQVGKV--VRADIITSRGHHRGMGTVEFTSGEEVDEAIRKFDG 168

Query: 826 VHLLGRRLVMQ 836
            +L+ R++ ++
Sbjct: 169 AYLMNRQIFVR 179

>Scas_598.1
          Length = 516

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 54/98 (55%), Gaps = 12/98 (12%)

Query: 324 PERAVPQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVAL---DT 380
           P+RA+P+        E+ ++TG++F+  I    + ++F + F+ +G + +  + L   D 
Sbjct: 271 PKRAIPR--------EEQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQLMLLMLDK 322

Query: 381 RTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418
            TG+S+GF ++ + DS  AV+   +     F+G+ + I
Sbjct: 323 DTGRSRGFGFITY-DSSEAVDRVCQNKYIDFKGKQIEI 359

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 49/85 (57%), Gaps = 5/85 (5%)

Query: 343 QTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNA 402
           +  +LF+  + + + E+  +  FS +G + ++ +  D  TG+S+GF ++ F+ S ++V+ 
Sbjct: 198 ECCKLFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELS-SSVDE 256

Query: 403 YVELDKQIFQGRLL---HILPGEEK 424
            V+  + I  G+++     +P EE+
Sbjct: 257 VVKT-QHILDGKVIDPKRAIPREEQ 280

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 32/77 (41%), Gaps = 8/77 (10%)

Query: 662 TVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQ 721
              +FI  LN+ TT   L D F  +   V  ++      K      S GFGF+ F     
Sbjct: 199 CCKLFIGGLNWETTEDKLKDYFSKYGNVVDLKIM-----KDNATGRSRGFGFLTFELSSS 253

Query: 722 ANAVIAA---MDGTVID 735
            + V+     +DG VID
Sbjct: 254 VDEVVKTQHILDGKVID 270

>CAGL0H10604g complement(1033488..1034738) similar to sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1, hypothetical
           start
          Length = 416

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 44/86 (51%), Gaps = 5/86 (5%)

Query: 662 TVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQ 721
           T ++F+ +LN    ++ L   F+ F  F+ A V         G+  S G+GFV F  +E+
Sbjct: 145 TFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWD---MQTGR--SRGYGFVSFSNQEE 199

Query: 722 ANAVIAAMDGTVIDGHKIQLKLSHRQ 747
           A   + AM G  + G +I++  + ++
Sbjct: 200 AQKAMDAMQGKDLSGRQIRINWATKR 225

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 73/176 (41%), Gaps = 17/176 (9%)

Query: 665 IFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANA 724
           +++ NL+ S T   L   F+   G  +  VK   D K++     + + FVE+     AN 
Sbjct: 60  LYVGNLDKSITEDLLKQYFQA--GGPIQNVKIIEDMKNE----YVNYAFVEYIRSHDANV 113

Query: 725 VIAAMDGTVIDGH--KIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVFEL 782
            +  ++G  ++    KI      +QA+++               V +L  +   + +   
Sbjct: 114 ALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLF--------VGDLNVDVDDETLAGT 165

Query: 783 FNSFGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQY 837
           F  F       V        +RG+ FV F   +EA+ AMD + G  L GR++ + +
Sbjct: 166 FREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINW 221

 Score = 36.6 bits (83), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 35/75 (46%)

Query: 344 TGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAY 403
           T  LF+ ++     +E     F  F    + HV  D +TG+S+G+ +V F + + A  A 
Sbjct: 145 TFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAM 204

Query: 404 VELDKQIFQGRLLHI 418
             +  +   GR + I
Sbjct: 205 DAMQGKDLSGRQIRI 219

>CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces
           cerevisiae YOR319w essential yeast splicing factor,
           hypothetical start
          Length = 211

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 37/59 (62%), Gaps = 1/59 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLH 824
           V N+  + T++ ++ELF   GQ+K V+ PK K  +  +GFAF+EF    +A+  ++ ++
Sbjct: 10  VGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLNVMN 68

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 83/188 (44%), Gaps = 22/188 (11%)

Query: 661 PTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKE 720
           P  +I++ N++   T + L   +++FT   V QVK    PK +      GF F+EF +  
Sbjct: 4   PEATIYVGNIDTKVTKELL---YELFTQ--VGQVKKVKYPKDKISQEYQGFAFIEFFSTA 58

Query: 721 QANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXX--------XXXXXXXXXXXXVKNLPF 772
            A+ V+  M+  V    K+   L  R+++Q+                       VK++  
Sbjct: 59  DADYVLNVMNNNVKLYQKV---LKIRRSNQAVQKDDANKKHELDASLLPVAKVFVKDIAD 115

Query: 773 EATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFLLPKEAENAMDQLHGVHLL 829
               + + +LF+ FG L   + P+ F  S    R  AF+ F     A+ A+  L+G  ++
Sbjct: 116 TVEVRHLTQLFSKFGPL--AKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFIM 172

Query: 830 GRRLVMQY 837
            ++  ++Y
Sbjct: 173 NKKASLEY 180

>Kwal_0.370
          Length = 560

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/164 (20%), Positives = 70/164 (42%), Gaps = 20/164 (12%)

Query: 650 SNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSM 709
           +N+++  V      S+FI +L+ + T + L D F+VF   +  ++    +       +S+
Sbjct: 2   NNSYNPCVTSQKVSSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSE-----TGISL 56

Query: 710 GFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKN 769
           G+G++ F + + A   I       + G ++++  S R +                    N
Sbjct: 57  GYGYLNFYSSKDAETAIETFSYVNLFGREVRIMPSMRNS-------YFRKNIGTNVFFSN 109

Query: 770 LPFE---ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEF 810
           LP E    T +  +E F  +G++ S ++ ++     +   FV F
Sbjct: 110 LPLEQPALTTRVFYETFREYGKVLSCKLDRR-----KNIGFVYF 148

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 826
           VKNLPF    +D+   F+  G +KSV    K +     + FV +    +   A+D L+G 
Sbjct: 229 VKNLPFNICNEDLLNYFSRIGPVKSV-FTSKLEAYRSSWGFVTYKKGCDTRKALDSLNGA 287

Query: 827 HLLGRRL 833
             + RRL
Sbjct: 288 IFMDRRL 294

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 3/80 (3%)

Query: 365 FSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHILPGEEK 424
           F  F  L  V + +D+ TG S G+ Y+ F  SK+A  A          GR + I+P    
Sbjct: 35  FRVFPSLISVKICVDSETGISLGYGYLNFYSSKDAETAIETFSYVNLFGREVRIMPSMRN 94

Query: 425 KSHRLD---EFDLKNMPLKK 441
              R +        N+PL++
Sbjct: 95  SYFRKNIGTNVFFSNLPLEQ 114

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 83/219 (37%), Gaps = 38/219 (17%)

Query: 534 ILVKNFPF---GTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFTKLSYK 590
           +   N P      T     E F  YGK+    +     I  V F    +AR A    + K
Sbjct: 105 VFFSNLPLEQPALTTRVFYETFREYGKVLSCKLDRRKNIGFVYFESDAAARKAIASYNNK 164

Query: 591 RFKDGIIY--------LERGPKDCFTKPAEADDLINNTSAKEEENPVEVKPSSNDLMEAN 642
            +   I+         + R P+  F K      L + T AKE           N L E N
Sbjct: 165 EYYGNIVTCGLHFDKDIRRSPE--FEK--RRSRLGSLTVAKE-----------NLLSENN 209

Query: 643 KDVTEGSSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKH 702
            ++       HD++  D    SI +KNL F+  N++L + F       +  VK+    K 
Sbjct: 210 VELEN-----HDQNSKDPHPNSIHVKNLPFNICNEDLLNYFS-----RIGPVKSVFTSKL 259

Query: 703 QGKTLSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQL 741
           +    S  +GFV ++        + +++G +    ++++
Sbjct: 260 EAYRSS--WGFVTYKKGCDTRKALDSLNGAIFMDRRLEV 296

>Kwal_26.7522
          Length = 262

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 38/70 (54%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           ++L +I Y   EE    L S  G +  + +  D +TG+SKG+A+V +KD + + +A   L
Sbjct: 14  VYLGSIPYDQTEEQILDLCSNVGPVVNLKMMFDPQTGKSKGYAFVEYKDLEASASAVRNL 73

Query: 407 DKQIFQGRLL 416
           +      RLL
Sbjct: 74  NGYQLGNRLL 83

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 43/71 (60%), Gaps = 6/71 (8%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFLLPKEAENAMDQL 823
           + ++P++ T + + +L ++ G + ++++   FD     ++G+AFVE+   + + +A+  L
Sbjct: 16  LGSIPYDQTEEQILDLCSNVGPVVNLKM--MFDPQTGKSKGYAFVEYKDLEASASAVRNL 73

Query: 824 HGVHLLGRRLV 834
           +G   LG RL+
Sbjct: 74  NGYQ-LGNRLL 83

>YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleolar
           protein with similarity to Nsr1p, has two RNA
           recognition (RRM) domains [1212 bp, 403 aa]
          Length = 403

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 52/97 (53%)

Query: 333 DEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVL 392
           D+ +A+ K   +  LF+ N+ +   ++  RK F   G++ ++ +A    +G+ KGFA++ 
Sbjct: 227 DDLVAMSKNPPSRILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFID 286

Query: 393 FKDSKNAVNAYVELDKQIFQGRLLHILPGEEKKSHRL 429
           FK+ + + N   +   +   GR L +  GE++   ++
Sbjct: 287 FKNEEGSTNELKDKSCRKIAGRPLRMEYGEDRSKRQV 323

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 81/197 (41%), Gaps = 33/197 (16%)

Query: 665 IFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPK----HQGKT-LSM---------- 709
           ++I NL+F TT  +L         F +A+ K   D K     Q  T LSM          
Sbjct: 127 VWIGNLSFDTTKDDLVR-------FFIAKTKDNEDEKSRVTEQDITRLSMPRVAAKNSNA 179

Query: 710 ----GFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXX 765
               GF ++ F+  EQ  AV+  +  + ++G  + +K S   + +               
Sbjct: 180 MKNKGFCYMFFKNVEQMKAVLE-LSESHLNGRNMLIKDSENYSGRPDKDDLVAMSKNPPS 238

Query: 766 X---VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS--ARGFAFVEFLLPKEAENAM 820
               V NL F+ T   + + F   G +  +R+   F+ S   +GFAF++F   + + N +
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMAT-FEDSGKCKGFAFIDFKNEEGSTNEL 297

Query: 821 DQLHGVHLLGRRLVMQY 837
                  + GR L M+Y
Sbjct: 298 KDKSCRKIAGRPLRMEY 314

>Scas_643.16
          Length = 448

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +F+ N+ +   EE+    F   GE+E V +  D +T   KGFAYV FK+ ++   A +  
Sbjct: 277 IFVGNLDFEEDEENLWNHFKSCGEIEYVRIIRDPKTNMGKGFAYVQFKELESVNKALLLN 336

Query: 407 DKQI 410
           +KQ+
Sbjct: 337 EKQM 340

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723
           SIF+ NL+F    +NL + FK  +   +  V+   DPK     +  GF +V+F+  E  N
Sbjct: 276 SIFVGNLDFEEDEENLWNHFK--SCGEIEYVRIIRDPK---TNMGKGFAYVQFKELESVN 330

Query: 724 AVI 726
             +
Sbjct: 331 KAL 333

>Scas_671.4
          Length = 443

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 5/85 (5%)

Query: 662 TVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQ 721
           T ++F+ +LN    ++ L+  F  F  +V A V         G+  S G+GFV F  +EQ
Sbjct: 170 TFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWD---MQTGR--SRGYGFVSFADQEQ 224

Query: 722 ANAVIAAMDGTVIDGHKIQLKLSHR 746
           A   +  M G  I+G  +++  + +
Sbjct: 225 AQEAMNVMQGMPINGRAVRINWATK 249

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 34/75 (45%)

Query: 344 TGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAY 403
           T  LF+ ++     +E     F  F    + HV  D +TG+S+G+ +V F D + A  A 
Sbjct: 170 TFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAM 229

Query: 404 VELDKQIFQGRLLHI 418
             +      GR + I
Sbjct: 230 NVMQGMPINGRAVRI 244

 Score = 37.4 bits (85), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 36/174 (20%), Positives = 75/174 (43%), Gaps = 13/174 (7%)

Query: 665 IFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANA 724
           +++ NL+ S     L   F+V  G  +  VK   D K+     ++ + F+E+     AN 
Sbjct: 85  LYVGNLDKSINEDLLKQYFQV--GGQITDVKIMVDKKNN----NVNYAFIEYLKSHDANV 138

Query: 725 VIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVFELFN 784
            +  ++G  I+G  +++  +  Q+ Q+               V +L  +   + +   F+
Sbjct: 139 ALQTLNGIQIEGKTVRINWAF-QSQQT-----TNSDDTFNLFVGDLNVDVDDETLSHAFD 192

Query: 785 SFGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQY 837
            F       V        +RG+ FV F   ++A+ AM+ + G+ + GR + + +
Sbjct: 193 QFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINW 246

 Score = 33.5 bits (75), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%)

Query: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMA 92
           ITDVKI+ D+   +  + FI Y    DA  A++  NG  I    + ++ A
Sbjct: 109 ITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWA 158

>ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH]
           complement(734486..735007) [522 bp, 173 aa]
          Length = 173

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 44  TDVKILRDR-NGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPR 99
           TD+K++RDR  GESR FGF+ Y ++     AV+  NG  +N     + +   F +PR
Sbjct: 61  TDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNG--VNLCGRVLKVDHCFYEPR 115

 Score = 37.4 bits (85), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%)

Query: 358 EEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLH 417
           E D   +FS FG   ++ +  D  TG+S+GF ++ ++D ++ V A   L+     GR+L 
Sbjct: 47  EGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCGRVLK 106

Query: 418 I 418
           +
Sbjct: 107 V 107

 Score = 37.0 bits (84), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 5/68 (7%)

Query: 769 NLPFEATRKDVFELFNSFG---QLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
            L  E T  D+  +F+ FG    LK VR   +    +RGF F+++   +    A+D L+G
Sbjct: 40  GLNVELTEGDILTVFSQFGVPTDLKLVR--DRETGESRGFGFLKYEDQRSTVLAVDNLNG 97

Query: 826 VHLLGRRL 833
           V+L GR L
Sbjct: 98  VNLCGRVL 105

>Kwal_23.5864
          Length = 278

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 36/60 (60%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +F+  + YT  E + +K F  FGE+E+V V  D  + +S+G+ +++FK+   A  A  E+
Sbjct: 103 VFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACREI 162

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEF---LLPKEAENAMDQ 822
           V  LP+  T  ++ + F  FG+++ VRV + K    +RG+ F+ F   L  + A   +  
Sbjct: 105 VGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACREIGV 164

Query: 823 LHGVHLLGRRLVM 835
             GV + GR +++
Sbjct: 165 HRGVEIGGRPVIV 177

>YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved in
           18S and 25S rRNA processing, export of RNA from the
           nucleus, import of proteins into the nucleus, associated
           with U1 snRNP, has 2 RNA recognition (RRM) domains [1245
           bp, 414 aa]
          Length = 414

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 8/74 (10%)

Query: 346 RLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVE 405
           RLF+R      +E +  ++F PFG ++EV +          GFA+V F+++++A  A  E
Sbjct: 126 RLFVRPFPLDVQESELNEIFGPFGPMKEVKIL--------NGFAFVEFEEAESAAKAIEE 177

Query: 406 LDKQIFQGRLLHIL 419
           +  + F  + L ++
Sbjct: 178 VHGKSFANQPLEVV 191

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 7/71 (9%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 826
           V+  P +    ++ E+F  FG +K V++         GFAFVEF   + A  A++++HG 
Sbjct: 129 VRPFPLDVQESELNEIFGPFGPMKEVKI-------LNGFAFVEFEEAESAAKAIEEVHGK 181

Query: 827 HLLGRRLVMQY 837
               + L + Y
Sbjct: 182 SFANQPLEVVY 192

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 534 ILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFTKLSYKRFK 593
           + V+ FP      EL E+F P+G ++ + +      A V+F +  SA  A  ++  K F 
Sbjct: 127 LFVRPFPLDVQESELNEIFGPFGPMKEVKI--LNGFAFVEFEEAESAAKAIEEVHGKSFA 184

Query: 594 D 594
           +
Sbjct: 185 N 185

>CAGL0H04763g 454589..455740 highly similar to sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3, hypothetical
           start
          Length = 383

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 41/74 (55%), Gaps = 8/74 (10%)

Query: 346 RLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVE 405
           RLF+R      +E +  ++F PFG ++EV +          GFA+V F+++++A  A  E
Sbjct: 106 RLFVRPFPLDVQESELNEIFGPFGAMKEVKIL--------NGFAFVEFEEAESASKAIEE 157

Query: 406 LDKQIFQGRLLHIL 419
           ++ + F  + L ++
Sbjct: 158 VNGKTFANQPLEVM 171

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 7/59 (11%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           V+  P +    ++ E+F  FG +K V++         GFAFVEF   + A  A+++++G
Sbjct: 109 VRPFPLDVQESELNEIFGPFGAMKEVKI-------LNGFAFVEFEEAESASKAIEEVNG 160

 Score = 33.9 bits (76), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 39/90 (43%), Gaps = 22/90 (24%)

Query: 534 ILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAA---------- 583
           + V+ FP      EL E+F P+G ++ + +      A V+F +  SA  A          
Sbjct: 107 LFVRPFPLDVQESELNEIFGPFGAMKEVKI--LNGFAFVEFEEAESASKAIEEVNGKTFA 164

Query: 584 -------FTKLSYKRFKDGIIYLERGPKDC 606
                  F+K+  KRF+   I L+  P+ C
Sbjct: 165 NQPLEVMFSKMPVKRFR---ITLKNLPEGC 191

>KLLA0A08338g 736461..738761 weakly similar to sp|P39684
           Saccharomyces cerevisiae YFR023w PES4 DNA-directed DNA
           polymerase epsilon suppressor, start by similarity
          Length = 766

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFD-KSARGFAFVEFLLPKEAENAMDQLHG 825
           + +LP   T   +  +FN F    SV++    + K + G+ ++ F  PK+AENA+D+ + 
Sbjct: 142 IGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFGDPKDAENAVDEYNY 201

Query: 826 VHLLGRRLVM 835
           + + GR + M
Sbjct: 202 MPIFGREIRM 211

 Score = 37.0 bits (84), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVP--KKFDKSARGFAFVEFLLPKEAENAMDQLH 824
           VKNLP   +  ++   F+  G +KSV      KFD S   +AF+ +   ++ + A+++L+
Sbjct: 390 VKNLPINPSHDNLLNFFSKIGPVKSVYTSDVSKFDSS---WAFITYKRIQDTKTAIEKLN 446

Query: 825 GVHLLGRRL 833
           G   + R +
Sbjct: 447 GCKYMKRTI 455

>AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH]
           (1446842..1447978) [1137 bp, 378 aa]
          Length = 378

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 46/89 (51%), Gaps = 5/89 (5%)

Query: 662 TVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQ 721
           T ++F+ +LN    ++ L+  FK F  F+ A V         G+  S G+GFV F  +E+
Sbjct: 121 TFNLFVGDLNVDVDDETLSSTFKEFPTFIQAHVMWD---MQSGR--SRGYGFVSFGEQEE 175

Query: 722 ANAVIAAMDGTVIDGHKIQLKLSHRQASQ 750
           A   + A  G  ++G  I++  + ++ SQ
Sbjct: 176 AQKAMDAKQGFNLNGRAIRVNWAAKRESQ 204

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 74/179 (41%), Gaps = 24/179 (13%)

Query: 665 IFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANA 724
           +++ NL+ +     L   F+V  G  +A VK   D  ++       + FVE+R    AN 
Sbjct: 37  LYVGNLDKTINEATLKQYFQV--GGPIANVKVLVDKNNE----EANYAFVEYRQPRDANV 90

Query: 725 VIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVFELFN 784
               +DG  I+ + I++  + +    S               V     + T    F+ F 
Sbjct: 91  AFQTLDGKQIENNVIKINWAFQSQQVSSDDTFNLFVGDLNVDVD----DETLSSTFKEFP 146

Query: 785 SFGQ------LKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQY 837
           +F Q      ++S R        +RG+ FV F   +EA+ AMD   G +L GR + + +
Sbjct: 147 TFIQAHVMWDMQSGR--------SRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNW 197

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 38  SGPDLITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMA 92
            GP  I +VK+L D+N E   + F+ YR   DA  A +  +G  I  + I+++ A
Sbjct: 58  GGP--IANVKVLVDKNNEEANYAFVEYRQPRDANVAFQTLDGKQIENNVIKINWA 110

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 29/59 (49%)

Query: 344 TGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNA 402
           T  LF+ ++     +E     F  F    + HV  D ++G+S+G+ +V F + + A  A
Sbjct: 121 TFNLFVGDLNVDVDDETLSSTFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKA 179

>Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement
          Length = 281

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%)

Query: 362 RKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLH 417
           ++L  PFG + +V V  +T TG+S+G +Y+ F+  + A  A   LD + F   +LH
Sbjct: 216 QELLFPFGRIPKVVVVRNTETGRSRGISYITFETEEIAETALNFLDGRGFMNLILH 271

>ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH]
           complement(854587..855867) [1281 bp, 426 aa]
          Length = 426

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +F+ N+ +   EE   K F   G +E V +  D +T   KGFAYV F D  +   A +  
Sbjct: 261 VFVGNLDFEESEESLWKHFMSCGPIEYVRIVRDPKTNVGKGFAYVQFADLVSVNKALLLN 320

Query: 407 DKQ--IFQGRLLHI 418
           DK+  + +GR L +
Sbjct: 321 DKKMAVGKGRKLRV 334

>AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH]
           (736609..737409) [801 bp, 266 aa]
          Length = 266

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 2/90 (2%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           ++L +I Y   E+    L S  G +  + +  D +TG+SKG+A++ FKD   + +A   L
Sbjct: 13  VYLGSIPYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFKDLATSSSAVRNL 72

Query: 407 DKQIFQGRLLHILPGEEKKSHRLDEFDLKN 436
           +      R L    G        +E+ L N
Sbjct: 73  NGYALGNRTLKC--GYTTGGGISEEYSLSN 100

 Score = 33.1 bits (74), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 40/74 (54%), Gaps = 5/74 (6%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFLLPKEAENAMDQL 823
           + ++P++ T + + +L ++ G +  +++   FD     ++G+AF+EF     + +A+  L
Sbjct: 15  LGSIPYDQTEQQILDLCSNVGPVTGLKM--MFDPQTGKSKGYAFIEFKDLATSSSAVRNL 72

Query: 824 HGVHLLGRRLVMQY 837
           +G  L  R L   Y
Sbjct: 73  NGYALGNRTLKCGY 86

>ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH]
           complement(1034093..1034902) [810 bp, 269 aa]
          Length = 269

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%)

Query: 362 RKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418
           +KL SPF  +  V V  +  TG+S+G AYV F   K+A  A   L  + F   +L +
Sbjct: 206 QKLLSPFPNVPRVAVVRNKETGRSRGIAYVTFASEKDAETALRLLHGRGFMNLILQV 262

>YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component of
           pre-mRNA cleavage and polyadenylation factor I (CFI),
           involved in poly(A) site choice, interacts with Rna14p,
           Pap1p, and Pcf11p, contains one RNA recognition (RRM)
           domain [891 bp, 296 aa]
          Length = 296

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 38/70 (54%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           ++L +I Y   EE    L S  G +  + +  D +TG+SKG+A++ F+D +++ +A   L
Sbjct: 20  VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNL 79

Query: 407 DKQIFQGRLL 416
           +      R L
Sbjct: 80  NGYQLGSRFL 89

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFLLPKEAENAMDQL 823
           + ++P++ T + + +L ++ G + ++++   FD     ++G+AF+EF   + + +A+  L
Sbjct: 22  LGSIPYDQTEEQILDLCSNVGPVINLKM--MFDPQTGRSKGYAFIEFRDLESSASAVRNL 79

Query: 824 HGVHLLGRRLVMQY 837
           +G  L  R L   Y
Sbjct: 80  NGYQLGSRFLKCGY 93

>KLLA0E08745g 782800..784227 some similarities with sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1 major
           polyadenylated RNA-binding protein of nucleus and
           cytoplasm, hypothetical start
          Length = 475

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 91/235 (38%), Gaps = 38/235 (16%)

Query: 620 TSAKEEENPVEVKPSSNDLMEANKDVTEGSSNAHDEDVIDGPTVS-----------IFIK 668
           T+   EE P   KP+S D    N D  +      +ED    P ++           +++ 
Sbjct: 46  TAPATEEAPASEKPASQD---NNGDGEKQQEEGDEEDDSAAPVLATQGGREKSDKILYVG 102

Query: 669 NLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANAVIAA 728
           NL  S  +  L   F++  G  ++ VK  PD   Q       + FVE+     AN     
Sbjct: 103 NLPKSIDDDLLKQYFQI--GGSISSVKIIPDKNSQ----ECNYAFVEYFEPHDANVAYQT 156

Query: 729 MDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVFELFNSFGQ 788
           ++G  ++G  +++  + +    +               V     +AT    F+ F SF Q
Sbjct: 157 LNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVD----DATLAGTFKEFPSFIQ 212

Query: 789 ------LKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQY 837
                 ++S R        +RG+ FV F    +A+ AM+   G  L GR L + +
Sbjct: 213 AHVMWDMQSGR--------SRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINW 259

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 6/91 (6%)

Query: 662 TVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQ 721
           T ++F+ +LN    +  L   FK F  F+ A V         G+  S G+GFV F  ++Q
Sbjct: 183 TFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWD---MQSGR--SRGYGFVSFGEQDQ 237

Query: 722 ANAVIAAMDGTVIDGHKIQLKL-SHRQASQS 751
           A   +    G  ++G  +++   S R+  QS
Sbjct: 238 AQVAMETKQGFELNGRALRINWASKREPQQS 268

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 15/89 (16%)

Query: 4   IIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFGFIG 63
           + V  LP  + DD L+++F            + GS    I+ VKI+ D+N +   + F+ 
Sbjct: 99  LYVGNLPKSIDDDLLKQYFQ-----------IGGS----ISSVKIIPDKNSQECNYAFVE 143

Query: 64  YRNEEDAFDAVEYFNGSFINTSKIEVSMA 92
           Y    DA  A +  NG  +    ++++ A
Sbjct: 144 YFEPHDANVAYQTLNGKEVEGKVLKINWA 172

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 4/79 (5%)

Query: 342 NQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVN 401
           ++T  LF+ ++     +      F  F    + HV  D ++G+S+G+ +V F +   A  
Sbjct: 181 DETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQV 240

Query: 402 AYVELDKQIFQ--GRLLHI 418
           A     KQ F+  GR L I
Sbjct: 241 AME--TKQGFELNGRALRI 257

>CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces
           cerevisiae YBR212w Negative growth regulatory protein,
           hypothetical start
          Length = 802

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 767 VKNLPFEATRKDVFELFNS-FGQLKSVRV-PKKFDKSARGFAFVEFLLPKEAENAMDQLH 824
           V +L   AT  D+  LF + F  +K+VRV       ++R F FV F   +E   A+ +++
Sbjct: 238 VGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALIEMN 297

Query: 825 GVHLLGRRLVMQY 837
           GVH  GR L + Y
Sbjct: 298 GVHFQGRTLRVAY 310

>YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in
           splicing and spliceosome assembly, has a role in sodium
           tolerance [447 bp, 148 aa]
          Length = 148

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +++ N+     E D   +FS +G   +V ++ D  TG+S+GFAY+ ++D ++ + A   L
Sbjct: 33  IYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNL 92

Query: 407 DKQIFQGRLLHI 418
           +     GR L I
Sbjct: 93  NGFKIGGRALKI 104

>KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor
           singleton, start by similarity
          Length = 432

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 8/127 (6%)

Query: 711 FGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNL 770
           F +V+  + E A      ++G  I+ +K+  K+S+   ++                VKNL
Sbjct: 157 FAYVDLVSPEVAKKATNRLNGIEINNYKLVAKISN--VNERTERTDNAISDGREIIVKNL 214

Query: 771 PFEATRKDVFELFNSFGQLKSVRVPKKFDKSARG----FAFVEFLLPKEAENAMDQLHGV 826
           P + T  D+ ++FN FG  +  R+    D++  G    +AF+ F     A+NA+  L+G 
Sbjct: 215 PDDITIDDLIKMFNEFGDTEKARIVTG-DETNPGRHSRYAFITFKNKASADNAL-SLNGA 272

Query: 827 HLLGRRL 833
            + G+ L
Sbjct: 273 VMNGKPL 279

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 3/62 (4%)

Query: 359 EDFRKLFSPFGELEEVHVAL--DTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLL 416
           +D  K+F+ FG+ E+  +    +T  G+   +A++ FK+  +A NA + L+  +  G+ L
Sbjct: 221 DDLIKMFNEFGDTEKARIVTGDETNPGRHSRYAFITFKNKASADNA-LSLNGAVMNGKPL 279

Query: 417 HI 418
           H+
Sbjct: 280 HV 281

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 791 SVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQ 836
           S+R+P     S R FA+V+ + P+ A+ A ++L+G+ +   +LV +
Sbjct: 143 SIRLPSLAFNSRRRFAYVDLVSPEVAKKATNRLNGIEINNYKLVAK 188

>Scas_697.10
          Length = 610

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 78/193 (40%), Gaps = 25/193 (12%)

Query: 649 SSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKT-L 707
           + ++H   +   P  ++FI +LN   T + L   F V+  FV A+V       +  +T +
Sbjct: 87  TQSSHSTKLESKPFTALFIGDLNEDVTKETLESIFGVYPSFVSAKV------CYDFQTNV 140

Query: 708 SMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXV 767
           S+G G++ F  KE A   I   +   +    I++  S R  +                  
Sbjct: 141 SLGHGYLNFGDKEDAEKAIDDFNCMKLGDKVIRIMPSLRGKN-------TKKSIGTNVFF 193

Query: 768 KNLPFEATR----KDVFELFNSFGQLKSVRV-PKKFDKSARGFAFVEFLLPKEAENAMDQ 822
            NLP E  R    +  FE+F  FG++ S R+ P K         F+ F   + A+  + +
Sbjct: 194 TNLPDEDNRLFHSRKFFEIFRQFGKILSCRLDPNK------NIGFISFEHEEVAKTVVKK 247

Query: 823 LHGVHLLGRRLVM 835
            +     G R+  
Sbjct: 248 YNNSMFFGNRITC 260

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 4/91 (4%)

Query: 47  KILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPRVPQPMKE 106
           KIL  R   ++  GFI + +EE A   V+ +N S    ++I   +    ++    +P+ E
Sbjct: 218 KILSCRLDPNKNIGFISFEHEEVAKTVVKKYNNSMFFGNRITCGI---LSEDNSKKPIME 274

Query: 107 KRREALKRFREKEEKL-LQEENRKKKKVDEN 136
           +++E  K+F +  +K  L E+N  +  ++ N
Sbjct: 275 EKQEQAKQFSQLNKKYDLNEKNMPRALLNTN 305

>KLLA0D05016g complement(431592..432380) similar to sp|P25555
           Saccharomyces cerevisiae YCL011c GBP2 potential
           telomere-associated protein, start by similarity
          Length = 262

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 38/91 (41%), Gaps = 12/91 (13%)

Query: 652 AHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGF 711
           AHDE         +F+  L FS   Q L D FK     + A V T  D K      S GF
Sbjct: 57  AHDEGF------EVFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGK------SRGF 104

Query: 712 GFVEFRTKEQANAVIAAMDGTVIDGHKIQLK 742
           G V   TKEQ N  I    GT   G  + +K
Sbjct: 105 GTVYMATKEQQNDAIRHWTGTEYKGRVLDVK 135

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +F+  + ++   ++ + +F P G++    V  D R G+S+GF  V     +   +A    
Sbjct: 64  VFVAQLPFSVNWQELKDMFKPCGDVLHADVVTD-RDGKSRGFGTVYMATKEQQNDAIRHW 122

Query: 407 DKQIFQGRLLHI 418
               ++GR+L +
Sbjct: 123 TGTEYKGRVLDV 134

>CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces
           cerevisiae YIL061c SNP1 U1 small nuclear
           ribonucleoprotein, hypothetical start
          Length = 299

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNA 399
           +F+  + Y + E   +K+F+ +GE+  V V  D +  +S+G+A+VLFK++ +A
Sbjct: 117 VFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRD-KQNKSRGYAFVLFKETDSA 168

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 9/75 (12%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENA------M 820
           V  LP++     + ++F  +G++  VRV +     +RG+AFV F   KE ++A      +
Sbjct: 119 VGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLF---KETDSARVCTRDI 175

Query: 821 DQLHGVHLLGRRLVM 835
               G+ + GRR ++
Sbjct: 176 GVHRGIQINGRRCIV 190

>Scas_621.16
          Length = 314

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 37/70 (52%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           ++L +I Y   EE    L +  G +  + +  D +TG+SKG+A++ FKD + + +A   L
Sbjct: 46  VYLGSIPYDQTEEQILDLCNNVGPVINLKMMFDPQTGKSKGYAFIEFKDLETSASAIRNL 105

Query: 407 DKQIFQGRLL 416
           +      R L
Sbjct: 106 NGYQLGSRFL 115

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFLLPKEAENAMDQL 823
           + ++P++ T + + +L N+ G + ++++   FD     ++G+AF+EF   + + +A+  L
Sbjct: 48  LGSIPYDQTEEQILDLCNNVGPVINLKM--MFDPQTGKSKGYAFIEFKDLETSASAIRNL 105

Query: 824 HGVHLLGRRLVMQY 837
           +G  L  R L   Y
Sbjct: 106 NGYQLGSRFLKCGY 119

>Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement
          Length = 257

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           ++L +I Y   EE    L S  G +  + +  D +TG+SKG+A+V +KD + + +A   L
Sbjct: 15  VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLEASNSAVRNL 74

Query: 407 DKQIFQGRLLHI 418
           +      R L  
Sbjct: 75  NGYQLGNRFLKC 86

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFLLPKEAENAMDQL 823
           + ++P++ T + + +L ++ G + ++++   FD     ++G+AFVE+   + + +A+  L
Sbjct: 17  LGSIPYDQTEEQILDLCSNVGPVTNLKM--MFDPQTGKSKGYAFVEYKDLEASNSAVRNL 74

Query: 824 HGVHLLGRRLVMQY 837
           +G  L  R L   Y
Sbjct: 75  NGYQLGNRFLKCGY 88

>Kwal_27.11447
          Length = 439

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 5/85 (5%)

Query: 662 TVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQ 721
           T ++F+ +LN    ++ L + FK    F+ A V         G+  S G+GFV F  + Q
Sbjct: 148 TFNLFVGDLNVDVDDETLANTFKHVPTFIQAHVMWD---MQTGR--SRGYGFVSFGEQVQ 202

Query: 722 ANAVIAAMDGTVIDGHKIQLKLSHR 746
           A   +    GTV++G  I++  + +
Sbjct: 203 AQKAMEEKQGTVVNGRAIRINWASK 227

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 76/191 (39%), Gaps = 48/191 (25%)

Query: 665 IFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANA 724
           +++ NL+ + T   L   F+V  G  +A VK   D  ++       + FVEF     A+ 
Sbjct: 64  LYVGNLDLAVTEDMLKQYFQV--GGAIANVKILMDKNNK----EANYAFVEFHQPHDASV 117

Query: 725 VIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFEATRKDVFELF- 783
               +DG  I+ H I++      A QS                     + + +D F LF 
Sbjct: 118 AFQTLDGKQIENHVIKINY----AFQSQ--------------------QVSSEDTFNLFV 153

Query: 784 -------------NSFGQLKS-VRVPKKFDKS---ARGFAFVEFLLPKEAENAMDQLHGV 826
                        N+F  + + ++    +D     +RG+ FV F    +A+ AM++  G 
Sbjct: 154 GDLNVDVDDETLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGT 213

Query: 827 HLLGRRLVMQY 837
            + GR + + +
Sbjct: 214 VVNGRAIRINW 224

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 33/75 (44%)

Query: 344 TGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAY 403
           T  LF+ ++     +E     F       + HV  D +TG+S+G+ +V F +   A  A 
Sbjct: 148 TFNLFVGDLNVDVDDETLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAM 207

Query: 404 VELDKQIFQGRLLHI 418
            E    +  GR + I
Sbjct: 208 EEKQGTVVNGRAIRI 222

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 16/91 (17%)

Query: 3   RIIVKG-LPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFGF 61
           RI+  G L + +T+D L+++F            V G+    I +VKIL D+N +   + F
Sbjct: 62  RILYVGNLDLAVTEDMLKQYFQ-----------VGGA----IANVKILMDKNNKEANYAF 106

Query: 62  IGYRNEEDAFDAVEYFNGSFINTSKIEVSMA 92
           + +    DA  A +  +G  I    I+++ A
Sbjct: 107 VEFHQPHDASVAFQTLDGKQIENHVIKINYA 137

>Kwal_27.10364
          Length = 443

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 62/132 (46%), Gaps = 12/132 (9%)

Query: 711 FGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNL 770
           F +V+  + E+A  ++  + G V+D H++ +KLS+    ++               +KNL
Sbjct: 160 FAYVDMASSEEAKLIVDRLHGFVVDNHELIIKLSN--PLKAEKRTDSDVLERRQVYLKNL 217

Query: 771 P-FEATRKDVFELFNSFGQLKSVRVPKKFDKSAR--------GFAFVEFLLPKEAENAMD 821
             F  + + + + F+ +G ++ + +P K +            GF FV F     A +++ 
Sbjct: 218 DYFRVSEEIISKSFSKYGHIERISLPHKEEPGLSGAEKRLNDGFGFVTFSESTSAASSL- 276

Query: 822 QLHGVHLLGRRL 833
           QL G  L GR++
Sbjct: 277 QLDGSELEGRKI 288

 Score = 37.0 bits (84), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 51/98 (52%), Gaps = 6/98 (6%)

Query: 654 DEDVIDGPTVSIFIKNLN-FSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQG--KTLSMG 710
           D DV++   V  ++KNL+ F  + + ++  F  +       +  K +P   G  K L+ G
Sbjct: 203 DSDVLERRQV--YLKNLDYFRVSEEIISKSFSKYGHIERISLPHKEEPGLSGAEKRLNDG 260

Query: 711 FGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQA 748
           FGFV F     A + +  +DG+ ++G KI + L+ R+A
Sbjct: 261 FGFVTFSESTSAASSLQ-LDGSELEGRKISVTLADRKA 297

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFG-QLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           V N P      ++ +LF+ FG  + S+R P     S R FA+V+    +EA+  +D+LHG
Sbjct: 121 VTNYPPLFGELELQKLFSQFGGTVLSIRFPSLRYDSHRRFAYVDMASSEEAKLIVDRLHG 180

Query: 826 VHLLGRRLVMQ 836
             +    L+++
Sbjct: 181 FVVDNHELIIK 191

>KLLA0D13420g complement(1157491..1157991) some similarities with
           sp|P40565 Saccharomyces cerevisiae YIR005w IST3
           singleton, hypothetical start
          Length = 166

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 34/61 (55%)

Query: 358 EEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLH 417
           E D   +FS +G   ++ +  D  TG+SKGF ++ ++D ++ + A   L+     GRL+ 
Sbjct: 47  EADILTIFSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLIR 106

Query: 418 I 418
           +
Sbjct: 107 V 107

 Score = 35.4 bits (80), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 44  TDVKILRDRN-GESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPR 99
            D+K++RD+  G+S+ FGF+ Y ++     AV+  NG+ +    I V  A  F  PR
Sbjct: 61  VDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLIRVDHA--FYRPR 115

>KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces
           cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
           processing factor CF I singleton, hypothetical start
          Length = 258

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%)

Query: 342 NQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVN 401
           N +  ++L +I Y   E+    L    G +  + +  D  TG+SKG+A++ FKD   + +
Sbjct: 5   NPSRTVYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPTTGKSKGYAFIEFKDLATSAS 64

Query: 402 AYVELDKQIFQGRLL 416
           A   L+      R L
Sbjct: 65  AVRNLNGYTLGSRSL 79

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 41/74 (55%), Gaps = 5/74 (6%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFLLPKEAENAMDQL 823
           + ++P++ T + + +L  + G + ++++   FD +   ++G+AF+EF     + +A+  L
Sbjct: 12  LGSIPYDQTEQQILDLCQTIGPVTAMKM--MFDPTTGKSKGYAFIEFKDLATSASAVRNL 69

Query: 824 HGVHLLGRRLVMQY 837
           +G  L  R L   Y
Sbjct: 70  NGYTLGSRSLKCGY 83

>Kwal_56.24709
          Length = 828

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 42/95 (44%), Gaps = 2/95 (2%)

Query: 326 RAVPQKTDEELAI--EKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTG 383
           RA P  +   +++    +   G L++R I      +D   +FS FG +  + +  D+ +G
Sbjct: 220 RASPIVSKWSVSVNAHALTHPGNLYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSG 279

Query: 384 QSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418
            S G+ ++ +     A     EL+  +  G  L I
Sbjct: 280 DSLGYGFLSYPLGSQASRCIKELNGNLMNGSALFI 314

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 16/85 (18%)

Query: 4   IIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRD-RNGESRRFGFI 62
           + V+G+P  LT D+L   F+K              GP  +  +KI+ D  +G+S  +GF+
Sbjct: 243 LYVRGIPKDLTIDDLVPVFSKF-------------GP--VLSLKIICDSHSGDSLGYGFL 287

Query: 63  GYRNEEDAFDAVEYFNGSFINTSKI 87
            Y     A   ++  NG+ +N S +
Sbjct: 288 SYPLGSQASRCIKELNGNLMNGSAL 312

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 60/138 (43%), Gaps = 22/138 (15%)

Query: 301 TREKSSSYATEQNESLDTKKEEQPERAVPQKTDEELAIE-KINQTGRLFLRNILYTSKEE 359
           T  +SS+  + +N SL      Q    + Q +   L I  K  Q   L+++++  + ++E
Sbjct: 567 TTPESSTAPSSRNGSL--YPPMQTPAGIVQSSPFMLPIPTKDQQESNLYVKHLPMSWRDE 624

Query: 360 DFRKLFSPFGELEEVHVAL------------------DTRTGQSKGFAYVLFKDSKNAVN 401
           DF + +  FGE+    +                    +   G SKG+ +V FK+  +A  
Sbjct: 625 DFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPALGSSKGYGFVCFKNPLDASR 684

Query: 402 AYVELDK-QIFQGRLLHI 418
           A +  D+ Q+ +   L++
Sbjct: 685 AMMITDRYQVDENHTLYV 702

>KLLA0C05522g 494240..495862 some similarities with sp|P32831
           Saccharomyces cerevisiae YBR212w NGR1
           glucose-repressible RNA-binding protein, hypothetical
           start
          Length = 540

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 771 PFEATRKDVFELFNS-FGQLKSVRV-PKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHL 828
           PF AT  D+  LF + +  +K+VRV       ++R F FV F    E  NA+ +++GV  
Sbjct: 168 PF-ATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNALIEMNGVQF 226

Query: 829 LGRRLVMQY 837
            GR+L + Y
Sbjct: 227 QGRQLRVAY 235

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 5/59 (8%)

Query: 779 VFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVMQY 837
           +FELF  FG +  V++P       +   FV++    EAE A++ L G  ++G  + + +
Sbjct: 461 LFELFKPFGTITDVKIPP-----GKQCGFVKYNERLEAEAAINGLQGFIIMGSPIRLSW 514

>CAGL0F01023g complement(108155..109345) similar to tr|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, hypothetical
           start
          Length = 396

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYV 404
           +F+ N+ +   EE   K F   G +E V +  D +T   KGFAYV F + ++   A +
Sbjct: 230 VFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQFNELQSVSKALL 287

>Kwal_33.13496
          Length = 330

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 38/72 (52%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LF+  +   ++ +D   +FS FG +E+V +  D  TG S  + ++ F +  +   AY ++
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 407 DKQIFQGRLLHI 418
           +  +   R +H+
Sbjct: 309 EGVLIDDRRIHV 320

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 5/80 (6%)

Query: 665 IFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANA 724
           +FI  LN  T  ++L   F  F    + +V+   D K  G   S+ +GF+EF  K    A
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFG--TIEKVEIVRD-KETGA--SLHYGFIEFTNKSSCEA 303

Query: 725 VIAAMDGTVIDGHKIQLKLS 744
             + M+G +ID  +I +   
Sbjct: 304 AYSKMEGVLIDDRRIHVDFC 323

>ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH]
           (1024792..1025754) [963 bp, 320 aa]
          Length = 320

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 7/71 (9%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 826
           VK  P +    ++ E+F+ +G LK V++         GFAFVEF  P+ AE A+  ++G 
Sbjct: 41  VKPFPPDVEEHELDEIFSPYGALKEVKL-------MSGFAFVEFEKPESAEQAIKDVNGK 93

Query: 827 HLLGRRLVMQY 837
                 L + Y
Sbjct: 94  MFADMPLTVSY 104

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 534 ILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFTKLSYKRFK 593
           + VK FP      EL E+F PYG L+ + +      A V+F    SA  A   ++ K F 
Sbjct: 39  LHVKPFPPDVEEHELDEIFSPYGALKEVKL--MSGFAFVEFEKPESAEQAIKDVNGKMFA 96

Query: 594 D 594
           D
Sbjct: 97  D 97

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 344 TGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAY 403
           T RL ++      +E +  ++FSP+G L+EV +          GFA+V F+  ++A  A 
Sbjct: 36  TTRLHVKPFPPDVEEHELDEIFSPYGALKEVKLM--------SGFAFVEFEKPESAEQAI 87

Query: 404 VELDKQIF 411
            +++ ++F
Sbjct: 88  KDVNGKMF 95

>AEL217W [2289] [Homologous to ScYGR250C - SH]
           complement(225217..227721) [2505 bp, 834 aa]
          Length = 834

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 35/78 (44%)

Query: 341 INQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAV 400
           +   G L++R I      +D   +FS FG +  + + +D  T +S G+ ++ +     A 
Sbjct: 213 LTHPGNLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAA 272

Query: 401 NAYVELDKQIFQGRLLHI 418
               EL+  +  G  L I
Sbjct: 273 RCIKELNGNLMNGSPLFI 290

 Score = 36.6 bits (83), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 17/92 (18%)

Query: 343 QTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHV--------------AL-DTRTGQSKG 387
           Q   L++++I  + ++ED    +S +GE+    +              AL D   G S+G
Sbjct: 597 QESNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTSRG 656

Query: 388 FAYVLFKDSKNAVNAYVELDKQIFQGRLLHIL 419
           + +V FK+  +A  A +  D+  FQ    H+L
Sbjct: 657 YGFVCFKNPLDASRAMMATDR--FQVGTNHVL 686

>Sklu_1706.1 YFR023W, Contig c1706 1364-3382
          Length = 672

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/176 (19%), Positives = 71/176 (40%), Gaps = 20/176 (11%)

Query: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722
           V++FI +L+   T + L D F  +   V  ++      K      S+G+G++ F   E A
Sbjct: 102 VALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKR-----SLGYGYINFSNDEDA 156

Query: 723 NAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFE---ATRKDV 779
                  +   + G ++++  S R +                    NLP E    T +  
Sbjct: 157 EKATEEFNYVPLFGKEVRIMPSLRNS-------FYRKNIGTNVFFSNLPLENLSLTTRAF 209

Query: 780 FELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVM 835
           ++ F  +G++ S ++ ++     +   F+ F     A++A+D  +G    G  ++ 
Sbjct: 210 YDTFKKYGKILSCKLDRR-----KNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMC 260

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           VKNLP  A   D+ + F+  G +KSV    K  K    +AFV +    +   A+++L+G
Sbjct: 316 VKNLPVNANEDDILDFFSRIGPVKSV-FTSKVPKYNSSWAFVTYKKGSDTSEAIEKLNG 373

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 58/138 (42%), Gaps = 11/138 (7%)

Query: 290 RRVRIKESEAETREKSSSYATEQNESLDTKKEEQPERAVPQKTDEELAIEKINQTGRLFL 349
           R VR K  E E R+      T   E L T  E++ +   P          K      +F+
Sbjct: 266 REVR-KSPEFEKRKSKLDGMTIIKEKLMTDDEQELQEVAPG--------TKAPHPNAIFV 316

Query: 350 RNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQ 409
           +N+   + E+D    FS  G ++ V  +   +   S  +A+V +K   +   A  +L+ +
Sbjct: 317 KNLPVNANEDDILDFFSRIGPVKSVFTSKVPKYNSS--WAFVTYKKGSDTSEAIEKLNGE 374

Query: 410 IFQGRLLHILPGEEKKSH 427
           IF+ R + +   ++   H
Sbjct: 375 IFKHRKIEVARAQKNFQH 392

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 40/96 (41%), Gaps = 17/96 (17%)

Query: 4   IIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFGFIG 63
           I VK LPV   +D++ + F++              GP        +   N     + F+ 
Sbjct: 314 IFVKNLPVNANEDDILDFFSR-------------IGPVKSVFTSKVPKYNSS---WAFVT 357

Query: 64  YRNEEDAFDAVEYFNGSFINTSKIEVSMA-KSFADP 98
           Y+   D  +A+E  NG      KIEV+ A K+F  P
Sbjct: 358 YKKGSDTSEAIEKLNGEIFKHRKIEVARAQKNFQHP 393

>AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C
           (GBP2) - SH] complement(309542..310555) [1014 bp, 337
           aa]
          Length = 337

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 45/250 (18%), Positives = 96/250 (38%), Gaps = 48/250 (19%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +F+ N+ Y+   +  + +F    E+    V++D   G S+GF  V     +N + A    
Sbjct: 109 IFVANLPYSISWQTLKDMFKECSEVIHADVSVDA-DGYSRGFGTVYVTTRENQIAAIERW 167

Query: 407 DKQIFQGRLLHILPG---EEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSWNSLYM 463
           +    +GR+L +  G   +   + R D +  K +P                ++ ++  Y 
Sbjct: 168 NGYELEGRILEVREGKGTDVGSAGRGDSYVPKQIP----------------SYDYDGEYR 211

Query: 464 NQDAVLGSVAAKLGLEKSQLIDAENSSSAVKQALAEAHVIGDVRKYFESKGVDLTKFSQL 523
             +             +++L  +EN+S +V          G     +E       +F+  
Sbjct: 212 GTEV------------RAELPHSENASVSVS---------GKASPEYEQYTPSDVEFTSK 250

Query: 524 KSTNQRDDKVILVKNFPFGTTREELGEMFLPYGKLERLLMP------PAGTIAIVQFRDT 577
            +     +++I  +N P  T   +L ++F   GK+ R  +       P G+ ++ +F   
Sbjct: 251 AAPGGAKNRIIYCENMPLATAESDLYDLFETAGKVLRANLQYDSEGNPTGS-SVCEFETV 309

Query: 578 TSARAAFTKL 587
             A+    +L
Sbjct: 310 ADAQECIERL 319

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 665 IFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANA 724
           IF+ NL +S + Q L D FK  +  + A V    D        S GFG V   T+E   A
Sbjct: 109 IFVANLPYSISWQTLKDMFKECSEVIHADVSVDAD------GYSRGFGTVYVTTRENQIA 162

Query: 725 VIAAMDGTVIDGHKIQLK 742
            I   +G  ++G  ++++
Sbjct: 163 AIERWNGYELEGRILEVR 180

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/71 (22%), Positives = 34/71 (47%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 826
            +N+P      D+++LF + G++    +    + +  G +  EF    +A+  +++L+  
Sbjct: 263 CENMPLATAESDLYDLFETAGKVLRANLQYDSEGNPTGSSVCEFETVADAQECIERLNNY 322

Query: 827 HLLGRRLVMQY 837
           H  G  L M Y
Sbjct: 323 HYGGCDLKMSY 333

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 2/77 (2%)

Query: 342 NQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVN 401
           N +  +F+ N+ Y +  ED R+LF   G +  V   + T  G  +G   V + ++++   
Sbjct: 4   NYSNSVFIGNLTYDTTPEDLRQLFGEVGHV--VRADIITSRGHHRGMGTVEYTNAQDVDE 61

Query: 402 AYVELDKQIFQGRLLHI 418
           A    +   F  R L +
Sbjct: 62  AIRRFNGMDFMHRELFV 78

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 36/177 (20%), Positives = 66/177 (37%), Gaps = 14/177 (7%)

Query: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723
           S+FI NL + TT ++L   F      V A + T        +    G G VE+   +  +
Sbjct: 8   SVFIGNLTYDTTPEDLRQLFGEVGHVVRADIITS-------RGHHRGMGTVEYTNAQDVD 60

Query: 724 AVIAAMDGTVIDGHKIQLKLSH-------RQASQSXXXXXXXXXXXXXXXVKNLPFEATR 776
             I   +G      ++ ++  +       R+                   V NLP+  + 
Sbjct: 61  EAIRRFNGMDFMHRELFVRRDNPPPVGERRERRGPGPLPRRTHPGGFEIFVANLPYSISW 120

Query: 777 KDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833
           + + ++F    ++    V    D  +RGF  V     +    A+++ +G  L GR L
Sbjct: 121 QTLKDMFKECSEVIHADVSVDADGYSRGFGTVYVTTRENQIAAIERWNGYELEGRIL 177

>YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of
           nuclear cap-binding protein complex [627 bp, 208 aa]
          Length = 208

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVP-KKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           V NL F  + + ++ELF+  G +K + +   +F  +  GF F+ +  P EA NA+  L  
Sbjct: 50  VGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNALKYLSD 109

Query: 826 VHL 828
             L
Sbjct: 110 TKL 112

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 30/56 (53%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNA 402
           +++ N+ + + EE   +LFS  G ++ + + LD       GF ++++     A+NA
Sbjct: 48  IYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNA 103

>Scas_720.2
          Length = 245

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 35/60 (58%)

Query: 343 QTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNA 402
           Q+  +++ N+ + + EE   +LFS  G ++ + + LD       GF +V++ +++ A+NA
Sbjct: 45  QSATIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFVIYSNAQEALNA 104

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVP-KKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           V NL F  + + ++ELF+  G +K + +   +F  +  GF FV +   +EA NA+  L  
Sbjct: 51  VGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFVIYSNAQEALNALKYLSD 110

Query: 826 VHLLGRRLVM 835
             L  + + +
Sbjct: 111 TKLDDKHITI 120

>AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH]
           complement(617434..618879) [1446 bp, 481 aa]
          Length = 481

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 347 LFLRNILYTSKEEDFRKLF-SPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVE 405
           LF+ ++  T+ E     LF + F  ++ V V  D  TG S+ F +V F D K    A  E
Sbjct: 164 LFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEKERRRALAE 223

Query: 406 LDKQIFQGRLLHI 418
           ++    QGR L +
Sbjct: 224 MNGVWCQGRQLRV 236

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 767 VKNLPFEATRKDVFELFNS-FGQLKSVRV-PKKFDKSARGFAFVEFLLPKEAENAMDQLH 824
           V +L   AT   +  LF + F  +K+VRV       ++R F FV F   KE   A+ +++
Sbjct: 166 VGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEKERRRALAEMN 225

Query: 825 GVHLLGRRLVMQY 837
           GV   GR+L + Y
Sbjct: 226 GVWCQGRQLRVAY 238

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 55/132 (41%), Gaps = 7/132 (5%)

Query: 611 AEADDLINNTSAKEEENPVEVKPSSNDLMEANKDVTEGSSNAHDEDVIDGPTVSIFIKNL 670
           A+A   +N T      +P    P+ N   + N  +   S      D+   P  S+F+ +L
Sbjct: 111 AQAGLQLNATPLPNVVSPTTRNPT-NPTGKRNFRLNWASGATLQSDIPATPEFSLFVGDL 169

Query: 671 NFSTTNQNLTDRFKV-FTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANAVIAAM 729
           + + T  +L   F+  F      +V T P         S  FGFV F  +++    +A M
Sbjct: 170 SPTATEAHLLSLFQTKFKSVKTVRVMTDPI-----TGASRCFGFVRFADEKERRRALAEM 224

Query: 730 DGTVIDGHKIQL 741
           +G    G ++++
Sbjct: 225 NGVWCQGRQLRV 236

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 11/79 (13%)

Query: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723
           ++FI  L+   +   L   F  F    +  VK  P     G+    G GFV F  +  A 
Sbjct: 327 TVFIGGLSNMISEGQLHALFMPFGN--ILSVKVPP-----GR----GCGFVRFENRMDAE 375

Query: 724 AVIAAMDGTVIDGHKIQLK 742
           A I  M G ++ G+ I+L 
Sbjct: 376 AAIQGMQGFIVGGNAIRLS 394

>CAGL0E03630g complement(335091..337331) weakly similar to sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation,
           hypothetical start
          Length = 746

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 770 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLL 829
           LP +    +V + F ++GQL  V+V +  D   R +AFV+++  K+A++A+    G  L 
Sbjct: 106 LPDDQLCMNVTKHFQNYGQLVGVKVLR--DDHNRPYAFVQYINDKDAKHALKNASGTVLN 163

Query: 830 GRRL 833
           GR+L
Sbjct: 164 GRKL 167

>AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073)
           [933 bp, 310 aa]
          Length = 310

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 5/80 (6%)

Query: 665 IFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANA 724
           +F+  LN  T   +L   F  F    V  V+   D +  G+  S+G+GFVEF TK     
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGH--VNSVEIIRD-RDSGR--SLGYGFVEFATKAACEL 286

Query: 725 VIAAMDGTVIDGHKIQLKLS 744
               MDG +ID  ++ +  S
Sbjct: 287 AYTKMDGALIDDRRVHVDFS 306

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 35/72 (48%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LF+  +   ++  D   +F+ FG +  V +  D  +G+S G+ +V F        AY ++
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 407 DKQIFQGRLLHI 418
           D  +   R +H+
Sbjct: 292 DGALIDDRRVHV 303

>Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement
          Length = 284

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 7/96 (7%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +F+ NI  ++  E     F   G ++ V +  +  TG  KG+AY+ F +SK++V      
Sbjct: 85  IFVGNISPSTTPESLEAHFEDAGVIKRVTILYNKHTGAPKGYAYIEF-ESKDSVEKGSAF 143

Query: 407 DKQIFQGRLLHI------LPGEEKKSHRLDEFDLKN 436
           D+  F G+ + +       PG  K+ +    F  +N
Sbjct: 144 DQSDFNGKTITVAKKRTNFPGFNKRFNYQKHFFYQN 179

>YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA
           polymerase epsilon mutation, contains four RNA
           recognition motif (RRM) domains [1836 bp, 611 aa]
          Length = 611

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 76/176 (43%), Gaps = 20/176 (11%)

Query: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722
           V +FI +L+ + T + L   FK +  FV A+V      K      S+G G++ F  KE+A
Sbjct: 91  VPLFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKK-----SLGHGYLNFEDKEEA 145

Query: 723 NAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNLPFE---ATRKDV 779
              +  ++ T ++G +I++  S R  +                   NLP      T +  
Sbjct: 146 EKAMEELNYTKVNGKEIRIMPSLRNTT-------FRKNFGTNVFFSNLPLNNPLLTTRVF 198

Query: 780 FELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVM 835
           ++ F+ +G++ S ++      S +   FV F   K A N +   +     G++++ 
Sbjct: 199 YDTFSRYGKILSCKL-----DSRKDIGFVYFEDEKTARNVIKMYNNTSFFGKKILC 249

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 826
           +KNLP   TR D+   F+  G +KS+ +     K    +AFV +    ++E A+ + +  
Sbjct: 307 IKNLPTITTRDDILNFFSEVGPIKSIYLSNA-TKVKYLWAFVTYKNSSDSEKAIKRYNNF 365

Query: 827 HLLGRRLVM 835
           +  G++L++
Sbjct: 366 YFRGKKLLV 374

 Score = 36.6 bits (83), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 109/269 (40%), Gaps = 35/269 (13%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LF+ ++  T  EE  + +F  +       V LD+ T +S G  Y+ F+D + A  A  EL
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 407 DKQIFQGRLLHILPGEEKKSHRLD---EFDLKNMPLKKQKELKRKAAASRQTFSWN---- 459
           +     G+ + I+P     + R +        N+PL       R       TFS      
Sbjct: 153 NYTKVNGKEIRIMPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTR---VFYDTFSRYGKIL 209

Query: 460 SLYMNQDAVLGSVAAKLGLEKSQLIDAENSSSAV-KQALAEAHVIGDVRKY--FESKGVD 516
           S  ++    +G V  +       +I   N++S   K+ L   H   +VR    FE++   
Sbjct: 210 SCKLDSRKDIGFVYFEDEKTARNVIKMYNNTSFFGKKILCGIHFDKEVRSVPNFETQKSR 269

Query: 517 L---TKFSQLKSTNQRDDK---------------VILVKNFPFGTTREELGEMFLPYGKL 558
           L   T   + +S N++  K                I +KN P  TTR+++   F   G +
Sbjct: 270 LDAETIIEKEQSLNEKHSKGNDKESKNIYSSSQNSIFIKNLPTITTRDDILNFFSEVGPI 329

Query: 559 ERLLMPPAGTI----AIVQFRDTTSARAA 583
           + + +  A  +    A V +++++ +  A
Sbjct: 330 KSIYLSNATKVKYLWAFVTYKNSSDSEKA 358

>CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces
           cerevisiae YBL051c, hypothetical start
          Length = 639

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSA-RGFAFVEFLLPKEAENAMDQLHG 825
           +KN+PF   ++ + ++    G          FD    RG AF  F  P++    +  L+G
Sbjct: 60  IKNIPFAIKKEQLLDIIQEMGLPLPYAFNYHFDNGIFRGLAFANFSTPEDTSRVISDLNG 119

Query: 826 VHLLGRRLVMQY 837
             + GR+L ++Y
Sbjct: 120 KEINGRKLKVEY 131

>AER285C [2787] [Homologous to ScYMR268C (PRP24) - SH]
           (1162117..1163397) [1281 bp, 426 aa]
          Length = 426

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFG-QLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           V N P     +++   F   G Q  SVR+P     + R FA+V+   P+ A+ A + L+G
Sbjct: 112 VTNFPPRYDGRELRRFFEDLGFQCLSVRLPSLRYNAGRRFAYVDLPSPQSADAAANTLNG 171

Query: 826 VHLLGRRLVMQ 836
           + L G  LV++
Sbjct: 172 MDLDGYNLVVK 182

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 49/105 (46%), Gaps = 7/105 (6%)

Query: 711 FGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSXXXXXXXXXXXXXXXVKNL 770
           F +V+  + + A+A    ++G  +DG+ + +KLS  ++                  ++ L
Sbjct: 151 FAYVDLPSPQSADAAANTLNGMDLDGYNLVVKLSDPESRAQ--RSDAGTIEKREVLIRGL 208

Query: 771 PF-EATRKDVFELFNSFGQLKSVRVPKKFD----KSARGFAFVEF 810
            F + T + +  L   FG+++ + +P   D    +  RGFAFV +
Sbjct: 209 DFIKVTIEKLQGLVEPFGEVEKLIMPPSSDSADGRHNRGFAFVTY 253

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 7/57 (12%)

Query: 517 LTKFSQLKSTNQRDD------KVILVKNFPF-GTTREELGEMFLPYGKLERLLMPPA 566
           + K S  +S  QR D      + +L++   F   T E+L  +  P+G++E+L+MPP+
Sbjct: 180 VVKLSDPESRAQRSDAGTIEKREVLIRGLDFIKVTIEKLQGLVEPFGEVEKLIMPPS 236

>Kwal_27.12337
          Length = 209

 Score = 37.0 bits (84), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLH 824
           V N+  + TR+ ++ELF     +  +R PK K  ++ +GFAFVEF   ++ E A   L+
Sbjct: 14  VGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYATKCLN 72

>Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement
          Length = 188

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%)

Query: 358 EEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLH 417
           E D   +FS +G   ++ +  D  T +SKGF Y+ ++D ++ V A   L+     GR + 
Sbjct: 47  EGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNLNGATIAGRTIK 106

Query: 418 I 418
           +
Sbjct: 107 V 107

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 44  TDVKILRDRNG-ESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPR 99
            D+K++RD+   ES+ FG++ Y ++     AV+  NG+ I    I+V  A  F  PR
Sbjct: 61  VDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNLNGATIAGRTIKVDHA--FYTPR 115

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/62 (22%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 773 EATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGR 831
           E T  D+  +F+ +G    +++ + K  + ++GF ++++   +    A+D L+G  + GR
Sbjct: 44  ELTEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNLNGATIAGR 103

Query: 832 RL 833
            +
Sbjct: 104 TI 105

>Kwal_55.20972
          Length = 135

 Score = 35.8 bits (81), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%)

Query: 358 EEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLH 417
           E D   +FS +G   ++ +  D  +G+SKGFAY+ ++D ++ V A   L+     GR + 
Sbjct: 47  EGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNLNGVKIAGRSIR 106

Query: 418 I 418
           +
Sbjct: 107 V 107

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 44  TDVKILRDR-NGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEV 89
            D+K++RDR +GES+ F ++ Y ++     AV+  NG  I    I V
Sbjct: 61  VDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNLNGVKIAGRSIRV 107

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 5/70 (7%)

Query: 767 VKNLPFEATRKDVFELFNSFG---QLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQL 823
           V  L  + T  D+  +F+ +G    LK VR   +    ++GFA++++   +    A+D L
Sbjct: 38  VGGLHKDLTEGDILTIFSQYGIPVDLKLVR--DRESGESKGFAYLKYEDQRSTVLAVDNL 95

Query: 824 HGVHLLGRRL 833
           +GV + GR +
Sbjct: 96  NGVKIAGRSI 105

>AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH]
           complement(345624..346280) [657 bp, 218 aa]
          Length = 218

 Score = 36.6 bits (83), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 41/83 (49%), Gaps = 3/83 (3%)

Query: 326 RAVPQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQS 385
           R  P   +E   + K   +  +++ N+ + + EE   +LFS  G +E++ + LD      
Sbjct: 30  RKTPGGLEE---LRKSMTSATIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTP 86

Query: 386 KGFAYVLFKDSKNAVNAYVELDK 408
            GF +++++  + A+ A   L K
Sbjct: 87  CGFCFIIYQTPQEALAALKYLSK 109

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVP-KKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           V NL F  + + ++ELF+  G ++ + +   +F  +  GF F+ +  P+EA  A+  L  
Sbjct: 50  VGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTPCGFCFIIYQTPQEALAALKYLSK 109

Query: 826 VHLLGRRLVM 835
             L  R + +
Sbjct: 110 TKLDDREITI 119

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 8/78 (10%)

Query: 533 VILVKNFPFGTTREELGEMFLPYGKLERLLM-------PPAGTIAIVQFRDTTSARAAFT 585
            I V N  F T+ E+L E+F   G +E+++M        P G   I+ ++    A AA  
Sbjct: 47  TIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTPCGFCFII-YQTPQEALAALK 105

Query: 586 KLSYKRFKDGIIYLERGP 603
            LS  +  D  I ++  P
Sbjct: 106 YLSKTKLDDREITIDLDP 123

>Kwal_14.1851
          Length = 535

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 347 LFLRNILYTSKEEDFRKLFSP-FGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVE 405
           LF+ ++  T+ E     LF   F  ++ V V  D  TG S+ F +V F D +    A VE
Sbjct: 176 LFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERRRALVE 235

Query: 406 LDKQIFQGRLLHI 418
           ++    QGR L +
Sbjct: 236 MNGVWCQGRNLRV 248

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 36/86 (41%), Gaps = 11/86 (12%)

Query: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722
            ++FI  L    + + L   F  F   +   VK  P     GK    G GFV++  +  A
Sbjct: 396 TTVFIGGLTSQISERQLHSLFSPFGAII--NVKIPP-----GK----GCGFVKYAYRIDA 444

Query: 723 NAVIAAMDGTVIDGHKIQLKLSHRQA 748
            A I  M G ++ G+ I+L      A
Sbjct: 445 EAAIQGMQGFIVGGNPIRLSWGRTSA 470

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 767 VKNLPFEATRKDVFELFNS-FGQLKSVRV-PKKFDKSARGFAFVEFLLPKEAENAMDQLH 824
           V +L   AT   +  LF   F  +K+VRV       ++R F FV F   +E   A+ +++
Sbjct: 178 VGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERRRALVEMN 237

Query: 825 GVHLLGRRLVMQY 837
           GV   GR L + Y
Sbjct: 238 GVWCQGRNLRVAY 250

>Kwal_27.11096
          Length = 201

 Score = 36.2 bits (82), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVP-KKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           V NL F  + + ++ELF+  G +K + +   +F  +  GF FV +  P+EA NA+  L  
Sbjct: 50  VGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYNTPEEALNAVKYLSD 109

Query: 826 VHL 828
             L
Sbjct: 110 TKL 112

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 33/60 (55%)

Query: 343 QTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNA 402
           ++  +++ N+ + + EE   +LFS  G ++ + + LD       GF +V++   + A+NA
Sbjct: 44  RSATIYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYNTPEEALNA 103

>YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein with
           weak similarity to RNA-binding proteins, contains one
           RNA recognition (RRM) domain [2007 bp, 668 aa]
          Length = 668

 Score = 37.4 bits (85), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSA-RGFAFVEFLLPKEAENAMDQLHG 825
           +KN+PF   ++ + ++               FD    RG AF  F  P+E    +  L+G
Sbjct: 89  IKNIPFAIKKEQLLDIIEEMDLPLPYAFNYHFDNGIFRGLAFANFTTPEETTQVITSLNG 148

Query: 826 VHLLGRRLVMQY 837
             + GR+L ++Y
Sbjct: 149 KEISGRKLKVEY 160

>ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH]
           (708437..709411) [975 bp, 324 aa]
          Length = 324

 Score = 36.6 bits (83), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 41/81 (50%), Gaps = 7/81 (8%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +F+ +I   +  E   + F   G +  + +  + +TG+ KG+AY+ F +S ++V   ++L
Sbjct: 85  VFVSSITPEATAEMLEEHFKDVGVISRITILYNKKTGEPKGYAYIQF-ESISSVEKALQL 143

Query: 407 DKQIFQGRLLHI------LPG 421
           D   F G  + +      LPG
Sbjct: 144 DGSSFNGNTISVAKKRTNLPG 164

>Scas_530.4
          Length = 684

 Score = 37.0 bits (84), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 779 VFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833
           V + F  FG++  V+V +  D++ R +AFV++    +A  A+ + HG  L GRRL
Sbjct: 161 VTDYFKKFGEIIRVKVLR--DQANRPYAFVQYTNDNDANVALKEAHGSILNGRRL 213

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 43  ITDVKILRDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93
           I  VK+LRD+   +R + F+ Y N+ DA  A++  +GS +N  ++    A+
Sbjct: 171 IIRVKVLRDQ--ANRPYAFVQYTNDNDANVALKEAHGSILNGRRLRCERAR 219

>CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces
           cerevisiae YPL178w SAE1, start by similarity
          Length = 236

 Score = 36.2 bits (82), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVP-KKFDKSARGFAFVEFLLPKEAENAMDQL 823
           V NL F  + + ++ELF+  G +K + +   +F  +  GF F+ +  P+EA NA+  L
Sbjct: 50  VGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFIIYNTPQEALNAVKYL 107

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 31/56 (55%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNA 402
           +++ N+ + + EE   +LFS  G ++ + + LD       GF ++++   + A+NA
Sbjct: 48  IYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFIIYNTPQEALNA 103

>KLLA0B00979g 77439..78467 some similarities with sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3 nucleolar protein
           singleton, hypothetical start
          Length = 342

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 10/60 (16%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 826
           VK  P + T  ++ E+F  FG LK +++         GFAFVEF   +EAE+A   +  V
Sbjct: 56  VKPFPPDVTDAEMKEIFEPFGALKEIKI-------LNGFAFVEF---EEAESASQAIQNV 105

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query: 531 DKVILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFTKLSYK 590
           D  + VK FP   T  E+ E+F P+G L+ + +      A V+F +  SA  A   ++ K
Sbjct: 51  DTRLFVKPFPPDVTDAEMKEIFEPFGALKEIKI--LNGFAFVEFEEAESASQAIQNVAGK 108

Query: 591 RFKD 594
            F D
Sbjct: 109 MFAD 112

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 44/87 (50%), Gaps = 14/87 (16%)

Query: 333 DEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVL 392
           DEEL+        RLF++       + + +++F PFG L+E+ +          GFA+V 
Sbjct: 46  DEELS------DTRLFVKPFPPDVTDAEMKEIFEPFGALKEIKIL--------NGFAFVE 91

Query: 393 FKDSKNAVNAYVELDKQIFQGRLLHIL 419
           F+++++A  A   +  ++F    L ++
Sbjct: 92  FEEAESASQAIQNVAGKMFADYPLEVV 118

>Scas_714.59
          Length = 233

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%)

Query: 364 LFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418
           L  PF  +++  V  +  TG+SKG A+V F   + A  A   LD + F   +L +
Sbjct: 170 LLFPFAPIQKCVVVRNRETGRSKGLAFVTFSSEQMAEKALHFLDGRGFMNLILRV 224

>Scas_709.2*
          Length = 171

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 29/45 (64%)

Query: 358 EEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNA 402
           E D   +FS +G   ++ +  D +TG+SKGFA++ ++D ++ V A
Sbjct: 47  EGDIISVFSQYGVPVDLLLVNDNQTGESKGFAFLKYEDQRSTVLA 91

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 6/77 (7%)

Query: 44  TDVKILRD-RNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPRVPQ 102
            D+ ++ D + GES+ F F+ Y ++     A++  NG  + ++ I+V    +F +PR  Q
Sbjct: 61  VDLLLVNDNQTGESKGFAFLKYEDQRSTVLAIDNLNGVKVGSNTIQVD--HTFYEPRDEQ 118

Query: 103 PMKEKRREALKRFREKE 119
                 RE +K   EK+
Sbjct: 119 ---WDYRETMKNELEKD 132

>Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement
          Length = 207

 Score = 35.0 bits (79), Expect = 0.16,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVP-KKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           V NL F  + + ++ELF+  G +K + +   +F  +  GF FV +  PKEA +A+  L  
Sbjct: 50  VGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFVIYNTPKEALSAVKYLSD 109

Query: 826 VHLLGRRL 833
             L  R +
Sbjct: 110 TKLDDRHI 117

 Score = 32.3 bits (72), Expect = 1.3,   Method: Composition-based stats.
 Identities = 19/81 (23%), Positives = 38/81 (46%)

Query: 338 IEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSK 397
           + K   +  +++ N+ + + EE   +LFS  G ++ + + LD       GF +V++   K
Sbjct: 39  LRKSMSSATIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFVIYNTPK 98

Query: 398 NAVNAYVELDKQIFQGRLLHI 418
            A++A   L       R + I
Sbjct: 99  EALSAVKYLSDTKLDDRHISI 119

>KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4
           Ashbya gossypii Yib1, hypothetical start
          Length = 345

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +F+ NI   +  E   + F   GE+  V +  +  TG  KG+AY+ F +S +++   +EL
Sbjct: 105 IFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYAYIEF-ESSDSIPKALEL 163

Query: 407 DKQIFQGRLLHI 418
                 G  +++
Sbjct: 164 KDSELHGETINV 175

>Kwal_30.12890
          Length = 280

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%)

Query: 364 LFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLH 417
           L  PFG + +V V  +  TG+S+G AYV F+  + A  A   L+ + F   +L+
Sbjct: 217 LLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETALNFLNGRGFMNLILN 270

>Kwal_55.20903
          Length = 147

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 826
           ++++P + +   + + F   G +  + +  K  KS  G+A+VEF     AE A+ +L G 
Sbjct: 63  LRDIPSDISLPSLEDHFRDMGSICRITMISKQRKSGTGYAYVEFATKASAERAL-ELDGS 121

Query: 827 HLLGRRL 833
            L G +L
Sbjct: 122 ILRGHKL 128

>Sklu_905.1 YMR268C, Contig c905 196-1743
          Length = 515

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 767 VKNLPFEATRKDVFELFNSFG-QLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLH 824
           V N    +T + +  LF+ +G  + SVR+P  KFD S R FA+++F    EA  AM +L+
Sbjct: 187 VTNFAPNSTVETLKALFSQYGGSVLSVRLPSLKFD-SNRRFAYIDFASSDEANTAMSKLN 245

Query: 825 GVHLLGRRLVMQ 836
                G  LV++
Sbjct: 246 NTSHDGYILVVK 257

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 57/119 (47%), Gaps = 12/119 (10%)

Query: 711 FGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLS--HRQASQSXXXXXXXXXXXXXXXVK 768
           F +++F + ++AN  ++ ++ T  DG+ + +K S  H ++ ++               ++
Sbjct: 226 FAYIDFASSDEANTAMSKLNNTSHDGYILVVKKSNPHEKSKRT----DAATLEKREIFIR 281

Query: 769 NLPF-EATRKDVFELFNSFGQLKSVRVPKKFD-----KSARGFAFVEFLLPKEAENAMD 821
            L F + +   + +L   +G ++ V +P   D     K   GFAFV +   + A+ A++
Sbjct: 282 KLDFYKVSLSKLTKLVEKYGPVERVSMPNSEDSVNSNKQNDGFAFVTYTNEESAQKALE 340

>CAGL0F08217g complement(814508..816544) similar to sp|P53316
           Saccharomyces cerevisiae YGR250c, hypothetical start
          Length = 678

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 40/90 (44%), Gaps = 19/90 (21%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS-----------------ARGFAFVE 809
           VK++P + + KD+F  +  FG + S ++      S                 +RG+ FV 
Sbjct: 444 VKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGISRGYGFVY 503

Query: 810 FLLPKEAENAMDQLHGVHLLG--RRLVMQY 837
           F  P +A  A+    G +L G  ++L + Y
Sbjct: 504 FANPLDAAYAILSTDGYYLEGAIQKLSVSY 533

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 826
           +  +P   +   + E F+ FG + S+++   FD    G  F+ F+L  EA   +  ++G 
Sbjct: 143 IGGIPKNMSLNTLMETFDKFGTISSLKI--LFDNKNVGIGFLSFMLGSEAAECIRCMNGT 200

Query: 827 HL 828
            +
Sbjct: 201 KI 202

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/95 (21%), Positives = 45/95 (47%), Gaps = 11/95 (11%)

Query: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKT-----------LSMGFG 712
           +I++K++    ++++L + ++ F   +  ++ T      + K+           +S G+G
Sbjct: 441 NIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGISRGYG 500

Query: 713 FVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQ 747
           FV F     A   I + DG  ++G   +L +S+ Q
Sbjct: 501 FVYFANPLDAAYAILSTDGYYLEGAIQKLSVSYAQ 535

>Sklu_2085.2 YOR319W, Contig c2085 3158-3787
          Length = 209

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 658 IDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFR 717
           ++ P  +++I N++ + T   L + F       V+ +     P+ +      G+ F+EF 
Sbjct: 5   LNNPETTLYIGNIDPNVTKDLLYELF-----IQVSPISKIRYPRDKILDTHQGYAFIEFF 59

Query: 718 TKEQANAVIAAMDGTV 733
           TKE A+ V+  M+ TV
Sbjct: 60  TKEDADYVVKVMNNTV 75

>CAGL0J01914g complement(189309..189818) similar to sp|P40565
           Saccharomyces cerevisiae YIR005w IST3, hypothetical
           start
          Length = 169

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 33/61 (54%)

Query: 358 EEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLH 417
           E D   +FS +G   +V +  D  T +SKGFA++ ++D ++ + A   L+     GR + 
Sbjct: 47  EGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNLNGITVAGRQIK 106

Query: 418 I 418
           +
Sbjct: 107 V 107

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFG-QLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           +  L  + T  D+  +F+ +G  +  + V  K    ++GFAF+++   +    A+D L+G
Sbjct: 38  IGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNLNG 97

Query: 826 VHLLGRRL 833
           + + GR++
Sbjct: 98  ITVAGRQI 105

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 49/99 (49%), Gaps = 7/99 (7%)

Query: 44  TDVKILRDR-NGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPRVPQ 102
            DV ++RD+   ES+ F F+ Y ++     AV+  NG  +   +I+V     F  PR   
Sbjct: 61  VDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNLNGITVAGRQIKVDHI--FFTPRDDI 118

Query: 103 PMKEKRREALKRFREKEEKLLQEENRKKKKVD-ENKHSN 140
           P   +  EA++ F  K++  + +++     +  E K++N
Sbjct: 119 P---EYTEAVREFLSKDKIDIHKDHLSTDNIQKETKYTN 154

>KLLA0C08019g complement(704199..705104) some similarities with
           sp|Q00916 Saccharomyces cerevisiae YIL061c SNP1 U1 small
           nuclear ribonucleoprotein singleton, hypothetical start
          Length = 301

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           LF+  + Y   E + +K F  +G++E   +  D + G+S+G+ +V F   +++   + EL
Sbjct: 117 LFVGRLHYAVDEVELQKSFVKYGDIESCRIVRD-QDGKSRGYGFVQFTSYEDSKQCFREL 175

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 783 FNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQL---HGVHLLGRRLVM 835
           F  +G ++S R+ +  D  +RG+ FV+F   ++++    +L    G+ ++GR  ++
Sbjct: 135 FVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFRELGVRKGIEIMGRTSIV 190

>Scas_665.4
          Length = 219

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 78/193 (40%), Gaps = 23/193 (11%)

Query: 658 IDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFR 717
           ++ P  ++++ N++   T + L + F       V+ +     PK +   +  G+ F+EF 
Sbjct: 5   LNNPETTVYVGNIDPKVTKEQLYELF-----IQVSPISKLRYPKDKILQMHQGYAFIEFY 59

Query: 718 TKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQ-----------SXXXXXXXXXXXXXXX 766
           T +    VI  M+ TV    +    L  RQ+ Q           S               
Sbjct: 60  TAKDVQYVIQVMNNTVALYDRF---LKVRQSVQNPTSSMGGANTSENSNQSIVLPIAKLF 116

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGF--AFVEFLLPKEAENAMDQLH 824
           VKNL        + +LF  FG L   + P+ F  S      A++ F   + ++ A+ +L+
Sbjct: 117 VKNLDESIENPQLIKLFQKFGPL--FKDPEIFFLSNGKLRCAYIYFKFYENSDMAIAKLN 174

Query: 825 GVHLLGRRLVMQY 837
              ++ +R+ + Y
Sbjct: 175 NELIVNKRINVDY 187

>YDR429C (TIF35) [1252] chr4 complement(1324465..1325289)
           Translation initiation factor eIF3, p33 subunit,
           contains an RRM (RNA recognition motif) domain [825 bp,
           274 aa]
          Length = 274

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%)

Query: 364 LFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418
           L  PF  +  V V  +  TG+S+G A+V F   + A  A   LD + +   +L +
Sbjct: 211 LLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQALRFLDGRGYMNLILRV 265

>Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement
          Length = 309

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 6/81 (7%)

Query: 665 IFIKNLNFSTTNQNLTD---RFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQ 721
           ++I NL+F TT   LT     + V +  + +Q           +   +G  + +F + ++
Sbjct: 24  VYISNLSFDTTEDELTGYLLEYNVLSVLIPSQTIRG---FRNSRVRPLGIAYADFESADK 80

Query: 722 ANAVIAAMDGTVIDGHKIQLK 742
           A   I A++G V +   ++LK
Sbjct: 81  AKEAIEALNGKVFNNRTLRLK 101

>CAGL0H04675g complement(447256..448080) highly similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35, start by
           similarity
          Length = 274

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%)

Query: 364 LFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418
           L  PF  +++V V  +  TG+S+G A+V F +   A  A   LD + F   +L +
Sbjct: 209 LLFPFEPIQKVVVVRNKETGRSRGLAFVTFINEDMAEKALHFLDGRGFMNLILRV 263

>Kwal_55.20414
          Length = 284

 Score = 33.5 bits (75), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 665 IFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTL-SMGFGFVEFRTKEQAN 723
           I++ NL+FSTT + L++  K +   V   + ++     +  T+  +G G+ +F++ + A 
Sbjct: 19  IYVSNLDFSTTEEELSEFLKEY-NVVSVLIPSQTIRGFRNSTVRPLGIGYADFQSAQDAQ 77

Query: 724 AVIAAMDGTVIDGHKIQLKL 743
                ++G  +   K+++K+
Sbjct: 78  NAAQNLNGKQLKDRKLKIKI 97

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 8/74 (10%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSAR-------GFAFVEFLLPKEAENA 819
           V NL F  T +++ E    +  + SV +P +  +  R       G  + +F   ++A+NA
Sbjct: 21  VSNLDFSTTEEELSEFLKEYN-VVSVLIPSQTIRGFRNSTVRPLGIGYADFQSAQDAQNA 79

Query: 820 MDQLHGVHLLGRRL 833
              L+G  L  R+L
Sbjct: 80  AQNLNGKQLKDRKL 93

>AGR057C [4367] [Homologous to ScYLR095C (IOC2) - SH]
           (821017..822264,822266..823201) [2184 bp, 727 aa]
          Length = 727

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 77/186 (41%), Gaps = 30/186 (16%)

Query: 61  FIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPRVPQPMKEKRREAL--KRFREK 118
           F+ Y  E +  +  E+F       ++ EV  AK +A       +KE+  + L  +R R  
Sbjct: 258 FLAYVQELEEGEFREFFCELLPYAAENEVYGAKLWAGL-----VKERSMQELITRRKRSS 312

Query: 119 EEKLLQEENRKKKKVDENKHSNIDDEIR----KNKQLQEFMETMKPSSQVTSWEKVGIDK 174
              + +EE  ++++V+++ HS +D+  R    ++K + +  +  K +     WE+   D 
Sbjct: 313 SRLVAREEETQRRQVEDDWHSKLDERDRFLRLRSKLVAKRAKKTKDALWTVLWERFESDA 372

Query: 175 SIE---------------DEKLKREEEDSSVQGNSLLAHALALKEENNKDEAPNLVIENE 219
            IE               DE L   E  +  QG   LA  + + E       P  V  NE
Sbjct: 373 KIEKMRRRNEAATPEAGGDELLTPAERYALEQGQGFLAPVVPVAEPAR----PLAVPCNE 428

Query: 220 SDDEYS 225
             DEY 
Sbjct: 429 LPDEYC 434

>KLLA0B10472g complement(914512..915108) similar to sgd|S0006099
           Saccharomyces cerevisiae YPL178w SAE1 small subunit of
           the nuclear cap-binding protein complex CBC, start by
           similarity
          Length = 198

 Score = 32.7 bits (73), Expect = 0.74,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 49/86 (56%), Gaps = 5/86 (5%)

Query: 322 EQPERAVPQKT--DEELAIEKINQTGR---LFLRNILYTSKEEDFRKLFSPFGELEEVHV 376
           ++P R + +K   D +  ++++ ++ +   +++ N+ + + EE   +LFS  G ++++ +
Sbjct: 19  DKPSRYLIRKARRDPDSGLQQLRKSMKSCTVYVGNLSFYTSEEQIYELFSKCGTIKKIIM 78

Query: 377 ALDTRTGQSKGFAYVLFKDSKNAVNA 402
            LD       GF +++F   ++A+N+
Sbjct: 79  GLDRFKFTPCGFCFIIFDKMEDALNS 104

 Score = 29.6 bits (65), Expect = 9.0,   Method: Composition-based stats.
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVP-KKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           V NL F  + + ++ELF+  G +K + +   +F  +  GF F+ F   ++A N++  L  
Sbjct: 51  VGNLSFYTSEEQIYELFSKCGTIKKIIMGLDRFKFTPCGFCFIIFDKMEDALNSIKYLGD 110

Query: 826 VHLLGRRLVM 835
             L  R + +
Sbjct: 111 TKLDDRHITI 120

>ACR235W [1282] [Homologous to ScYBL051C (PIN4) - SH]
           complement(771971..773707) [1737 bp, 578 aa]
          Length = 578

 Score = 33.5 bits (75), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 1/72 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSA-RGFAFVEFLLPKEAENAMDQLHG 825
           +KN+PF   ++ + E+               FD    RG AF  F   +E    +  L+G
Sbjct: 53  IKNIPFAIKKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTEETMQVVQHLNG 112

Query: 826 VHLLGRRLVMQY 837
             + GRRL ++Y
Sbjct: 113 KEIGGRRLRVEY 124

>Scas_500.6
          Length = 621

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 1/72 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSA-RGFAFVEFLLPKEAENAMDQLHG 825
           +KN+PF   R+ + ++               FD    RG AF  F    E    ++ L+G
Sbjct: 57  IKNIPFAIKREQLLDIMAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTDETTRVIECLNG 116

Query: 826 VHLLGRRLVMQY 837
             + GR+L ++Y
Sbjct: 117 KEIGGRKLRVEY 128

>YHL024W (RIM4) [2262] chr8 (56646..58787) Protein required for
           sporulation and formation of meiotic spindle, has two
           RNA recognition motif (RRM) domains [2142 bp, 713 aa]
          Length = 713

 Score = 33.5 bits (75), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 779 VFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833
           V E F  +G L  V+V +  D + R +AFV++    +A++A+ +  G  L GRRL
Sbjct: 113 VTENFKKYGDLARVKVLR--DNANRPYAFVQYNNDHDAKHALIRAQGTLLNGRRL 165

>CAGL0A03117g join(315979..316263,317561..317974) highly similar to
           sp|Q12159 Saccharomyces cerevisiae YDR381w YRA1
          Length = 232

 Score = 32.7 bits (73), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 18/117 (15%)

Query: 2   SRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFGF 61
           +R+ V+GLP  +  D +RE F            V G     +  V +  +  G+S     
Sbjct: 78  ARVTVEGLPRDIKQDAVREFF---------QSQVGG-----VQRVLLSYNERGQSTGMAN 123

Query: 62  IGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPRV--PQPMKEKRREALKRFR 116
           + +RN E A  AV  F+G+ I+  K  + +     DP V   +P+ E+ R A+ R R
Sbjct: 124 VTFRNGELAKKAVAQFSGAPIDGGKSRLRL-NIVVDPTVQPARPLTERIR-AISRER 178

>CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces
           cerevisiae YPL190c NAB3 polyadenylated RNA-binding
           protein, hypothetical start
          Length = 775

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 10/73 (13%)

Query: 338 IEKINQTGRLFLRNI-LYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDS 396
           +  I    RLF+ N+ L    ++D  +LFSPFG + ++++           F ++ + + 
Sbjct: 323 MHSIPPKSRLFIGNLPLKNVSKQDLFRLFSPFGHILQINI--------KNAFGFIQYDNP 374

Query: 397 KNAVNAYVELDKQ 409
           K +V A +E + Q
Sbjct: 375 K-SVRAAIECESQ 386

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/71 (22%), Positives = 36/71 (50%), Gaps = 8/71 (11%)

Query: 767 VKNLPFE-ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           + NLP +  +++D+F LF+ FG +  + +          F F+++  PK    A++    
Sbjct: 334 IGNLPLKNVSKQDLFRLFSPFGHILQINI-------KNAFGFIQYDNPKSVRAAIECESQ 386

Query: 826 VHLLGRRLVMQ 836
               G++L+++
Sbjct: 387 EINFGKKLILE 397

>KLLA0F18216g 1677731..1679857 some similarities with sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation
           singleton, hypothetical start
          Length = 708

 Score = 33.5 bits (75), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 783 FNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833
           F  +G++ SV+V +  D + R +AFV++    EA NA+ Q  G  L  R +
Sbjct: 144 FAKYGKIVSVKVLR--DPANRPYAFVQYASDDEALNALSQAQGTTLNNRNI 192

>CAGL0H02123g complement(188454..190121) similar to sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 555

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 374 VH--VALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418
           VH  V  D  TG SKG+ +V FK S +   A VE+      GR + I
Sbjct: 218 VHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQGCFLNGRAIKI 264

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 37/87 (42%), Gaps = 16/87 (18%)

Query: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKH------QGKTLSMGFGFVEFR 717
           SIF+ +L  S T   L D F          +   P   H      Q   +S G+GFV+F+
Sbjct: 191 SIFVGDLAPSVTEAQLFDLF----------INKYPSTVHAKVMYDQLTGISKGYGFVKFK 240

Query: 718 TKEQANAVIAAMDGTVIDGHKIQLKLS 744
           +       +  M G  ++G  I++ ++
Sbjct: 241 SSMDQQRALVEMQGCFLNGRAIKIGIA 267

>CAGL0J02200g complement(215042..215476) similar to sp|P40561
           Saccharomyces cerevisiae YIR001c SGN1, hypothetical
           start
          Length = 144

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLF 393
           +++ NI   +  E+  + F   G ++ + +  D  TG S G+AYV F
Sbjct: 47  IYIGNISLDTTPEEIDEHFKSCGVIKRITMLYDKNTGPSIGYAYVEF 93

>ADL126C [1615] [Homologous to ScYFR032C - SH] (469991..471391)
           [1401 bp, 466 aa]
          Length = 466

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 41/95 (43%), Gaps = 5/95 (5%)

Query: 329 PQKTDEELAIEKINQTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSK-- 386
           PQ+  +++  E+     R+++ N+   + EE   +    F  +  +  +   R  Q    
Sbjct: 33  PQQCAQQVLFEQQGAQHRVYISNLSQDATEEALTEFLKDFHPVSVLIPSQSVRGFQKTSV 92

Query: 387 ---GFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418
              G AYV FKD+  A    +EL+   F  R L +
Sbjct: 93  RPLGIAYVEFKDADTAAKVILELNGVTFMDRELRL 127

>KLLA0E00484g complement(45755..46483) similar to sp|P10080
           Saccharomyces cerevisiae YHL034c SBP1 single-strand
           nucleic acid binding protein singleton, start by
           similarity
          Length = 242

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 78/217 (35%), Gaps = 48/217 (22%)

Query: 657 VIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEF 716
           ++  P  SIF+ NL+  T+ ++L    KVF   V  ++ T        +T    F FV F
Sbjct: 11  IVVDPETSIFVGNLSPETSPEDLQ---KVFGESVKVEIPT----LQSDRTYPRIFAFVTF 63

Query: 717 RTKEQANAVIAAMDGTVIDGHKI-----------QLKLSHRQASQ--------------S 751
             K     + +  D TVI    I           QLK   R+A+Q              +
Sbjct: 64  DDKVDVEDLRSKFDKTVIKDKSIYVTKVLTPEEQQLKKQKRRANQRGKAVPAPPKKNKEA 123

Query: 752 XXXXXXXXXXXXXXXVKNLPFEATRKDVFELFNSFGQ-------------LKSVRVPKKF 798
                          V N+P+  T+ ++   F +  +              K V   +KF
Sbjct: 124 QVPLEQMERSKDTLYVNNIPYHTTKAEIASFFGTTEESVILPMRRMKDTTTKRVFFSRKF 183

Query: 799 DKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVM 835
           +   RG AFV F    + E    + +G +   R L +
Sbjct: 184 N---RGIAFVSFPEGTDIEAKAAEFNGKNFEDRELTV 217

>KLLA0C07194g 624694..625587 no similarity, hypothetical start
          Length = 297

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 21/45 (46%)

Query: 530 DDKVILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQF 574
           D   + V  FP GT   EL   F   G+L R+ +PP G    + +
Sbjct: 3   DRNTVHVSGFPAGTRANELAPQFENVGRLVRIDIPPLGRFKSIPY 47

>Scas_696.32
          Length = 445

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLK-SVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           + N P   T +++  LF  +  L  SVR+P     + R FA+V+     EA N ++ L+ 
Sbjct: 115 LTNFPPTFTSRELKSLFTEYDCLPISVRLPSLRFNANRRFAYVDVCTSNEATNMVNNLNN 174

Query: 826 VHLLGRRLV 834
             +   +LV
Sbjct: 175 KEIDNYKLV 183

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 4/74 (5%)

Query: 517 LTKFSQLKSTNQRDDKVILVKNFPFGTTREELGEMFLPYGKLERL----LMPPAGTIAIV 572
           L K    K T  R+   +LVKN P  T +  L + F   G L+ +     +  +  +A +
Sbjct: 20  LVKKQDSKPTRNRELTTVLVKNLPKSTNQNRLRKFFQDCGPLKHVDIVDTLDKSSRVARL 79

Query: 573 QFRDTTSARAAFTK 586
           +F +   A +A TK
Sbjct: 80  EFENFLDASSALTK 93

>YDR381W (YRA1) [1208] chr4 (1236546..1236830,1237597..1237992)
           Protein with RNA:RNA annealing activity, involved in
           mRNA packaging for export from the nucleus, contains one
           RNA recognition (RRM) domain [681 bp, 226 aa]
          Length = 226

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 14/89 (15%)

Query: 3   RIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFGFI 62
           ++ V+GLP  +  D +RE F  +         V G     +  V +  +  G+S     I
Sbjct: 79  KVNVEGLPRDIKQDAVREFFASQ---------VGG-----VQRVLLSYNERGQSTGMANI 124

Query: 63  GYRNEEDAFDAVEYFNGSFINTSKIEVSM 91
            ++N E A  AVE FNGS I+  +  + +
Sbjct: 125 TFKNGELARRAVERFNGSPIDGGRSRLRL 153

>YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein with
           possible role in protein translation, has one RNA
           recognition (RRM) domain [753 bp, 250 aa]
          Length = 250

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 30/69 (43%), Gaps = 5/69 (7%)

Query: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406
           +F+ NI      E     F   G+++ + +  D  TG  KG+ Y+ F+       AY E 
Sbjct: 66  IFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESP-----AYREK 120

Query: 407 DKQIFQGRL 415
             Q+  G L
Sbjct: 121 ALQLNGGEL 129

>YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated
           protein, essential for meiotic recombination, suppressor
           of mitochondrial splicing defects, has 3 RNA recognition
           (RRM) domains [1572 bp, 523 aa]
          Length = 523

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 767 VKNLPFEATRKDVFELF-NSFGQLKSVR-VPKKFDKSARGFAFVEFLLPKEAENAMDQLH 824
           V +L    T   +FELF N +      + V  +    ++G+ FV+F    E + A+ ++ 
Sbjct: 167 VGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQ 226

Query: 825 GVHLLGRRL 833
           GV L GR +
Sbjct: 227 GVFLNGRAI 235

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 35/82 (42%), Gaps = 1/82 (1%)

Query: 347 LFLRNILYTSKEEDFRKLF-SPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVE 405
           +F+ ++     E    +LF + +       +  D  TG SKG+ +V F +S     A  E
Sbjct: 165 IFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSE 224

Query: 406 LDKQIFQGRLLHILPGEEKKSH 427
           +      GR + + P   ++ H
Sbjct: 225 MQGVFLNGRAIKVGPTSGQQQH 246

>Kwal_55.21039
          Length = 119

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 35/66 (53%), Gaps = 4/66 (6%)

Query: 772 FEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGR 831
            +  R+++F LF+++G++  + + K+     RG AF+      EA  A+  L+     G+
Sbjct: 48  IQTLRENLFLLFSTYGEVLQIDMSKRI----RGQAFIVLKTVDEANIALISLNNEPFFGK 103

Query: 832 RLVMQY 837
            L +Q+
Sbjct: 104 DLHIQF 109

>KLLA0F17413g complement(1594037..1595203) similar to sgd|S0004023
           Saccharomyces cerevisiae YLR033w hypothetical protein,
           hypothetical start
          Length = 388

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 68/147 (46%), Gaps = 15/147 (10%)

Query: 173 DKSIEDEKLKREE-EDSSV-QGNSLLAHALALKEENNKDEAPNLVIENESDDEYSALNRN 230
           DK++EDEK+K E  ED  V + N  +      KE N  DE  N+  + E D      N  
Sbjct: 200 DKNVEDEKIKDEGIEDQKVEEANDSIGSDNQKKESNENDEEQNVATDEEQD-----TNEE 254

Query: 231 RDE---DQEDAGEEEKMISISNLKDTDIGL-VNDDANSDEKENEKRRNLAQDEKVSDLDW 286
            DE     E AG     I++ NL D      ++D+  +  ++ E++R L   E +  L  
Sbjct: 255 GDEVIVTTEPAGPVN--INLKNLYDWQPSHEIHDEDITAFEQGEQQRLLT--EILLKLKA 310

Query: 287 FKQRRVRIKESEAETREKSSSYATEQN 313
            K RRV++ +    T E+ S Y   QN
Sbjct: 311 CKSRRVKLNKISKPTSEEVSLYHRAQN 337

>ADL253C [1488] [Homologous to ScYNL059C (ARP5) - SH]
           (255552..257807) [2256 bp, 751 aa]
          Length = 751

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 54/118 (45%), Gaps = 15/118 (12%)

Query: 330 QKTDEELAI--EKINQTGRLFL------RNILYTSKEEDFRKLFSPFGELEEVHVALDTR 381
           QKT+EEL +  EK  +TG+         R      KEE++       G+LE         
Sbjct: 290 QKTEEELRLQAEKRRETGKRLQEQARQRRKEKLVQKEEEYEYYLQIRGQLEGQPKKNILA 349

Query: 382 TGQSKGFAYVLFKDSKNAVNAYV-ELDKQIFQGRLLHILPGEEKKSHRLDEFDLKNMP 438
           T Q+ GF      D ++  N Y+  L++ + + R+L     EE+ S  +  FDL N+P
Sbjct: 350 TLQNAGF------DDEDDFNKYITSLERSLKRARVLDANENEEEPSSTVPNFDLVNIP 401

>Kwal_26.7414
          Length = 704

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 52/128 (40%), Gaps = 4/128 (3%)

Query: 88  EVSMAKSFADP---RVPQPMKEKRREALKRFREKEEKLLQEENRKKKKVDENKHSNIDDE 144
           EV +  S   P    V Q +K+ R+EAL +F  +     +  N +      N +S     
Sbjct: 562 EVQVTNSMPGPETTSVAQALKQNRQEALSKFSTRSLPTKRPWNGEVTYSSPNVNSTPQAS 621

Query: 145 IRKNKQLQEFMETMKPSSQVTSWEKVGIDKSIEDEKLKREEEDSSVQGNSLLAHALALKE 204
             K  +L    ET+KP  + +SW     +++ E +     +  SS Q    +   +    
Sbjct: 622 PTKIARLVP-TETLKPIQRTSSWGNALSNQAQEAKNQLDSDSGSSTQDEESIHTQVTYGS 680

Query: 205 ENNKDEAP 212
             +K EAP
Sbjct: 681 PQHKSEAP 688

>AER349C [2850] [Homologous to NOHBY] (1278446..1279102) [657 bp,
           218 aa]
          Length = 218

 Score = 30.0 bits (66), Expect = 6.1,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 29/59 (49%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           V   P E   +D+   F + G++  + +P       R FAFV+F   +E   A+++L G
Sbjct: 9   VSGFPAETRARDMAPDFEAVGKIVRIDIPPMRPFQDRPFAFVKFETHEECVRAVEELDG 67

>Sklu_2391.1 YPL190C, Contig c2391 194-2479 reverse complement
          Length = 761

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 37/73 (50%), Gaps = 10/73 (13%)

Query: 338 IEKINQTGRLFLRNI-LYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDS 396
           I+      RLF+ N+ L    +ED  ++FSP+G + ++++           F ++ + D 
Sbjct: 334 IQHFPPKSRLFIGNLPLKNVTKEDLFRIFSPYGHIFQINI--------KNAFGFIQYDDP 385

Query: 397 KNAVNAYVELDKQ 409
           ++  +A +E + Q
Sbjct: 386 QSVKDA-IECESQ 397

>Kwal_33.14810
          Length = 574

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 31/72 (43%), Gaps = 1/72 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSA-RGFAFVEFLLPKEAENAMDQLHG 825
           +KN+PF   ++ + ++               FD    RG AF  F    E    +  L+G
Sbjct: 35  IKNIPFAIKKEQLLDVIAKMNLPLPYAFNYHFDNGVFRGLAFANFATTDETTQVVHMLNG 94

Query: 826 VHLLGRRLVMQY 837
             + GR+L ++Y
Sbjct: 95  KEIGGRKLRVEY 106

>ADL371C [1370] [Homologous to ScYBR119W (MUD1) - SH]
           (55727..56570,56628..56638) [855 bp, 284 aa]
          Length = 284

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 526 TNQRDDKVILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFT 585
            N   +KV+LV++ P   T +EL ++F    KL ++ +     +A V + D  SA A   
Sbjct: 207 ANNPPNKVLLVQDLPTDITEQELVDIFA-NDKLLQVRLVQVRQLAFVDYADVQSATAVKN 265

Query: 586 KL 587
           KL
Sbjct: 266 KL 267

>YMR268C (PRP24) [4222] chr13 complement(802887..804221) Pre-mRNA
           splicing factor, responsible for reannealing U4 and U6
           snRNAs to recycle snRNPs for subsequent splicing
           reactions, has 3 RNA recognition (RRM) domains [1335 bp,
           444 aa]
          Length = 444

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 767 VKNLPFEATRKDVFELFNSFGQLK-SVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHG 825
           + N P   T++++ +L      +  S+R+P     ++R FA+++    ++A   +++L+G
Sbjct: 121 MTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNG 180

Query: 826 VHLLGRRLV 834
           + + G  LV
Sbjct: 181 LKIEGYTLV 189

>Scas_632.7*
          Length = 229

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 14/84 (16%)

Query: 3   RIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFGFI 62
           ++ V+GLP  +  D +RE F  +         V G     +  V +  +  G+S     I
Sbjct: 78  KVNVEGLPRDIKQDAVREFFASQ---------VGG-----VQRVLLSYNERGQSTGMANI 123

Query: 63  GYRNEEDAFDAVEYFNGSFINTSK 86
            +RN + A  AV  FNG+ I+  +
Sbjct: 124 TFRNAQQAKVAVTKFNGAPIDGGR 147

>Kwal_56.23945
          Length = 806

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 338 IEKINQTGRLFLRNI-LYTSKEEDFRKLFSPFGELEEVHV 376
           I+ I    RLF+ N+ L    ++D  ++FSP+G + ++++
Sbjct: 355 IQNIPPKSRLFIGNLPLKNVAKDDLFRIFSPYGHIYQINI 394

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.130    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,909,953
Number of extensions: 1431266
Number of successful extensions: 14337
Number of sequences better than 10.0: 1343
Number of HSP's gapped: 11864
Number of HSP's successfully gapped: 2195
Length of query: 872
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 762
Effective length of database: 12,788,129
Effective search space: 9744554298
Effective search space used: 9744554298
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)