Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPR065W (ROX1)36836210111e-136
Scas_667.28372742992e-30
Sklu_2286.4308742583e-25
ADL331C416732245e-20
CAGL0D05434g241871947e-17
Scas_614.4294761941e-16
Kwal_55.21061337771943e-16
AAR026W336781845e-15
KLLA0B11495g393841848e-15
Sklu_2103.3230761513e-11
CAGL0L02013g50370940.001
Scas_378.249370940.001
YKL032C (IXR1)59770930.002
Kwal_26.804341070830.024
YPR052C (NHP6A)9334690.33
KLLA0B12056g9338670.50
KLLA0C03157g25783710.66
KLLA0B14575g25783710.66
Kwal_27.125399338660.83
YBR089C-A (NHP6B)9934651.2
KLLA0D18029g24479681.3
Sklu_2216.19338632.0
ADL310W9438632.1
Scas_642.2115057652.3
Scas_667.1710138613.9
Scas_718.179428614.0
CAGL0K11396g144740654.4
CAGL0E00737g27454645.1
KLLA0C13233g26250627.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR065W
         (362 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR065W (ROX1) [5493] chr16 (679688..680794) Heme-dependent tran...   394   e-136
Scas_667.28                                                           119   2e-30
Sklu_2286.4 YPR065W, Contig c2286 4323-5249                           103   3e-25
ADL331C [1410] [Homologous to ScYPR065W (ROX1) - SH] (119995..12...    91   5e-20
CAGL0D05434g complement(518042..518767) some similarities with s...    79   7e-17
Scas_614.4                                                             79   1e-16
Kwal_55.21061                                                          79   3e-16
AAR026W [212] [Homologous to NOHBY] complement(388824..389834) [...    75   5e-15
KLLA0B11495g complement(1006306..1007487) some similarities with...    75   8e-15
Sklu_2103.3 , Contig c2103 5595-6287                                   63   3e-11
CAGL0L02013g complement(233619..235130) some similarities with s...    41   0.001
Scas_378.2                                                             41   0.001
YKL032C (IXR1) [3225] chr11 complement(379708..381501) Intrastra...    40   0.002
Kwal_26.8043                                                           37   0.024
YPR052C (NHP6A) [5483] chr16 complement(665688..665969) Protein ...    31   0.33 
KLLA0B12056g 1056188..1056469 highly similar to sp|P11632 Saccha...    30   0.50 
KLLA0C03157g 281410..282183 gi|10643641|gb|AAG21093.1|AF195067_1...    32   0.66 
KLLA0B14575g 1280163..1280936 sp|Q9HG13 Kluyveromyces lactis A2p...    32   0.66 
Kwal_27.12539                                                          30   0.83 
YBR089C-A (NHP6B) [280] chr2 complement(426147..426446) Protein ...    30   1.2  
KLLA0D18029g join(1521909..1521950,1522143..1522835) highly simi...    31   1.3  
Sklu_2216.1 YPR052C, Contig c2216 1623-1904                            29   2.0  
ADL310W [1431] [Homologous to ScYPR052C (NHP6A) - SH; ScYBR089C-...    29   2.1  
Scas_642.21                                                            30   2.3  
Scas_667.17                                                            28   3.9  
Scas_718.17                                                            28   4.0  
CAGL0K11396g complement(1102935..1107278) weakly similar to sp|P...    30   4.4  
CAGL0E00737g complement(66741..67565) similar to tr|Q03973 Sacch...    29   5.1  
KLLA0C13233g complement(1129020..1129808) weakly similar to sp|Q...    28   7.7  

>YPR065W (ROX1) [5493] chr16 (679688..680794) Heme-dependent
           transcriptional repressor of hypoxic genes including
           CYC7 and ANB1 [1107 bp, 368 aa]
          Length = 368

 Score =  394 bits (1011), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 220/362 (60%), Positives = 220/362 (60%)

Query: 1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIGTKWKGLQPED 60
           MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIGTKWKGLQPED
Sbjct: 1   MNPKSSTPKIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIGTKWKGLQPED 60

Query: 61  KAHWENLAEKEKLEHERKYPEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
           KAHWENLAEKEKLEHERKYPEY                                      
Sbjct: 61  KAHWENLAEKEKLEHERKYPEYKYKPVRKSKKKQLLLKEIEQQQQQQQKEQQQQKQSQPQ 120

Query: 121 XXXXFNNNIVLMKRAHXXXXXXXXXXXXXYQFQLNNDLKRLPIPSVNTSNYMVSRSLSGL 180
               FNNNIVLMKRAH             YQFQLNNDLKRLPIPSVNTSNYMVSRSLSGL
Sbjct: 121 LQQPFNNNIVLMKRAHSLSPSSSVSSSNSYQFQLNNDLKRLPIPSVNTSNYMVSRSLSGL 180

Query: 181 PLTHDKTARDLPQLSSQLNSIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIIN 240
           PLTHDKTARDLPQLSSQLNSIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIIN
Sbjct: 181 PLTHDKTARDLPQLSSQLNSIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQLPFISSIIN 240

Query: 241 NXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLEXXXXXXXXXXXQYXXXXXXXXXXXXX 300
           N                              VLE           QY             
Sbjct: 241 NSSQTPVTTTTTSTTTATSSPGKFSSSPNSSVLENNRLNSINNSNQYLPPPLLPSLQDFQ 300

Query: 301 XXXXXXXXXMGPTYIVKPLSHTRXXXXXXXXXXXXXXXXXXXXXXXXHQIINSSNTEVTA 360
                    MGPTYIVKPLSHTR                        HQIINSSNTEVTA
Sbjct: 301 LDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTPTHHHIPHIPNQNIPLHQIINSSNTEVTA 360

Query: 361 KT 362
           KT
Sbjct: 361 KT 362

>Scas_667.28
          Length = 372

 Score =  119 bits (299), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 51/74 (68%), Positives = 61/74 (82%)

Query: 9   KIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIGTKWKGLQPEDKAHWENLA 68
           KIPRPKNAFILFRQHYH+ LIDEWT  G +IPHNS ISKI+G KWK +   +K HW +LA
Sbjct: 69  KIPRPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISENEKTHWSDLA 128

Query: 69  EKEKLEHERKYPEY 82
           ++EKLEH +KYP+Y
Sbjct: 129 KEEKLEHLKKYPQY 142

>Sklu_2286.4 YPR065W, Contig c2286 4323-5249
          Length = 308

 Score =  103 bits (258), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 62/74 (83%)

Query: 9  KIPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIGTKWKGLQPEDKAHWENLA 68
          KIPRP+NAFILFRQH+H++LID+   +G  IPHNS ISK++GT+W+ L  ++K++W++ A
Sbjct: 4  KIPRPRNAFILFRQHHHKLLIDQLREEGKPIPHNSEISKLLGTRWRSLSTDEKSYWDSKA 63

Query: 69 EKEKLEHERKYPEY 82
          + EK EHE+KYP+Y
Sbjct: 64 QLEKEEHEKKYPDY 77

>ADL331C [1410] [Homologous to ScYPR065W (ROX1) - SH]
          (119995..121245) [1251 bp, 416 aa]
          Length = 416

 Score = 90.9 bits (224), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 40/73 (54%), Positives = 49/73 (67%)

Query: 10 IPRPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIGTKWKGLQPEDKAHWENLAE 69
          IPRP+NAFILFR H  ++L D W   G +IPHN  +SKII  +WK L  E+K  W + AE
Sbjct: 24 IPRPRNAFILFRSHQQKLLTDYWKQSGQDIPHNCEVSKIISYQWKKLTAEEKKEWHDKAE 83

Query: 70 KEKLEHERKYPEY 82
           EK EH +KYP Y
Sbjct: 84 LEKQEHAKKYPGY 96

>CAGL0D05434g complement(518042..518767) some similarities with
           sp|P25042 Saccharomyces cerevisiae YPR065w ROX1,
           hypothetical start
          Length = 241

 Score = 79.3 bits (194), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 51/87 (58%), Gaps = 8/87 (9%)

Query: 4   KSSTPK-IPRPKNAFILFRQHYHRILIDEWTAQ-------GVEIPHNSNISKIIGTKWKG 55
           K+++P+ IPRP+NAFILFRQH HR L  + T               NS  S+ IG KW+ 
Sbjct: 139 KAASPRHIPRPRNAFILFRQHMHRKLFPKLTKDKQKSSDNSSSFKTNSECSREIGQKWRN 198

Query: 56  LQPEDKAHWENLAEKEKLEHERKYPEY 82
           L PE+K +W  LA KEK  H  KYP Y
Sbjct: 199 LDPEEKKYWNELARKEKEWHRMKYPNY 225

>Scas_614.4
          Length = 294

 Score = 79.3 bits (194), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 37/76 (48%), Positives = 50/76 (65%), Gaps = 3/76 (3%)

Query: 10  IPRPKNAFILFRQHYHRILI---DEWTAQGVEIPHNSNISKIIGTKWKGLQPEDKAHWEN 66
           IPRP+NAFILFRQH H  L     E   +      NSN+S+ IG +W+ L  +DK +W++
Sbjct: 198 IPRPRNAFILFRQHLHHSLFPKNKELLDKEGSFKTNSNVSREIGQRWRALDEDDKKYWQD 257

Query: 67  LAEKEKLEHERKYPEY 82
           LA+KEK  H++KYP Y
Sbjct: 258 LAQKEKEWHKKKYPNY 273

>Kwal_55.21061
          Length = 337

 Score = 79.3 bits (194), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 36/77 (46%), Positives = 50/77 (64%), Gaps = 4/77 (5%)

Query: 10  IPRPKNAFILFRQHYHRILIDEWTAQG----VEIPHNSNISKIIGTKWKGLQPEDKAHWE 65
           IPRP+NAFILFRQH H+ L  + +A      V    NS IS+ IG +W+ L   D+ HW+
Sbjct: 235 IPRPRNAFILFRQHLHQQLFAKQSASCENTEVSFKTNSQISREIGQRWRELNDADRCHWQ 294

Query: 66  NLAEKEKLEHERKYPEY 82
           +LA +EK  H ++YP+Y
Sbjct: 295 DLAAREKELHRKRYPDY 311

>AAR026W [212] [Homologous to NOHBY] complement(388824..389834)
           [1011 bp, 336 aa]
          Length = 336

 Score = 75.5 bits (184), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 49/78 (62%), Gaps = 5/78 (6%)

Query: 10  IPRPKNAFILFRQHYHRILIDEWTAQGVE-----IPHNSNISKIIGTKWKGLQPEDKAHW 64
           IPRP+NAFILFRQH+H+ L  +   +  E        NS +S  IG +W+ L PE++  W
Sbjct: 225 IPRPRNAFILFRQHWHQQLFPQERIKQSERGNGSFKTNSQVSVDIGQRWRSLSPEERQKW 284

Query: 65  ENLAEKEKLEHERKYPEY 82
            + A++EK EH RKYP Y
Sbjct: 285 LDFAKREKEEHMRKYPNY 302

>KLLA0B11495g complement(1006306..1007487) some similarities with
           ca|CA0346|CaROX1 Candida albicans Possible
           heme-dependent transcriptional repressor (by homology),
           hypothetical start
          Length = 393

 Score = 75.5 bits (184), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 53/84 (63%), Gaps = 11/84 (13%)

Query: 10  IPRPKNAFILFRQHYHRILIDEW-------TAQGVE----IPHNSNISKIIGTKWKGLQP 58
           IPRP+NAFILFRQH+H+ + D+        T+QG         NS  S+ IG KW+ L  
Sbjct: 281 IPRPRNAFILFRQHWHQQVFDQEKEKITTDTSQGTSKLGSFKANSQASRDIGRKWRSLPD 340

Query: 59  EDKAHWENLAEKEKLEHERKYPEY 82
            +K +W +LA++EK  H++KYP+Y
Sbjct: 341 SEKKYWLDLAKQEKEAHKKKYPDY 364

>Sklu_2103.3 , Contig c2103 5595-6287
          Length = 230

 Score = 62.8 bits (151), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (65%), Gaps = 2/76 (2%)

Query: 9   KIPRPKNAFILFRQHYHRILIDEWTAQGVE--IPHNSNISKIIGTKWKGLQPEDKAHWEN 66
           +IPRP+NAFILFRQH H+ L     +Q  +     N  +S+ IG +W+ L  E++ +W +
Sbjct: 123 RIPRPRNAFILFRQHLHQSLFPSQYSQSTQGSFKTNCEVSREIGQRWRQLSNEERQYWND 182

Query: 67  LAEKEKLEHERKYPEY 82
           L++KEK  H+ KYP+Y
Sbjct: 183 LSKKEKELHKEKYPDY 198

>CAGL0L02013g complement(233619..235130) some similarities with
           sp|P33417 Saccharomyces cerevisiae YKL032c IXR1,
           hypothetical start
          Length = 503

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 5/70 (7%)

Query: 12  RPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIGTKWKGLQPEDKAHWENLAEKE 71
           RP   FI F Q    I++ E   + +       I+KIIG+KW+ L P  K  +  + +K 
Sbjct: 381 RPSGPFIQFTQEIRPIVVKENPDKNL-----IEITKIIGSKWRDLDPAKKNEYTEMYKKR 435

Query: 72  KLEHERKYPE 81
             E E  YPE
Sbjct: 436 LKEWEECYPE 445

>Scas_378.2
          Length = 493

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 5/70 (7%)

Query: 12  RPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIGTKWKGLQPEDKAHWENLAEKE 71
           RP   FI F Q     ++ E   + +       I+KIIG KW+ L PE KA +    ++ 
Sbjct: 418 RPSGPFIQFTQEIRPTIVKENPDKNL-----IEITKIIGEKWRELDPEKKAAYTETYKRR 472

Query: 72  KLEHERKYPE 81
             E E+ YPE
Sbjct: 473 LXEWEKCYPE 482

>YKL032C (IXR1) [3225] chr11 complement(379708..381501) Intrastrand
           crosslink recognition protein and transcription factor
           that confers oxygen (O2) regulation on COX5B, has 2
           HMG-box DNA-binding domains [1794 bp, 597 aa]
          Length = 597

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 5/70 (7%)

Query: 12  RPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIGTKWKGLQPEDKAHWENLAEKE 71
           RP   FI F Q     ++ E   +G+       I+KIIG +W+ L P  KA +    +K 
Sbjct: 436 RPSGPFIQFTQEIRPTVVKENPDKGL-----IEITKIIGERWRELDPAKKAEYTETYKKR 490

Query: 72  KLEHERKYPE 81
             E E  YP+
Sbjct: 491 LKEWESCYPD 500

>Kwal_26.8043
          Length = 410

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 5/70 (7%)

Query: 12  RPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIGTKWKGLQPEDKAHWENLAEKE 71
           RP   FI F Q     +I E   + +       I+K+IG KW+ L   DK  + +  +++
Sbjct: 329 RPSGPFIQFTQEVRPQIIRENPTKDL-----IEITKLIGEKWRSLSAVDKRSYTDTYKRK 383

Query: 72  KLEHERKYPE 81
             E E +YPE
Sbjct: 384 LKEWEEQYPE 393

>YPR052C (NHP6A) [5483] chr16 complement(665688..665969) Protein
          with DNA-binding and DNA-bending activity, involved in
          transcriptional activation of a number of genes,
          preferentially binds cisplatin-modified DNA,
          functionally redundant with Nhp6Bp [282 bp, 93 aa]
          Length = 93

 Score = 31.2 bits (69), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 43 SNISKIIGTKWKGLQPEDKAHWENLAEKEKLEHE 76
            + K +G KWK L PE+K  +E  A+ +K  +E
Sbjct: 49 GQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYE 82

>KLLA0B12056g 1056188..1056469 highly similar to sp|P11632
          Saccharomyces cerevisiae YPR052c NHP6A nonhistone
          chromosomal protein related to mammalian HMG1, start by
          similarity
          Length = 93

 Score = 30.4 bits (67), Expect = 0.50,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 45 ISKIIGTKWKGLQPEDKAHWENLAEKEKLEHERKYPEY 82
          + +I+G KWK L  ++KA +E  AE +K  +E +   Y
Sbjct: 48 VGRILGEKWKALNEDEKAPYEAKAEADKKRYESEKELY 85

>KLLA0C03157g 281410..282183 gi|10643641|gb|AAG21093.1|AF195067_1
           Kluyveromyces lactis a2p, start by similarity
          Length = 257

 Score = 32.0 bits (71), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 6/83 (7%)

Query: 4   KSSTPKIPRPKNAFILFRQHYHRI----LIDEWTAQGVEIPHNSNISKIIGTKWKGLQPE 59
           K +T K  RP+N F+L R  ++R     ++  +    +E    +  SKI    W    P+
Sbjct: 52  KENTKKYTRPRNQFVLMRTLFNRRVNNHILQYYNKSKLEKKMFTLTSKITSELWNESSPD 111

Query: 60  DKAHWENLAEKEKLEHERKYPEY 82
            K+++  LA  E  E+  KY  Y
Sbjct: 112 LKSYFSLLATLE--ENWHKYTHY 132

>KLLA0B14575g 1280163..1280936 sp|Q9HG13 Kluyveromyces lactis A2p,
           start by similarity
          Length = 257

 Score = 32.0 bits (71), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 6/83 (7%)

Query: 4   KSSTPKIPRPKNAFILFRQHYHRI----LIDEWTAQGVEIPHNSNISKIIGTKWKGLQPE 59
           K +T K  RP+N F+L R  ++R     ++  +    +E    +  SKI    W    P+
Sbjct: 52  KENTKKYTRPRNQFVLMRTLFNRRVNNHILQYYNKSKLEKKMFTLTSKITSELWNESSPD 111

Query: 60  DKAHWENLAEKEKLEHERKYPEY 82
            K+++  LA  E  E+  KY  Y
Sbjct: 112 LKSYFSLLATLE--ENWHKYTHY 132

>Kwal_27.12539
          Length = 93

 Score = 30.0 bits (66), Expect = 0.83,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 45 ISKIIGTKWKGLQPEDKAHWENLAEKEKLEHERKYPEY 82
          + +I+G KWK L  E+K  +E  AE +K  +E +   Y
Sbjct: 51 VGRILGEKWKALNDEEKVPYEAKAESDKKRYESEKELY 88

>YBR089C-A (NHP6B) [280] chr2 complement(426147..426446) Protein
          with DNA-binding and DNA-bending activity, involved in
          transcriptional activation of a number of genes,
          functionally redundant with Nhp6Ap [300 bp, 99 aa]
          Length = 99

 Score = 29.6 bits (65), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 21/34 (61%)

Query: 43 SNISKIIGTKWKGLQPEDKAHWENLAEKEKLEHE 76
            + +I+G +WK L  E+K  +E+ A+ +K  +E
Sbjct: 55 GQVGRILGERWKALTAEEKQPYESKAQADKKRYE 88

>KLLA0D18029g join(1521909..1521950,1522143..1522835) highly similar
           to YDR174w Saccharomyces cerevisiae YDR174w HMO1
           Non-histone protein singleton, hypothetical start
          Length = 244

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 35/79 (44%), Gaps = 9/79 (11%)

Query: 9   KIPR-------PKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIGTKWKGLQPEDK 61
           KIPR       P   F  +  +  + L DE    G+    ++ I++ I  KWK L   +K
Sbjct: 98  KIPRDPYAPKKPLTVFFAYSAYVRQALRDERQRAGLPPLSSTEITQEISKKWKDLGDSEK 157

Query: 62  AHWENL--AEKEKLEHERK 78
             W+    AE E  + E++
Sbjct: 158 DKWKQAYNAELENYQREKQ 176

>Sklu_2216.1 YPR052C, Contig c2216 1623-1904
          Length = 93

 Score = 28.9 bits (63), Expect = 2.0,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 45 ISKIIGTKWKGLQPEDKAHWENLAEKEKLEHERKYPEY 82
          + +I+G KWK L  E+K  +E  A+ +K  +E +   Y
Sbjct: 51 VGRILGEKWKALTDEEKQPYEAKADADKKRYESEKELY 88

>ADL310W [1431] [Homologous to ScYPR052C (NHP6A) - SH; ScYBR089C-A
          (NHP6B) - SH] complement(153085..153369) [285 bp, 94
          aa]
          Length = 94

 Score = 28.9 bits (63), Expect = 2.1,   Method: Composition-based stats.
 Identities = 12/38 (31%), Positives = 22/38 (57%)

Query: 45 ISKIIGTKWKGLQPEDKAHWENLAEKEKLEHERKYPEY 82
          + +++G KWK L  ++K  +E  AE +K  +E +   Y
Sbjct: 51 VGRVLGEKWKALSDDEKQPYEAKAEADKKRYESEKELY 88

>Scas_642.21
          Length = 150

 Score = 29.6 bits (65), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 10/57 (17%)

Query: 12  RPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIGTKWKGLQPEDKAHWENLA 68
           +P N FILFR +Y R     W   G++    + +S+++   WK     D+A W+  A
Sbjct: 90  KPINGFILFRSYYSR-----W-GYGIK---QTMLSQLLAKFWKS-SDTDQALWDYFA 136

>Scas_667.17
          Length = 101

 Score = 28.1 bits (61), Expect = 3.9,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 45 ISKIIGTKWKGLQPEDKAHWENLAEKEKLEHERKYPEY 82
          + K++G KWK L  E+K  +E  A+ +K  +E +   Y
Sbjct: 50 VGKVLGEKWKALTAEEKEPYEAKAKADKKRYESEKELY 87

>Scas_718.17
          Length = 94

 Score = 28.1 bits (61), Expect = 4.0,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 20/28 (71%)

Query: 45 ISKIIGTKWKGLQPEDKAHWENLAEKEK 72
          + K++G +WK L PE+K  +E  A+++K
Sbjct: 52 VGKLLGERWKALTPEEKEPFELKAKQDK 79

>CAGL0K11396g complement(1102935..1107278) weakly similar to
           sp|P11978 Saccharomyces cerevisiae YDR227w SIR4
           silencing regulatory and DNA-repair protein,
           hypothetical start
          Length = 1447

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 193 QLSSQLNSIPYYSAPHDPSTRHHYLNVAQAQPRANSTPQL 232
           Q + ++N +P Y A +  ++  H ++  Q Q R++STPQL
Sbjct: 240 QTNQRINGVPSYGAYNIVNSYGHVMSAPQRQRRSDSTPQL 279

>CAGL0E00737g complement(66741..67565) similar to tr|Q03973
           Saccharomyces cerevisiae YDR174w Non-histone protein,
           hypothetical start
          Length = 274

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 25/54 (46%)

Query: 12  RPKNAFILFRQHYHRILIDEWTAQGVEIPHNSNISKIIGTKWKGLQPEDKAHWE 65
           +P   F  +  +  + L D     G+    ++ I++ I  KWK L  E+K  W+
Sbjct: 123 KPLTVFFAYSAYVRQELRDARAQAGLPPLSSTEITQEISKKWKNLSDEEKEKWK 176

>KLLA0C13233g complement(1129020..1129808) weakly similar to
           sp|Q12241 Saccharomyces cerevisiae YOR106w VAM3 syntaxin
           (t-SNARE) singleton, start by similarity
          Length = 262

 Score = 28.5 bits (62), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 6/50 (12%)

Query: 154 LNNDLKRLPIPSVNTSNYMVSRSLSGLPL--THDKTARDLPQLSSQLNSI 201
           L  D+K   IP +      +SR L+ L    T DK ARD   LS Q NS+
Sbjct: 53  LRVDIKNRVIPEIQK----ISRKLADLTSLDTQDKFARDFQALSKQYNSV 98

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.130    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,623,447
Number of extensions: 264256
Number of successful extensions: 858
Number of sequences better than 10.0: 38
Number of HSP's gapped: 859
Number of HSP's successfully gapped: 40
Length of query: 362
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 259
Effective length of database: 13,030,455
Effective search space: 3374887845
Effective search space used: 3374887845
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)