Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPR063C1401396542e-89
CAGL0D01540g1271204127e-53
Scas_667.26*1261193911e-49
Kwal_27.1261072711854e-19
ADL329W111951824e-18
KLLA0B08415g1211081679e-16
Scas_562.571288740.052
Sklu_2310.511560630.78
Scas_695.4228838641.1
CAGL0E02959g83032612.5
ABL081W164583579.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR063C
         (139 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR063C (YPR063C) [5492] chr16 complement(677807..678188,678275....   256   2e-89
CAGL0D01540g 166233..166616 similar to tr|Q12160 Saccharomyces c...   163   7e-53
Scas_667.26*                                                          155   1e-49
Kwal_27.12610                                                          76   4e-19
ADL329W [1412] [Homologous to ScYPR063C - SH] complement(122957....    75   4e-18
KLLA0B08415g 749520..749885 weakly similar to sgd|S0006267 Sacch...    69   9e-16
Scas_562.5                                                             33   0.052
Sklu_2310.5 YER092W, Contig c2310 7669-8016 reverse complement         29   0.78 
Scas_695.42                                                            29   1.1  
CAGL0E02959g 279623..282115 some similarities with sp|P48237 Sac...    28   2.5  
ABL081W [511] [Homologous to ScYJR140C (HIR3) - SH] complement(2...    27   9.3  

>YPR063C (YPR063C) [5492] chr16
           complement(677807..678188,678275..678315) Protein of
           unknown function [423 bp, 140 aa]
          Length = 140

 Score =  256 bits (654), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 124/139 (89%)

Query: 1   MTLNNVARPDLCVSYKKIAPPKGLYSATPSISGVVNQSMPMAAIFLRNKFIAWFSLIQSV 60
           MTLNNVARPDLCVSYKKIAPPKGLYSATPSISGVVNQSMPMAAIFLRNKFIAWFSLIQSV
Sbjct: 1   MTLNNVARPDLCVSYKKIAPPKGLYSATPSISGVVNQSMPMAAIFLRNKFIAWFSLIQSV 60

Query: 61  HYYLNTDEDIIVAYKENKAPSPMDQPPAIKLFMSLIGLCVCYMNLVFPQQIAQPSSSGSK 120
           HYYLNTDEDIIVAYKENKAPSPMDQPPAIKLFMSLIGLCVCYMNLVFPQQIAQPSSSGSK
Sbjct: 61  HYYLNTDEDIIVAYKENKAPSPMDQPPAIKLFMSLIGLCVCYMNLVFPQQIAQPSSSGSK 120

Query: 121 GNXXXXXXXXXXXXXXXAK 139
           GN               AK
Sbjct: 121 GNTETTIETTTEVETETAK 139

>CAGL0D01540g 166233..166616 similar to tr|Q12160 Saccharomyces
           cerevisiae YPR063c, start by similarity
          Length = 127

 Score =  163 bits (412), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 91/120 (75%)

Query: 1   MTLNNVARPDLCVSYKKIAPPKGLYSATPSISGVVNQSMPMAAIFLRNKFIAWFSLIQSV 60
           M LNNV R DLCV YKK  PP+G+YS + S+SG+VNQ+MPMAAIFL+NKFIAWFSLIQSV
Sbjct: 1   MALNNVRRQDLCVQYKKSEPPRGIYSESQSLSGIVNQTMPMAAIFLKNKFIAWFSLIQSV 60

Query: 61  HYYLNTDEDIIVAYKENKAPSPMDQPPAIKLFMSLIGLCVCYMNLVFPQQIAQPSSSGSK 120
           H YLNTDE+ +   K     S +DQPP +K+ MSL+G+ VCYMNLVFP   A P SS  K
Sbjct: 61  HSYLNTDEETLEKNKSKTGNSALDQPPLVKVAMSLVGILVCYMNLVFPTPDAPPPSSEKK 120

>Scas_667.26*
          Length = 126

 Score =  155 bits (391), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 76/119 (63%), Positives = 91/119 (76%), Gaps = 3/119 (2%)

Query: 1   MTLNNVARPDLCVSYKKIAPPKGLYSATPSISGVVNQSMPMAAIFLRNKFIAWFSLIQSV 60
           M LNNV RPDLC    +  PPKGLYS  PS+SG+VNQSMPMAAIFLRN+F+AWF++IQSV
Sbjct: 1   MGLNNVKRPDLCARASRAIPPKGLYSTLPSMSGIVNQSMPMAAIFLRNRFVAWFAVIQSV 60

Query: 61  HYYLNTDEDIIVAYKENKAPSPMDQPPAIKLFMSLIGLCVCYMNLVFP--QQIAQPSSS 117
           HYYLNTDED   A K+ K  S ++Q P IK+ M+++GL VCYMNLVFP   Q+ QP S 
Sbjct: 61  HYYLNTDEDEANA-KDGKQSSSIEQTPIIKVAMAMVGLIVCYMNLVFPVVNQMPQPPSD 118

>Kwal_27.12610
          Length = 72

 Score = 75.9 bits (185), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 11/71 (15%)

Query: 39  MPMAAIFLRNKFIAWFSLIQSVHYYLNTDEDIIVAYKENKAPSPMDQPPAIKLFMSLIGL 98
           MPMAA+F+RNKF+AWF+L+ +VHY L T+ D           +  DQ   +K+ MSL+ L
Sbjct: 1   MPMAAMFMRNKFLAWFALLSTVHYALTTEPD-----------ANADQSAVVKVLMSLVSL 49

Query: 99  CVCYMNLVFPQ 109
            VCY+N+ FPQ
Sbjct: 50  AVCYINVAFPQ 60

>ADL329W [1412] [Homologous to ScYPR063C - SH]
           complement(122957..123292) [336 bp, 111 aa]
          Length = 111

 Score = 74.7 bits (182), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 8/95 (8%)

Query: 15  YKKIAPPKGLYSATPSISGVVNQSMPMAAIFLRNKFIAWFSLIQSVHYYLNTDEDIIVAY 74
           Y  +  P   Y  T +  GVV+QSMPM A+F+RNKF+AWFSL+ + H YL  D +   A 
Sbjct: 18  YTHVLAPDTAY--TGASQGVVSQSMPMLAMFMRNKFLAWFSLLTAWHTYLTADPN---AV 72

Query: 75  KENKAPSPMDQPPAIKLFMSLIGLCVCYMNLVFPQ 109
           ++ +     +  P +KL M+++ + VCY  +V PQ
Sbjct: 73  RDREG---TEVGPIMKLGMAVVAVVVCYTGMVLPQ 104

>KLLA0B08415g 749520..749885 weakly similar to sgd|S0006267
           Saccharomyces cerevisiae YPR063c hypothetical protein,
           start by similarity
          Length = 121

 Score = 68.9 bits (167), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 68/108 (62%), Gaps = 10/108 (9%)

Query: 1   MTLNNVARPDLCVSYKKIAPPKGLYSATPSISGVVNQSMPMAAIFLRNKFIAWFSLIQSV 60
           M LNNV RPDL  +Y     PKGLYS++ S  G+++QSMPMAA+F++NKF+AWF+++ + 
Sbjct: 1   MPLNNVRRPDLVATYNHTPAPKGLYSSSSSSQGMLSQSMPMAAMFMKNKFLAWFAVLTTW 60

Query: 61  HYYLNTDEDIIVAYKENKAPSPMDQPPAIKLFMSLIGLCVCYMNLVFP 108
           H +L +  D          PS     P +K+ M+++ + + Y+ L FP
Sbjct: 61  HVFLTSQPD----------PSNPTDSPFMKIGMAVLAVGMNYLGLFFP 98

>Scas_562.5
          Length = 712

 Score = 33.1 bits (74), Expect = 0.052,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 37/88 (42%), Gaps = 7/88 (7%)

Query: 9   PDLCVSYKKIAPPKGLYSATPSISGVVNQSMPMAAIFLRNKFIAWFSLIQSVHYYLNTDE 68
           PDLC +Y     P+   +     S       P+A+  +  + I+  S +  +HYYL +DE
Sbjct: 394 PDLCTNYYGAIDPQDAVTGNAPTS-------PLASSVMSTEIISNLSRVSKLHYYLVSDE 446

Query: 69  DIIVAYKENKAPSPMDQPPAIKLFMSLI 96
                Y  N     +     I L++ L+
Sbjct: 447 CTSSVYFSNSEFFTLVFVTPISLYLHLL 474

>Sklu_2310.5 YER092W, Contig c2310 7669-8016 reverse complement
          Length = 115

 Score = 28.9 bits (63), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 14/60 (23%), Positives = 26/60 (43%)

Query: 37 QSMPMAAIFLRNKFIAWFSLIQSVHYYLNTDEDIIVAYKENKAPSPMDQPPAIKLFMSLI 96
          + +      LR ++      I S+H  L   EDI        +P  +++ P +K +M L+
Sbjct: 21 EELTKQETSLRREYTTLLRKIASLHTVLRNLEDIDDLSGRTLSPETLEKVPQLKRYMDLV 80

>Scas_695.42
          Length = 288

 Score = 29.3 bits (64), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 72  VAYKENKAPSPMDQPPAIKLFMSLIGLCVCYMNLVFPQ 109
           + +KE+   SP  QP         IGL +CY +L FP+
Sbjct: 138 ITFKESTTLSPGSQPTTFSTKYGQIGLGICY-DLRFPE 174

>CAGL0E02959g 279623..282115 some similarities with sp|P48237
           Saccharomyces cerevisiae YGR150c, hypothetical start
          Length = 830

 Score = 28.1 bits (61), Expect = 2.5,   Method: Composition-based stats.
 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 41  MAAIFLRNKFIAW-FSLIQSVHYYLNTDEDII 71
           MA +     FI W +S+++S+H+ L   EDII
Sbjct: 767 MAVVLSSKNFIKWDYSMVKSLHHGLIEAEDII 798

>ABL081W [511] [Homologous to ScYJR140C (HIR3) - SH]
            complement(243824..248761) [4938 bp, 1645 aa]
          Length = 1645

 Score = 26.6 bits (57), Expect = 9.3,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 7/83 (8%)

Query: 22   KGLYSATPSISGVVNQSMPMAAIFLRNKFIAWFSLIQSVHYYLNTD-----EDIIVAYKE 76
            K    A PS    + +++    ++  N+F  WF L +   Y +  D     + ++VA K 
Sbjct: 1087 KKTLQARPSELDSIIETLKADILYKTNRFETWFLLGKCYSYVVEDDLIWTSDRLVVASK- 1145

Query: 77   NKAPSPMDQPPAIKLFMSLIGLC 99
             KA +   Q  AI  ++  + LC
Sbjct: 1146 -KATTASIQRKAILCYLMALNLC 1167

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.133    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,102,972
Number of extensions: 157201
Number of successful extensions: 338
Number of sequences better than 10.0: 12
Number of HSP's gapped: 335
Number of HSP's successfully gapped: 12
Length of query: 139
Length of database: 16,596,109
Length adjustment: 91
Effective length of query: 48
Effective length of database: 13,445,871
Effective search space: 645401808
Effective search space used: 645401808
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 56 (26.2 bits)