Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPR058W (YMC1)30730216150.0
Scas_667.2230630313980.0
CAGL0D01606g30530213000.0
Kwal_27.1259930430211871e-165
Sklu_1926.230530411771e-164
KLLA0B08503g30330211441e-159
YBR104W (YMC2)32932410601e-145
Scas_718.532432110361e-142
CAGL0K12210g31130710291e-141
Kwal_33.1298830330210151e-139
Sklu_2398.43093019641e-131
Sklu_1275.13113019621e-131
Kwal_56.230113033019331e-126
KLLA0F17864g3073058551e-115
Scas_697.473282903639e-41
ADL264C3292923631e-40
KLLA0C13431g3282943612e-40
CAGL0B04543g3173143542e-39
YOR100C (CRC1)3273033533e-39
Sklu_2127.52782823477e-39
KLLA0E09680g3072843183e-34
Kwal_23.29133203093165e-34
YOR130C (ORT1)2922903102e-33
Kwal_33.154463052863034e-32
Kwal_55.213353172862931e-30
Sklu_2075.33452972922e-30
CAGL0B03883g3062962815e-29
CAGL0K10362g3013012762e-28
Scas_632.92922982735e-28
KLLA0E02772g2842902726e-28
ADL049W9122832811e-27
AFR146W2812962656e-27
Scas_714.183053032651e-26
AGL311C3622882564e-25
ACR109W2992872492e-24
YPL134C (ODC1)3103062482e-24
KLLA0E13453g9062882554e-24
Kwal_26.86692962842465e-24
KLLA0D07073g2972882449e-24
YPR021C (AGC1)9022802511e-23
YJR095W (SFC1)3222922413e-23
Scas_691.43343152423e-23
Sklu_2037.23103052395e-23
YIL006W3732882408e-23
CAGL0K02365g9192902431e-22
Sklu_2334.23192922343e-22
Scas_602.88852842394e-22
YOR222W (ODC2)3073022316e-22
Kwal_47.173218812872387e-22
CAGL0J02002g3612862283e-21
Sklu_2359.69022932315e-21
Scas_640.253062952221e-20
Kwal_47.182163333162222e-20
Scas_662.123083072193e-20
KLLA0F03212g3052942114e-19
Scas_709.93652912082e-18
CAGL0M09020g3483242063e-18
Scas_589.103163172019e-18
YIL134W (FLX1)3113092001e-17
CAGL0J04114g3032971964e-17
KLLA0F04697g3072941921e-16
CAGL0G08910g2892901912e-16
Scas_379.23012991912e-16
AGL065C3353251895e-16
YPR011C3263281861e-15
CAGL0K02915g3423231861e-15
Kwal_23.47313142971842e-15
ACR260W3113151823e-15
Sklu_2442.82752831813e-15
Kwal_55.208683802951826e-15
Kwal_0.2322742871797e-15
YJL133W (MRS3)3143121807e-15
YHR002W (LEU5)3573201754e-14
AER366W2933001735e-14
Scas_717.203563261746e-14
KLLA0D14036g4313281748e-14
YEL006W3352941728e-14
Sklu_2363.23233231721e-13
CAGL0L05742g3053091711e-13
ADL009W3793081702e-13
KLLA0E15532g3263201683e-13
KLLA0B12826g3193051674e-13
CAGL0J01661g3273191658e-13
AGL047C3162961649e-13
Kwal_33.140503143111622e-12
Scas_582.73293041612e-12
YKR052C (MRS4)3043091594e-12
CAGL0K08250g2972931585e-12
YNL003C (PET8)2842771575e-12
Kwal_26.79672972931576e-12
Kwal_14.22103152991561e-11
Sklu_2432.52882771551e-11
AAL014C2712781532e-11
Scas_558.22892821523e-11
Scas_721.1293232931524e-11
CAGL0G01166g2952781506e-11
CAGL0H03839g2822761496e-11
Sklu_2431.53703111516e-11
Kwal_26.76533253211507e-11
CAGL0G03135g3073041497e-11
Kwal_27.120813693061507e-11
KLLA0C11363g5173071491e-10
Kwal_26.79723583151481e-10
YKL120W (OAC1)3242921471e-10
Scas_716.293163211462e-10
YMR166C3682911472e-10
Sklu_2430.103243091462e-10
KLLA0D04950g2742881434e-10
YLR348C (DIC1)2982771434e-10
CAGL0F07711g3683041428e-10
Scas_669.63732781429e-10
YBR291C (CTP1)2992831419e-10
AER419W4931911421e-09
CAGL0H10538g2971861401e-09
KLLA0A09383g3662021401e-09
Scas_578.3*5242591411e-09
Sklu_1149.22962851391e-09
Scas_721.273743121402e-09
YNL083W5452051402e-09
KLLA0E23705g3683101364e-09
YGR096W (TPC1)3143131354e-09
CAGL0J05522g5193211366e-09
YDL198C (YHM1)3002881346e-09
Kwal_23.39653071831347e-09
Scas_489.42972831331e-08
Scas_562.123002931321e-08
Sklu_2374.75132151331e-08
KLLA0E08877g2942971312e-08
KLLA0D15015g3172931302e-08
Scas_702.103022741284e-08
YFR045W2852091275e-08
AGR383W2931871266e-08
Kwal_23.30425421871278e-08
AEL253W3653111268e-08
Sklu_2435.23442571259e-08
Sklu_2117.22982921241e-07
AER184W3051741241e-07
KLLA0E18810g3772841251e-07
CAGL0J09790g3002961241e-07
AFR131C3442631241e-07
Kwal_23.35293952661241e-07
Kwal_27.116262992971232e-07
CAGL0K11616g3201851232e-07
YBR085W (AAC3)3073081222e-07
YBL030C (PET9)3182501213e-07
KLLA0D09889g3642801213e-07
Kwal_47.192282811421204e-07
AGR191W2983011204e-07
CAGL0L02079g2972981187e-07
KLLA0F13464g3003031179e-07
CAGL0F04213g3061741179e-07
Kwal_23.43543433241189e-07
AFR253W3441651152e-06
KLLA0D04290g1881751122e-06
Sklu_2433.84201561152e-06
CAGL0M05225g3813141143e-06
Scas_718.243371741124e-06
AFR542W3101721124e-06
Kwal_27.114192981871116e-06
Kwal_27.124813041741108e-06
Scas_715.453051931108e-06
KLLA0E02750g3042711099e-06
Scas_667.43081771091e-05
YER053C3002471062e-05
KLLA0E12353g3051501053e-05
AFL196W3612741054e-05
AAR036W3173191035e-05
YMR056C (AAC1)3091791036e-05
CAGL0F00231g3072361028e-05
KLLA0E18788g3813241029e-05
Scas_645.93912001001e-04
YJR077C (MIR1)3111871002e-04
AGL064W296276982e-04
Scas_687.15*328318982e-04
Scas_705.9323292965e-04
Scas_328.1227130945e-04
YBR192W (RIM2)377313965e-04
KLLA0A00979g343125956e-04
Sklu_2115.4299308948e-04
Sklu_1119.130780930.001
Sklu_2194.3312261920.001
Kwal_33.1559730580920.001
Scas_613.24177167900.001
YDL119C307308920.001
Scas_696.9312159910.002
CAGL0C02013g329323890.003
Scas_673.17314200870.005
KLLA0B14454g305180870.006
KLLA0D04312g10391800.008
YPR128C (ANT1)328303860.008
CAGL0K07436g307172840.012
AER450C308173840.013
CAGL0F08305g374201800.045
ADR036C340242740.25
Kwal_23.5757307193730.32
Kwal_55.21338323292720.37
KLLA0B11319g355142720.44
Sklu_2127.4323263710.48
Kwal_55.2110632837710.60
AFR147C315252681.1
CAGL0M04367g60458691.2
ABL023W309151681.4
CAGL0D04774g32260671.8
AFR669W191861672.4
YGR257C (MTM1)36641662.7
CAGL0G02563g63168653.9
YIL156W (UBP7)107159644.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR058W
         (302 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...   626   0.0  
Scas_667.22                                                           543   0.0  
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...   505   0.0  
Kwal_27.12599                                                         461   e-165
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement         457   e-164
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...   445   e-159
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...   412   e-145
Scas_718.5                                                            403   e-142
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...   400   e-141
Kwal_33.12988                                                         395   e-139
Sklu_2398.4 , Contig c2398 9476-10405                                 375   e-131
Sklu_1275.1 , Contig c1275 314-1249                                   375   e-131
Kwal_56.23011                                                         363   e-126
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...   333   e-115
Scas_697.47                                                           144   9e-41
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...   144   1e-40
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...   143   2e-40
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...   140   2e-39
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...   140   3e-39
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement        138   7e-39
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...   127   3e-34
Kwal_23.2913                                                          126   5e-34
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...   124   2e-33
Kwal_33.15446                                                         121   4e-32
Kwal_55.21335                                                         117   1e-30
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement               117   2e-30
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...   112   5e-29
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...   110   2e-28
Scas_632.9                                                            109   5e-28
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...   109   6e-28
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....   112   1e-27
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...   106   6e-27
Scas_714.18                                                           106   1e-26
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...   103   4e-25
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...   100   2e-24
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...   100   2e-24
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...   102   4e-24
Kwal_26.8669                                                           99   5e-24
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    99   9e-24
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...   101   1e-23
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    97   3e-23
Scas_691.4                                                             98   3e-23
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         97   5e-23
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    97   8e-23
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    98   1e-22
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         95   3e-22
Scas_602.8                                                             97   4e-22
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    94   6e-22
Kwal_47.17321                                                          96   7e-22
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    92   3e-21
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          94   5e-21
Scas_640.25                                                            90   1e-20
Kwal_47.18216                                                          90   2e-20
Scas_662.12                                                            89   3e-20
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    86   4e-19
Scas_709.9                                                             85   2e-18
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    84   3e-18
Scas_589.10                                                            82   9e-18
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    82   1e-17
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    80   4e-17
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    79   1e-16
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    78   2e-16
Scas_379.2                                                             78   2e-16
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    77   5e-16
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    76   1e-15
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    76   1e-15
Kwal_23.4731                                                           75   2e-15
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    75   3e-15
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          74   3e-15
Kwal_55.20868                                                          75   6e-15
Kwal_0.232                                                             74   7e-15
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    74   7e-15
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    72   4e-14
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    71   5e-14
Scas_717.20                                                            72   6e-14
KLLA0D14036g complement(1203522..1204817) some similarities with...    72   8e-14
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    71   8e-14
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          71   1e-13
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    70   1e-13
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    70   2e-13
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    69   3e-13
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    69   4e-13
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    68   8e-13
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    68   9e-13
Kwal_33.14050                                                          67   2e-12
Scas_582.7                                                             67   2e-12
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    66   4e-12
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    65   5e-12
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    65   5e-12
Kwal_26.7967                                                           65   6e-12
Kwal_14.2210                                                           65   1e-11
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       64   1e-11
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    64   2e-11
Scas_558.2                                                             63   3e-11
Scas_721.129                                                           63   4e-11
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    62   6e-11
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    62   6e-11
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            63   6e-11
Kwal_26.7653                                                           62   7e-11
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    62   7e-11
Kwal_27.12081                                                          62   7e-11
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    62   1e-10
Kwal_26.7972                                                           62   1e-10
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    61   1e-10
Scas_716.29                                                            61   2e-10
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    61   2e-10
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         61   2e-10
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    60   4e-10
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    60   4e-10
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    59   8e-10
Scas_669.6                                                             59   9e-10
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    59   9e-10
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    59   1e-09
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    59   1e-09
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    59   1e-09
Scas_578.3*                                                            59   1e-09
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         58   1e-09
Scas_721.27                                                            59   2e-09
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    59   2e-09
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    57   4e-09
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    57   4e-09
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    57   6e-09
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    56   6e-09
Kwal_23.3965                                                           56   7e-09
Scas_489.4                                                             56   1e-08
Scas_562.12                                                            55   1e-08
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       56   1e-08
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    55   2e-08
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    55   2e-08
Scas_702.10                                                            54   4e-08
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    54   5e-08
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    53   6e-08
Kwal_23.3042                                                           54   8e-08
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    53   8e-08
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         53   9e-08
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            52   1e-07
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    52   1e-07
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    53   1e-07
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    52   1e-07
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    52   1e-07
Kwal_23.3529                                                           52   1e-07
Kwal_27.11626                                                          52   2e-07
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    52   2e-07
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    52   2e-07
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    51   3e-07
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    51   3e-07
Kwal_47.19228                                                          51   4e-07
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    51   4e-07
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    50   7e-07
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    50   9e-07
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    50   9e-07
Kwal_23.4354                                                           50   9e-07
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    49   2e-06
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    48   2e-06
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       49   2e-06
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    49   3e-06
Scas_718.24                                                            48   4e-06
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    48   4e-06
Kwal_27.11419                                                          47   6e-06
Kwal_27.12481                                                          47   8e-06
Scas_715.45                                                            47   8e-06
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    47   9e-06
Scas_667.4                                                             47   1e-05
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    45   2e-05
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    45   3e-05
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    45   4e-05
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    44   5e-05
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    44   6e-05
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    44   8e-05
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    44   9e-05
Scas_645.9                                                             43   1e-04
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    43   2e-04
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    42   2e-04
Scas_687.15*                                                           42   2e-04
Scas_705.9                                                             42   5e-04
Scas_328.1                                                             41   5e-04
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    42   5e-04
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    41   6e-04
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            41   8e-04
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             40   0.001
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            40   0.001
Kwal_33.15597                                                          40   0.001
Scas_613.24                                                            39   0.001
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    40   0.001
Scas_696.9                                                             40   0.002
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    39   0.003
Scas_673.17                                                            38   0.005
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    38   0.006
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    35   0.008
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    38   0.008
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    37   0.012
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    37   0.013
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    35   0.045
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    33   0.25 
Kwal_23.5757                                                           33   0.32 
Kwal_55.21338                                                          32   0.37 
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    32   0.44 
Sklu_2127.4 , Contig c2127 6322-7293                                   32   0.48 
Kwal_55.21106                                                          32   0.60 
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    31   1.1  
CAGL0M04367g 479260..481074 similar to sp|P20485 Saccharomyces c...    31   1.2  
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    31   1.4  
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    30   1.8  
AFR669W [3862] [Homologous to ScYNL271C (BNI1) - SH] complement(...    30   2.4  
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    30   2.7  
CAGL0G02563g complement(235498..237393) weakly similar to sp|P36...    30   3.9  
YIL156W (UBP7) [2521] chr9 (48091..51306) Putative ubiquitin-spe...    29   4.3  

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/302 (100%), Positives = 302/302 (100%)

Query: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT
Sbjct: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60

Query: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSL 120
           TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSL
Sbjct: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSL 120

Query: 121 PQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGL 180
           PQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGL
Sbjct: 121 PQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGL 180

Query: 181 TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPL 240
           TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPL
Sbjct: 181 TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPL 240

Query: 241 DVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           DVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE
Sbjct: 241 DVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300

Query: 301 LA 302
           LA
Sbjct: 301 LA 302

>Scas_667.22
          Length = 306

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/303 (84%), Positives = 280/303 (92%), Gaps = 3/303 (0%)

Query: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           MSEEFP+PQLIDDLE HP+HDNARV+KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT
Sbjct: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60

Query: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSS-TLS 119
           TAMEV+RKLL NEGP+GFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH RN D +S  LS
Sbjct: 61  TAMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILS 120

Query: 120 LPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRG 179
           LPQYY CG+TGGI NSFLASPIEHVRIRLQTQTGSG N EFKGPL+CI+KLR     +RG
Sbjct: 121 LPQYYICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFMRG 180

Query: 180 LTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYP 239
           LTPT+LREGHGCGTYFLVYEA++AN++NK  G +R ++PAWKLC+FGALSGT LW+MVYP
Sbjct: 181 LTPTMLREGHGCGTYFLVYEAMVANEINK--GFKRTEVPAWKLCLFGALSGTTLWMMVYP 238

Query: 240 LDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATF 299
           LDVIKSVMQTDNL+ PK+GNSISSVAKTLYA GG+GAFFKGFGPTMLRAAPANGATFATF
Sbjct: 239 LDVIKSVMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATF 298

Query: 300 ELA 302
           ELA
Sbjct: 299 ELA 301

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score =  505 bits (1300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 236/302 (78%), Positives = 267/302 (88%), Gaps = 2/302 (0%)

Query: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           MSEEFP+PQLIDDLE+HP  DN RVVKDLLAGTAGGIAQVL+GQPFDTTKVRLQTS  PT
Sbjct: 1   MSEEFPTPQLIDDLEDHPGQDNGRVVKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPT 60

Query: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSL 120
           +A EVV+ LL NEGP+GFYKGTLTPL+GVGACVS+QFGVNEAMKRFFH RN D ++TLSL
Sbjct: 61  SAAEVVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEAMKRFFHARNVDHNATLSL 120

Query: 121 PQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGL 180
            QYY CG+TGG+ NSFLASPIEHVRIRLQTQTGSG  AEFKGP++CIKKLR  K L+RGL
Sbjct: 121 SQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKGLMRGL 180

Query: 181 TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPL 240
            PT+LREGHGCGTYFLVYEAL++ Q+N+  GL+R +IP WKLC++GALSGTALWLMVYP+
Sbjct: 181 IPTMLREGHGCGTYFLVYEALVSKQINQ--GLKRTEIPPWKLCLYGALSGTALWLMVYPI 238

Query: 241 DVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           DV+KSVMQTDNL KP+ G ++  VA+ LYA  G+ AFFKGFGPTMLRAAPANG TFATFE
Sbjct: 239 DVVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFE 298

Query: 301 LA 302
           LA
Sbjct: 299 LA 300

>Kwal_27.12599
          Length = 304

 Score =  461 bits (1187), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 224/302 (74%), Positives = 253/302 (83%), Gaps = 3/302 (0%)

Query: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           M EE  SP LIDD+++ P HD+ RV+KDLLAGTAGG+AQVLVGQPFDTTKVRLQTS+TPT
Sbjct: 1   MPEETSSPLLIDDIDQQP-HDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPT 59

Query: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSL 120
           TA+EVV+KL+ NEG RGFYKGTLTPL+GVGACVS QFGVNEAMKRFF   +AD   TL+L
Sbjct: 60  TAVEVVKKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTL 119

Query: 121 PQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGL 180
           PQYY CG  GG+ NSFLASPIEHVRIRLQTQT SGT AEFKGPL+CI KLR N AL+RGL
Sbjct: 120 PQYYICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANGALMRGL 179

Query: 181 TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPL 240
           +PTILRE  GC TYFL YEAL+ANQ+ K  G+ R D+PAWKLC+FGA+SG  LWL VYPL
Sbjct: 180 SPTILREAQGCATYFLTYEALVANQIGK--GIARSDVPAWKLCLFGAVSGVTLWLTVYPL 237

Query: 241 DVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           DVIKS+MQTDNL+ P  G +I  VA+ + A  G  +FFKGFGPTMLRAAPANGATFATFE
Sbjct: 238 DVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFE 297

Query: 301 LA 302
           LA
Sbjct: 298 LA 299

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score =  457 bits (1177), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 219/304 (72%), Positives = 256/304 (84%), Gaps = 6/304 (1%)

Query: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           M+EE P+P +IDDL+    HD+ RV KDLLAGTAGG++QVL+GQPFDTTKVRLQTSS PT
Sbjct: 1   MTEELPTPLIIDDLDG--AHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPT 58

Query: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADM--SSTL 118
           TA++VV+KL+ NEG RGFYKGTLTPL+GVGACVS+QFGVNEAMKRFFH RN +   + TL
Sbjct: 59  TALDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETL 118

Query: 119 SLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLR 178
            L QYY CG  GG  NSFLASPIEHVRIRLQTQTG+G  A+F GPL+CIKKL  N +L+R
Sbjct: 119 GLLQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMR 178

Query: 179 GLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVY 238
           GLTPT+LRE HGCG YFL YEALIAN+++K  G+ R +IP WKLC+FGA SGT LWLM+Y
Sbjct: 179 GLTPTMLRESHGCGVYFLTYEALIANELHK--GVSRSEIPTWKLCLFGATSGTTLWLMIY 236

Query: 239 PLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFAT 298
           PLDVIKSVMQTD+L +PK G ++  VAKT+Y+  G+ +FFKGFGPTMLRAAPANGATFAT
Sbjct: 237 PLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFAT 296

Query: 299 FELA 302
           FELA
Sbjct: 297 FELA 300

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score =  445 bits (1144), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 224/302 (74%), Positives = 251/302 (83%), Gaps = 4/302 (1%)

Query: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           M+EEFP+PQLIDDLE    HDN RV+KDLLAGTAGGIAQVLVGQPFDTTKVRLQTS T T
Sbjct: 1   MTEEFPTPQLIDDLES--PHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETST 58

Query: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSL 120
            A++V++ L+ NEGP GFYKGTLTPL+GVGACVSLQFGVNEAMKRFFH  +   S  LSL
Sbjct: 59  NAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSL 118

Query: 121 PQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGL 180
            QYY CGV GG  NSFLASPIEH+RIRLQTQTGSG  AEFKGP++CIKKLR N  L+RGL
Sbjct: 119 LQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGL 178

Query: 181 TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPL 240
           TPT+LRE HGCG YFL YEALI +Q+  + G++RKDIPAWKLC+FGA SGT LW MVYPL
Sbjct: 179 TPTMLRESHGCGVYFLTYEALIGHQV--KSGIQRKDIPAWKLCLFGAASGTLLWTMVYPL 236

Query: 241 DVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           DVIKSVMQTDNL+ PK GN+I +V +T+ A  G+   FKGF PTMLRAAPAN ATFATFE
Sbjct: 237 DVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATFATFE 296

Query: 301 LA 302
            A
Sbjct: 297 TA 298

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score =  412 bits (1060), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 209/324 (64%), Positives = 249/324 (76%), Gaps = 24/324 (7%)

Query: 1   MSEEFPSPQLIDDLE---------EHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKV 51
           MSEEFP+PQL+D+LE         E  +  + RV+KD+ AGT GGIAQVLVGQPFDTTKV
Sbjct: 1   MSEEFPTPQLLDELEDQQKVTTPNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDTTKV 60

Query: 52  RLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRN 111
           RLQT++T TT +EV+R L+ NEG   FYKG LTPL+GVG CVS+QFGVNEAMKRFF + N
Sbjct: 61  RLQTATTRTTTLEVLRNLVKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYN 120

Query: 112 A----DMSS---------TLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNA 158
           A    +MSS         TL L QYY CG+TGG+VNSFLASPIE +RIRLQTQT +G + 
Sbjct: 121 ASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDR 180

Query: 159 EFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIP 218
           EFKGP +CIKKL+    L+RGL PT++R GHG GTYFLVYEAL+A ++    GL R +IP
Sbjct: 181 EFKGPWDCIKKLKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGT--GLTRNEIP 238

Query: 219 AWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFF 278
            WKLC+FGA SGT LWL VYPLDV+KS++Q D+L+KPK+ NSIS VAKT+YA  GI AFF
Sbjct: 239 PWKLCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFF 298

Query: 279 KGFGPTMLRAAPANGATFATFELA 302
           KGFGPTM+R+AP NGATF TFEL 
Sbjct: 299 KGFGPTMVRSAPVNGATFLTFELV 322

>Scas_718.5
          Length = 324

 Score =  403 bits (1036), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 194/321 (60%), Positives = 239/321 (74%), Gaps = 21/321 (6%)

Query: 1   MSEEFPSPQLIDDLEEH----------PQH----DNARVVKDLLAGTAGGIAQVLVGQPF 46
           MSE+F SPQLI++ ++             H    D+ RV+KD+LAGT GGI+QV+VGQPF
Sbjct: 1   MSEDFSSPQLINEFDDEMASNGNDNNGSSHSMAKDSTRVLKDILAGTCGGISQVIVGQPF 60

Query: 47  DTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRF 106
           DTTKVR+QTS+    A++++RKL+ NEG   FYKG+L P++GVGACVS+QFGVNEAMKRF
Sbjct: 61  DTTKVRMQTSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRF 120

Query: 107 FHHRNADMSS-----TLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFK 161
           F   N    +     TL L QYY CG+TGG+VNSFLASPIEHVRIRLQTQTG+G   EFK
Sbjct: 121 FREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFK 180

Query: 162 GPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWK 221
           GPL+CI+KL   K+L+RGL P +LR GHG G YFL YEALIAN++ K  G +R +I +WK
Sbjct: 181 GPLDCIRKLVKEKSLMRGLRPMMLRAGHGLGCYFLTYEALIANEIKK--GKDRSEIASWK 238

Query: 222 LCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGF 281
           LC +G+LSG  LWL +YPLDV+KS++QTD L+ P+F NS+ +V   LY   GI AFFKGF
Sbjct: 239 LCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGF 298

Query: 282 GPTMLRAAPANGATFATFELA 302
            PTMLRAAP NGATF TFEL 
Sbjct: 299 APTMLRAAPVNGATFVTFELV 319

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score =  400 bits (1029), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 197/307 (64%), Positives = 230/307 (74%), Gaps = 8/307 (2%)

Query: 1   MSEEFPSPQLIDDLEE-HPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP 59
           MSEEFP+PQL+++LE+  P     RVVKD+ AGT GG+AQVLVGQPFDTTKVRLQTS T 
Sbjct: 1   MSEEFPTPQLLNELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTK 60

Query: 60  TTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSS--- 116
              +EVV+ LL NEG   FYKG LTPL+GVG CVS+QFGVNE+MKRFF   NAD      
Sbjct: 61  IGVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQK 120

Query: 117 --TLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK 174
              L L QYY CG+TGG+VNSFLA+PIEHVRIRLQTQT  G   +FKGP +CIKKL   K
Sbjct: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK 180

Query: 175 ALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALW 234
           AL+RGL PT++R GHG GTYF  YEAL+  +  K  G  R  IPAWKLC FGALSGT LW
Sbjct: 181 ALMRGLLPTMIRAGHGLGTYFAAYEALVVKEFEK--GTPRNQIPAWKLCSFGALSGTILW 238

Query: 235 LMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGA 294
           L VYP+DV+KSV+QTD+++ PK+ NSI    + LY   GI AFFKGF PTM+RAAPAN A
Sbjct: 239 LTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAA 298

Query: 295 TFATFEL 301
           TF +FE+
Sbjct: 299 TFVSFEM 305

>Kwal_33.12988
          Length = 303

 Score =  395 bits (1015), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 188/302 (62%), Positives = 227/302 (75%), Gaps = 4/302 (1%)

Query: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           MS+E   PQ++DDL +  + D  R +KD+ AGT GGIAQVLVGQPFD TKVRLQTSSTPT
Sbjct: 1   MSDELTMPQVVDDLTD--KSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQTSSTPT 58

Query: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSL 120
           TA+ VV+ L+ NEG RGFYKGT  PLIGVG CVS QFG NEAMKR+FH RN   S++L L
Sbjct: 59  TALRVVQDLVKNEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRL 118

Query: 121 PQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGL 180
           P+YYACG   G  N+FLA+PIEHVRI LQ QT S  +AE++G ++CIKKL     L+RG 
Sbjct: 119 PEYYACGFVSGCANAFLATPIEHVRILLQVQTKSRADAEYQGAMDCIKKLLKEGKLMRGF 178

Query: 181 TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPL 240
           TPTILR  HG G YF  YEA+I ++  +R+G+ RKDIPAWKLC++GA SG+ LW MVYP 
Sbjct: 179 TPTILRTSHGFGVYFTSYEAMICSE--QRKGIARKDIPAWKLCLYGAFSGSLLWAMVYPF 236

Query: 241 DVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           DVIKSVMQ+D L+ P +G ++  VAK +Y   G  AF KGFGPTMLR+ P NGATF  FE
Sbjct: 237 DVIKSVMQSDKLRTPVYGTNVFQVAKNIYNERGPKAFVKGFGPTMLRSLPVNGATFTAFE 296

Query: 301 LA 302
           +A
Sbjct: 297 MA 298

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score =  375 bits (964), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 181/301 (60%), Positives = 219/301 (72%), Gaps = 4/301 (1%)

Query: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           MS+E  +PQ++DDL +    D  R +KD+L+GTAGGIAQVLVGQPFD TKVR+QTS+   
Sbjct: 1   MSDELTAPQVVDDLSD--SLDYKRAIKDILSGTAGGIAQVLVGQPFDITKVRMQTSAGSA 58

Query: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSL 120
           TA++VV  L+ NEG  GFYKGTL PL+GVGACVS QFGVNEAMKR F   N D S  LSL
Sbjct: 59  TAVDVVTSLIKNEGILGFYKGTLAPLVGVGACVSCQFGVNEAMKRRFRRMNGDPSKPLSL 118

Query: 121 PQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGL 180
            QYY CGV  G  N+FLA+PIEHVRIRLQ QT S  NAE++G L+C++KL    AL+RG 
Sbjct: 119 KQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLKQGALMRGF 178

Query: 181 TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPL 240
           T T++R  HG G YF  YEALIANQ   ++G+ RKDI  WK+CIFGA SG   W M YP+
Sbjct: 179 TATLMRTCHGFGIYFSTYEALIANQ--HKKGIPRKDIAPWKVCIFGAFSGACYWAMAYPI 236

Query: 241 DVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           DV+KS+MQ+D L  P  G ++  VAK++Y   G  AF KGF P MLR+ P NGATFATFE
Sbjct: 237 DVVKSIMQSDRLVSPVHGTNVWQVAKSIYTTRGKRAFIKGFMPAMLRSLPVNGATFATFE 296

Query: 301 L 301
           +
Sbjct: 297 M 297

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score =  375 bits (962), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 179/301 (59%), Positives = 219/301 (72%), Gaps = 4/301 (1%)

Query: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           MS+E  +PQ++DDL + P+   A  +KD+++GT+GGIAQVLVGQPFD TKVR+QTSS   
Sbjct: 1   MSDELTTPQVVDDLSDAPEFRKA--IKDIISGTSGGIAQVLVGQPFDITKVRMQTSSGSP 58

Query: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSL 120
           TA+EV++ L+ NEG   FYKGTL PLIGVGACVS QFGVNEAMKR+F   N      LSL
Sbjct: 59  TAIEVIKNLVKNEGLLAFYKGTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKDQHLSL 118

Query: 121 PQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGL 180
            QYY CG   G  N+FLA+PIEHVRIRLQ QT +   AE++G L+C+KKL   KAL+RG 
Sbjct: 119 LQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQKALMRGF 178

Query: 181 TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPL 240
           T T++R  HG G YFL YEALI NQ   + G+ RKDIP WK+C+FGA SG   W M YP 
Sbjct: 179 TATLMRTSHGFGVYFLTYEALIMNQ--NKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYPF 236

Query: 241 DVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           DV+KS+MQ D L  P  G ++  VAK+++A  G GAF KGF PTMLR+ P NGATFATFE
Sbjct: 237 DVVKSIMQADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATFATFE 296

Query: 301 L 301
           +
Sbjct: 297 V 297

>Kwal_56.23011
          Length = 303

 Score =  363 bits (933), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 174/301 (57%), Positives = 214/301 (71%), Gaps = 4/301 (1%)

Query: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           MSEE  SPQ++DDL +   HD  + +KD+  GT GG+AQVLVGQPFD TKVRLQTS  PT
Sbjct: 1   MSEELTSPQVVDDLVD--THDFKQALKDVFCGTVGGVAQVLVGQPFDITKVRLQTSPVPT 58

Query: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSL 120
           TA +V++ L+ NEG   FYKGTL PL GVGACVS QFGVNEA+K++F  ++ +    L+L
Sbjct: 59  TAAQVIKSLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLAL 118

Query: 121 PQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGL 180
            QYYACG   G  N+FLA+PIEHVRIRLQ QT S + AE+ G L+C +KL    AL+RG 
Sbjct: 119 RQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQGALMRGF 178

Query: 181 TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPL 240
           T T LR  HG G YFL YE LIANQ +   G+ R++IPAWK+C++GA SG   W M YP 
Sbjct: 179 TATTLRTSHGFGIYFLTYETLIANQAH--HGVLRENIPAWKVCVYGAFSGAFFWAMTYPF 236

Query: 241 DVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           DV+KSVMQ D L+ P +G +  +VAK +Y   G  AF KGF PTMLR+ P NGATFA FE
Sbjct: 237 DVVKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTMLRSLPVNGATFAAFE 296

Query: 301 L 301
           +
Sbjct: 297 I 297

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score =  333 bits (855), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 165/305 (54%), Positives = 205/305 (67%), Gaps = 8/305 (2%)

Query: 1   MSEEF-PSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP 59
           MS+E   +PQ+++DL +   H   + +KD+ +GT GG+AQVLVGQPFD  KVRLQT    
Sbjct: 1   MSDELLITPQVVEDLTD--LHGFRKTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGN 58

Query: 60  TTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNAD---MSS 116
            TA E +  L+  EG  GFYKGT+ PL+GVGACVS QFG+NEAMKR+F   N       +
Sbjct: 59  ATAWEAITDLVKYEGFMGFYKGTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDN 118

Query: 117 TLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKAL 176
           TLSL QYY CG   G  N+ LA+PIEHVRIRLQ Q  +  NAE+K  L+C +KL    +L
Sbjct: 119 TLSLGQYYTCGFVSGSANALLATPIEHVRIRLQLQKEALANAEYKSTLDCTEKLLKQGSL 178

Query: 177 LRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLM 236
           +RG T T++R  HG G YFL YE LIA+Q+    G  R+DI AWK C+FGALSG   W M
Sbjct: 179 MRGFTATLMRTSHGFGIYFLTYETLIASQLA--HGFRREDISAWKACMFGALSGAFFWAM 236

Query: 237 VYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATF 296
            YP DV+KSVMQ D L  P +G ++  VAK +Y   G+ AF KGF PTMLR+ P NGATF
Sbjct: 237 TYPFDVVKSVMQADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATF 296

Query: 297 ATFEL 301
           A FE+
Sbjct: 297 AAFEV 301

>Scas_697.47
          Length = 328

 Score =  144 bits (363), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 93/290 (32%), Positives = 150/290 (51%), Gaps = 22/290 (7%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT--AMEVVRK---------LLANEG 74
           +K L+AG  GG+  VL G PFD  KVR Q+    +T  A++++ K         +L N  
Sbjct: 37  LKSLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNS- 95

Query: 75  PRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVN 134
            +GFYKG + PL+GV    ++ F   +  K+    R+   S+ L++ Q  A G    I  
Sbjct: 96  VKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVT-RSDSSSAQLTMGQMAAAGFISAIPT 154

Query: 135 SFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTY 194
           + + +P E +++ LQT  G+ +   F G  + I K    K+L +G   T+ R+G G   Y
Sbjct: 155 TLVTAPTERIKVVLQT-AGANSKTSFIGAAKNIVKDGGVKSLFKGSLATLARDGPGSALY 213

Query: 195 FLVYE--ALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNL 252
           F  YE      N  N     +  ++    +C+ G ++G ++WL+V+P+D IK+ +Q+ + 
Sbjct: 214 FASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQSSSG 273

Query: 253 QKPKFGNSISSVAKTLYAN-GGIGAFFKGFGPTMLRAAPANGATFATFEL 301
            +     S+ +  + +Y   GGI  FF G GP +LR+ PAN ATF   EL
Sbjct: 274 SQ-----SMVAATREIYVKRGGIKGFFPGLGPALLRSFPANAATFLGVEL 318

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 75/184 (40%), Gaps = 12/184 (6%)

Query: 126 CGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALL-------R 178
            G  GG+       P + +++R Q+   S T    K  L+  + +  +  L+       +
Sbjct: 42  AGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNSVKGFYK 101

Query: 179 GLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVY 238
           G+ P +L         F  Y+  +  ++  R       +   ++   G +S     L+  
Sbjct: 102 GVIPPLLGVTPIFAVSFWGYD--VGKKIVTRSDSSSAQLTMGQMAAAGFISAIPTTLVTA 159

Query: 239 PLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFAT 298
           P + IK V+QT          S    AK +  +GG+ + FKG   T+ R  P +   FA+
Sbjct: 160 PTERIKVVLQTAGANSK---TSFIGAAKNIVKDGGVKSLFKGSLATLARDGPGSALYFAS 216

Query: 299 FELA 302
           +E++
Sbjct: 217 YEIS 220

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score =  144 bits (363), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 99/292 (33%), Positives = 144/292 (49%), Gaps = 27/292 (9%)

Query: 20  HDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLL----ANEG- 74
           ++NA   K L AG  GG+  VL G PFD  KVR Q++    T ++ VRK+L    A  G 
Sbjct: 45  YENA---KSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGT-VDAVRKILVEARAQSGL 100

Query: 75  -----PRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVT 129
                 RGFYKG + PL+GV    ++ F   +  K+       D S  L+  Q    G  
Sbjct: 101 SAVNMMRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWN--DNSGKLTTAQLATAGFI 158

Query: 130 GGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGH 189
             I  + + +P E V++ LQTQ+    N       + I      ++L RG   T+ R+G 
Sbjct: 159 SAIPTTLVMAPTERVKVVLQTQS----NHSLGSAAKHILATGGVRSLFRGSLATLARDGP 214

Query: 190 GCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQT 249
           G   YF  YEA  A  +N R G     I    +C+ G ++G ++W+ V+P+D IK+ +Q+
Sbjct: 215 GSALYFASYEATKA-YLNARSGTNELSIK--NVCLAGGMAGVSMWVGVFPIDTIKTELQS 271

Query: 250 DNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFEL 301
            N ++      + +  K     GGI  FF G GP +LR+ PAN ATF   EL
Sbjct: 272 SNTRQ----TMMEATRKIYNTRGGIKGFFPGIGPALLRSFPANAATFLGVEL 319

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score =  143 bits (361), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 96/294 (32%), Positives = 148/294 (50%), Gaps = 28/294 (9%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANE----GP------ 75
           +K L AG  GG+  VL G PFD  KVR Q S+   +AM+ V  +L       GP      
Sbjct: 29  LKSLAAGGVGGVCAVLTGHPFDLVKVRCQ-SNQARSAMDAVSHILQAARQAAGPTSLNAV 87

Query: 76  RGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHH-------RNADMSSTLSLPQYYACGV 128
           RGFYKG + PL+GV    ++ F   +  K+             A +   L+L Q  A G 
Sbjct: 88  RGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQMAAAGF 147

Query: 129 TGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREG 188
              I  + + +P E V++ LQT  G    A F    + I + +  ++L +G   T+ R+G
Sbjct: 148 ISAIPTTLVTAPTERVKVVLQTTQG---KASFLDAAKQIVRTQGFQSLFKGSLATLSRDG 204

Query: 189 HGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQ 248
            G   YF  YE +    +NK  G    ++    +CI G ++G ++W++V+P+D +K+ +Q
Sbjct: 205 PGSALYFASYE-ICKEYLNKASGHTSGELSITNVCISGGMAGVSMWVVVFPIDTVKTQLQ 263

Query: 249 TDNLQKPKFGNSISSVAKTLY-ANGGIGAFFKGFGPTMLRAAPANGATFATFEL 301
           + + ++     S+  V + +Y   GGI  FF G GP +LR+ PAN ATF   EL
Sbjct: 264 SSSKRQ-----SMLEVTRMIYNTRGGIKGFFPGVGPAILRSFPANAATFLGVEL 312

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score =  140 bits (354), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 101/314 (32%), Positives = 149/314 (47%), Gaps = 40/314 (12%)

Query: 13  DLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT--AMEVVRK-- 68
           ++ EH        +K L+AG  GG+  VL G PFD  KVR Q++   +T  A+ ++ K  
Sbjct: 9   NILEHKTDAFRENMKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEA 68

Query: 69  -------------LLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMS 115
                        L      +GFYKG + PLIGV    ++ F   +  KR    + A   
Sbjct: 69  RSLSTVNGSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQAS-D 127

Query: 116 STLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRH--- 172
           + L+  Q    G    I  + + +P E +++ LQT      N+EFKG    IK  +H   
Sbjct: 128 APLTTAQMATAGFISAIPTTLVTAPTERIKVVLQT------NSEFKGSF--IKAAKHIVS 179

Query: 173 ---NKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKD-IPAWKLCIFGAL 228
               K+L  G   T+ R+G G   YF  YE L    +NK    + KD +    +C+ G +
Sbjct: 180 TGGVKSLFNGSLATLARDGPGSALYFASYE-LSKAFLNKSVAKKDKDEVNLANVCLAGGI 238

Query: 229 SGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYAN-GGIGAFFKGFGPTMLR 287
           +G ++WL+V+P+D IK+ +Q           S+    K +Y   GGI  FF G GP +LR
Sbjct: 239 AGMSMWLVVFPIDTIKTRLQVATTPI-----SMVQATKDIYIQRGGIKGFFPGLGPALLR 293

Query: 288 AAPANGATFATFEL 301
           + PAN ATF   EL
Sbjct: 294 SFPANAATFLGVEL 307

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 74/191 (38%), Gaps = 20/191 (10%)

Query: 126 CGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKL--------------R 171
            G  GG+       P + +++R Q+     T       L+  + L               
Sbjct: 27  AGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGSLTTSLFFKN 86

Query: 172 HNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGT 231
             K   +G+ P ++         F  Y+  I  ++   +      +   ++   G +S  
Sbjct: 87  SVKGFYKGVIPPLIGVTPIFAVSFWGYD--IGKRLVTWKQASDAPLTTAQMATAGFISAI 144

Query: 232 ALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPA 291
              L+  P + IK V+QT++    +F  S    AK + + GG+ + F G   T+ R  P 
Sbjct: 145 PTTLVTAPTERIKVVLQTNS----EFKGSFIKAAKHIVSTGGVKSLFNGSLATLARDGPG 200

Query: 292 NGATFATFELA 302
           +   FA++EL+
Sbjct: 201 SALYFASYELS 211

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score =  140 bits (353), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 93/303 (30%), Positives = 145/303 (47%), Gaps = 27/303 (8%)

Query: 14  LEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEV-------- 65
           ++ +P  +N   +K  +AG  GG+  V  G PFD  KVR Q     +T   +        
Sbjct: 27  IKSNPVREN---IKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAK 83

Query: 66  --VRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADM-SSTLSLPQ 122
             V+  L     +GFYKG + PL+GV    ++ F   +  K+     N    S+ L++ Q
Sbjct: 84  TQVKGTLFTNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQ 143

Query: 123 YYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTP 182
             A G    I  + + +P E V++ LQT +       F    + I K     +L +G   
Sbjct: 144 MAAAGFISAIPTTLVTAPTERVKVVLQTSS----KGSFIQAAKTIVKEGGIASLFKGSLA 199

Query: 183 TILREGHGCGTYFLVYEALIANQMNKR--RGLERKDIPA--WKLCIFGALSGTALWLMVY 238
           T+ R+G G   YF  YE +  N +N R  R    KD P     +C+ G ++G ++WL V+
Sbjct: 200 TLARDGPGSALYFASYE-ISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVF 258

Query: 239 PLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFAT 298
           P+D IK+ +Q  + ++    N +S+  +     GGI  FF G GP +LR+ PAN ATF  
Sbjct: 259 PIDTIKTKLQASSTRQ----NMLSATKEIYLQRGGIKGFFPGLGPALLRSFPANAATFLG 314

Query: 299 FEL 301
            E+
Sbjct: 315 VEM 317

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 78/188 (41%), Gaps = 17/188 (9%)

Query: 124 YACGVTGGIVNSFLASPIEHVRIRLQT-QTGSGTNA------EFKGPLECIKKLRHNKAL 176
           +  G  GG+   F   P + +++R Q  Q  S  +A      E K  ++        K  
Sbjct: 39  FVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNSVKGF 98

Query: 177 LRGLTPTILREGHGCGTYFLVYEA--LIANQMNKRRGLERKDIPAWKLCIFGALSGTALW 234
            +G+ P +L         F  Y+    +    NK+ G    ++   ++   G +S     
Sbjct: 99  YKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGG--SNELTMGQMAAAGFISAIPTT 156

Query: 235 LMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGA 294
           L+  P + +K V+QT +        S    AKT+   GGI + FKG   T+ R  P +  
Sbjct: 157 LVTAPTERVKVVLQTSS------KGSFIQAAKTIVKEGGIASLFKGSLATLARDGPGSAL 210

Query: 295 TFATFELA 302
            FA++E++
Sbjct: 211 YFASYEIS 218

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score =  138 bits (347), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 139/282 (49%), Gaps = 24/282 (8%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAMEVVRKLLANEG-PRGFYKGT 82
           KD+L G+  G    ++  PFDT KVRLQT      PTT    ++    NEG  RGFY+G 
Sbjct: 8   KDILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTT-WSCIKFTYDNEGLWRGFYQGI 66

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLS-LPQYYACGVTGGIVNSFLASPI 141
            +PL G     ++ F      KR       D+ S LS L +    G   G   SF+ +P+
Sbjct: 67  GSPLAGAALENAVLFVSFNQAKRLL-----DVESLLSPLSKTVWAGAFAGACASFVLTPV 121

Query: 142 EHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALL---RGLTPTILREGHGCGTYFLVY 198
           E ++ +LQ    S T       L  IK +   +  L   +G + T +RE  G   +F  Y
Sbjct: 122 ELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTY 181

Query: 199 EALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFG 258
           E ++ N +  RR  E+     W+L   GA +G A    ++P D IKS MQTD++      
Sbjct: 182 E-VVKNYLASRRQAEQNT--TWELLASGASAGLAFNASIFPADTIKSTMQTDHID----- 233

Query: 259 NSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
             +SS  + +YA  GI  F++G G T++RA PAN A F T+E
Sbjct: 234 --LSSATRKIYARQGIAGFYRGLGITLIRAVPANAAIFYTYE 273

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 4/83 (4%)

Query: 221 KLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIG-AFFK 279
           K  ++G+++G    ++ YP D +K  +QT   Q      +  S  K  Y N G+   F++
Sbjct: 8   KDILYGSIAGAVGKVIEYPFDTVKVRLQT---QPAHMFPTTWSCIKFTYDNEGLWRGFYQ 64

Query: 280 GFGPTMLRAAPANGATFATFELA 302
           G G  +  AA  N   F +F  A
Sbjct: 65  GIGSPLAGAALENAVLFVSFNQA 87

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score =  127 bits (318), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 128/284 (45%), Gaps = 15/284 (5%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT---AMEVVRKLLANEGPRGFYKGT 82
           +   +AG   G+A+  VG PFDT KVRLQTS   T     ++ V K   N+G RGFY G 
Sbjct: 24  IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGF 83

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIE 142
             PL+G     S+  G     +   H         L L      GV  G   SF+A PIE
Sbjct: 84  TPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIE 143

Query: 143 HVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTILREGHGCGTYFLVYE 199
             + +LQ Q    T   +KGPL+ IKK+      + L +GL  T++   H    Y+    
Sbjct: 144 LAKAKLQVQYDK-TTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTH--FVYWWGSY 200

Query: 200 ALIANQMNKRRGLERKDIPAWKLCIFGALSGT-ALWLMVYPLDVIKSVMQTDNLQKPKFG 258
            L+     +   +    I  W     G  S +   W   YP DV+K V+  ++     F 
Sbjct: 201 ELLTRWFRENTKMSEAAINFWA----GGFSASFGFWTTAYPSDVVKQVVLCNDKYDGSF- 255

Query: 259 NSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELA 302
            S  +  K +Y + GI  FFKGF P+ LR+ PAN A  A FE  
Sbjct: 256 KSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPANAAALAAFEFV 299

>Kwal_23.2913
          Length = 320

 Score =  126 bits (316), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 86/309 (27%), Positives = 148/309 (47%), Gaps = 42/309 (13%)

Query: 19  QHDNARVVKD----LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLL---- 70
           Q  N+  ++D    L AG  GG+  VL G PFD  KVR Q++    T ++ + ++L    
Sbjct: 18  QASNSHTLRDSFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGT-LDAISRVLHEAK 76

Query: 71  ANEGP------RGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRN---ADMSST---- 117
           +  GP      +GFY+G + PL+GV    ++ F   +  KR     +    D++ +    
Sbjct: 77  SKSGPLPLNQIKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKL 136

Query: 118 --LSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKA 175
             L+  Q    G    I  + + +P E V++ LQT      +  F G    + +    ++
Sbjct: 137 TPLTTSQLALAGFFSAIPTTLITAPTERVKVVLQTSE----SGSFLGAARTLIREGGVRS 192

Query: 176 LLRGLTPTILREGHGCGTYFLVYEALIANQMNKR---RGLERKDIPAWKLCIFGALSGTA 232
           L +G   T+ R+G G   YF  YE      ++KR   R  +   +    +C+ G ++G +
Sbjct: 193 LFQGTLATLARDGPGSALYFASYE------VSKRFLSRNQDTDALSVVSICVAGGVAGMS 246

Query: 233 LWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPAN 292
           +W+ V+P+D IK+ +Q+ +  +     S+   A+ +Y   G+  FF G GP ++R+ PAN
Sbjct: 247 MWIGVFPIDTIKTKLQSSSRSQ-----SMVQAAREIYTRAGLRGFFPGLGPALMRSFPAN 301

Query: 293 GATFATFEL 301
            ATF   E 
Sbjct: 302 AATFLGVEF 310

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 80/202 (39%), Gaps = 34/202 (16%)

Query: 122 QYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN-------- 173
           +  A G  GG+       P + +++R Q+   SGT       L+ I ++ H         
Sbjct: 30  ESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGT-------LDAISRVLHEAKSKSGPL 82

Query: 174 -----KALLRGLTPTILREGHGCGTYFLVYEA---LI---ANQMNKRRGLERKDIP--AW 220
                K   RG+ P +L         F  Y+    L+   +N +    G   K  P    
Sbjct: 83  PLNQIKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTS 142

Query: 221 KLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKG 280
           +L + G  S     L+  P + +K V+QT          S    A+TL   GG+ + F+G
Sbjct: 143 QLALAGFFSAIPTTLITAPTERVKVVLQTSE------SGSFLGAARTLIREGGVRSLFQG 196

Query: 281 FGPTMLRAAPANGATFATFELA 302
              T+ R  P +   FA++E++
Sbjct: 197 TLATLARDGPGSALYFASYEVS 218

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%)

Query: 14  LEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANE 73
           L  +   D   VV   +AG   G++  +   P DT K +LQ+SS   + ++  R++    
Sbjct: 222 LSRNQDTDALSVVSICVAGGVAGMSMWIGVFPIDTIKTKLQSSSRSQSMVQAAREIYTRA 281

Query: 74  GPRGFYKG 81
           G RGF+ G
Sbjct: 282 GLRGFFPG 289

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score =  124 bits (310), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 92/290 (31%), Positives = 142/290 (48%), Gaps = 31/290 (10%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAMEVVRKLLANEG-PRGFYKG 81
           + D++ G+  G    ++  PFDT KVRLQT ++   PTT    ++    NEG  RGF++G
Sbjct: 14  ILDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTT-WSCIKFTYQNEGIARGFFQG 72

Query: 82  TLTPLIGVGACV---SLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLA 138
             +PL  VGAC+   +L    N+  K    H N        L Q    G   G   S + 
Sbjct: 73  IASPL--VGACLENATLFVSYNQCSKFLEKHTN-----VFPLGQILISGGVAGSCASLVL 125

Query: 139 SPIEHVRIRLQTQTGSGTNAEFKGP--LECIKKL---RHNKALLRGLTPTILREGHGCGT 193
           +P+E V+ +LQ       +A+ K    L  IK +   R    L +G + T +RE  G   
Sbjct: 126 TPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVA 185

Query: 194 YFLVYEALIANQMNKRRGLE---RKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTD 250
           +F  YE ++   +  R  L+   R +   W+L I G  +G A    ++P D +KSVMQT+
Sbjct: 186 WFATYE-IVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQTE 244

Query: 251 NLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           ++       S+++  K ++   G+  F++G G T+ RA PAN A F  FE
Sbjct: 245 HI-------SLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFE 287

>Kwal_33.15446
          Length = 305

 Score =  121 bits (303), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 131/286 (45%), Gaps = 27/286 (9%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP---TTAMEVVRKLLANEGPRGFYKGTLTP 85
            ++G   GIA+  VG PFDT KVRLQTS         ++ V + +  +G RGFY G   P
Sbjct: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPP 81

Query: 86  LIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVR 145
           L+G     S+  G     +             L L      GV  G   SF+A+P+E  +
Sbjct: 82  LVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAK 141

Query: 146 IRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTILREGH---GCGTYFLVYE 199
            +LQ Q  + T   ++GPL+ IKK+      + + +GL  T++   H     G+Y L+  
Sbjct: 142 AKLQVQYDAQTT-RYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELLTR 200

Query: 200 ALIANQMNKRRGLERKDIPAWKLCIFGALSGT-ALWLMVYPLDVIKSVMQTDNLQKPKFG 258
              AN       L    I  W     G  S +   W   YP DVIK V+  ++    K+ 
Sbjct: 201 WFKANT-----NLSDTAINFWA----GGFSASFGFWTTAYPSDVIKQVILCND----KYD 247

Query: 259 NSISS---VAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFEL 301
            S+ S    A  ++   GI  FFKGF P+ LR+ PAN A  A+FE 
Sbjct: 248 GSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEF 293

>Kwal_55.21335
          Length = 317

 Score =  117 bits (293), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 83/286 (29%), Positives = 125/286 (43%), Gaps = 20/286 (6%)

Query: 21  DNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT--TAMEVVRKLLANEG-PRG 77
           D    +KD+L G+  G A  ++  P DT KVRLQT       T+   ++     EG  +G
Sbjct: 41  DFKDALKDILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTSWSCIKYTYQKEGFVKG 100

Query: 78  FYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFL 137
           FY+G  +PL+G     ++ F      + F         S   L Q    G   G   S++
Sbjct: 101 FYQGVASPLVGAALENAVLFVTFNRAQNFLQQ----YESVSPLSQTVLSGAFAGACTSYV 156

Query: 138 ASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKA---LLRGLTPTILREGHGCGTY 194
            +P+E ++  LQ     G           +K +  +K    L +G + T +RE  G   +
Sbjct: 157 LTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVW 216

Query: 195 FLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQK 254
           F  YE+L +    +R   E      W+L   GA +G A    ++P D IKS  QT +L  
Sbjct: 217 FTTYESLKSYLARRRNDTENH---TWELLASGASAGVAFNASIFPADTIKSTAQTQHL-- 271

Query: 255 PKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
                 I    K + A  G    ++G G T++RAAPAN   F T+E
Sbjct: 272 -----GIVDATKRILARSGPAGLYRGLGITLIRAAPANAIVFYTYE 312

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 4/91 (4%)

Query: 212 LERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYAN 271
           ++ KD  A K  ++G+++G A  ++ YPLD IK  +QT       F  S S +  T    
Sbjct: 40  MDFKD--ALKDILYGSIAGAAGKVIEYPLDTIKVRLQTQPAH--VFPTSWSCIKYTYQKE 95

Query: 272 GGIGAFFKGFGPTMLRAAPANGATFATFELA 302
           G +  F++G    ++ AA  N   F TF  A
Sbjct: 96  GFVKGFYQGVASPLVGAALENAVLFVTFNRA 126

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 3/86 (3%)

Query: 19  QHDNARVVKDLLA-GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRG 77
           ++D      +LLA G + G+A      P DT K   QT       ++  +++LA  GP G
Sbjct: 231 RNDTENHTWELLASGASAGVAFNASIFPADTIKSTAQTQHLGI--VDATKRILARSGPAG 288

Query: 78  FYKGTLTPLIGVGACVSLQFGVNEAM 103
            Y+G    LI      ++ F   E +
Sbjct: 289 LYRGLGITLIRAAPANAIVFYTYETL 314

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score =  117 bits (292), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 92/297 (30%), Positives = 136/297 (45%), Gaps = 15/297 (5%)

Query: 13  DLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT---AMEVVRKL 69
           D+++ P  +    +   ++G   GIA+  VG PFDT KVRLQTS   T     ++ V K 
Sbjct: 48  DIQQPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKT 107

Query: 70  LANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVT 129
              +G RGFY G   PL+G     S+  G     +             L L      GV 
Sbjct: 108 FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVM 167

Query: 130 GGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTILR 186
            G   SF+A+P+E  + +LQ Q  + T  ++ GP++ IKK+  +   + L +GLT T++ 
Sbjct: 168 AGWSVSFIAAPVELAKAKLQVQYDAKT-TKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIF 226

Query: 187 EGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGT-ALWLMVYPLDVIKS 245
             +    ++  YE L+     +   +    I  W     G  S +   W   YP DVIK 
Sbjct: 227 RTNFV-FWWGSYE-LLTRWFKEHTNMSDTAINFWS----GGFSASFGFWTTAYPSDVIKQ 280

Query: 246 VMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELA 302
           V+  ++     F  S    AK ++   G   FFKGF P+ LR+ PAN A  A FE  
Sbjct: 281 VVLCNDKYDGTF-RSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPANAAALAAFEFV 336

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score =  112 bits (281), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 93/296 (31%), Positives = 131/296 (44%), Gaps = 27/296 (9%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA-------MEVVRKLLANEGPRGF 78
           V   +AG   G+A+  VG PFDT KVRLQTS   + A       ++ V K L N+G RG 
Sbjct: 10  VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGL 69

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLA 138
           Y G   PL G     S   G     +   H         L L      GV  G   SF+A
Sbjct: 70  YLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIA 129

Query: 139 SPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN-----------KALLRGLTPTILRE 187
           +P+E  + +LQ Q  + T  ++ GP++ ++K+              ++L +GL  T++  
Sbjct: 130 APVELAKAKLQVQYDAKTT-KYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFR 188

Query: 188 GHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGT-ALWLMVYPLDVIKSV 246
            +    ++  YE LI     K   L    I  W     G LS +   W   YP DV+K V
Sbjct: 189 SNFV-FWWGSYE-LITQWFQKNTNLSAPAINFWA----GGLSASFGFWTSAYPSDVVKQV 242

Query: 247 MQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELA 302
           +  ++     F  S  +    +Y   GI  FFKGF P+ LR+ PAN A  A FE  
Sbjct: 243 VLCNDKYDGSF-KSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPANAAALAAFEFV 297

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 78/185 (42%), Gaps = 18/185 (9%)

Query: 17  HPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQT-----SSTPTTAMEVVRKLLA 71
           +P+HD   +   +++G   G     +  P +  K +LQ      ++  T  ++VV+K+  
Sbjct: 103 YPEHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFK 162

Query: 72  N--------EGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQY 123
                     G R  YKG ++ LI     V   +G  E + ++F  +N ++S+      +
Sbjct: 163 QGMATNGILGGVRSLYKGLISTLIFRSNFV-FWWGSYELITQWF-QKNTNLSA--PAINF 218

Query: 124 YACGVTGGIVNSFLASPIEHVR-IRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTP 182
           +A G++        A P + V+ + L      G+   ++  +  I + R      +G  P
Sbjct: 219 WAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLP 278

Query: 183 TILRE 187
           + LR 
Sbjct: 279 SFLRS 283

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score =  110 bits (276), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 86/301 (28%), Positives = 138/301 (45%), Gaps = 38/301 (12%)

Query: 23  ARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAMEVVRKLLANEGP-RGF 78
           A   +D+L G+  G    ++  PFDT KVRLQT      P T    +     NEG  +GF
Sbjct: 11  AAAFRDILYGSIAGALGKVIEYPFDTVKVRLQTQGRHVFPDT-WSCITYTYKNEGIIKGF 69

Query: 79  YKGTLTPLIGVG-ACVSLQFGVNEAMKRFFHHRN-ADMSSTLSLPQYYACGVTGGIVNSF 136
           ++G  +PL G      +L    N+  K   H+ N +D+++ L        G   G   SF
Sbjct: 70  FQGIASPLAGAAIENAALFLSYNQCSKFLQHYTNVSDLTNIL------ISGAFAGSCASF 123

Query: 137 LASPIEHVRIRLQTQT---------GSGTNAE----FKGPLECIKKLRHNKALLRGLTPT 183
           + +P+E ++ +LQ            G  T  E        ++ + K R    L +G + T
Sbjct: 124 VLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGT 183

Query: 184 ILREGHGCGTYFLVYEALIANQMNKRRGLERKDIP----AWKLCIFGALSGTALWLMVYP 239
            +RE  G   +F  YE L+   +  R  +E   +P     W+L   GA +G A    ++P
Sbjct: 184 FIRESFGGVAWFATYE-LMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFP 242

Query: 240 LDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATF 299
            D +KS+MQT++L        + +  K ++   G+  F++G G T++RA PAN   F  +
Sbjct: 243 ADTVKSMMQTEHL-------GLKTAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFYVY 295

Query: 300 E 300
           E
Sbjct: 296 E 296

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 80/192 (41%), Gaps = 28/192 (14%)

Query: 127 GVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILR 186
           G   G +   +  P + V++RLQTQ   G +  F     CI     N+ +++G    I  
Sbjct: 20  GSIAGALGKVIEYPFDTVKVRLQTQ---GRHV-FPDTWSCITYTYKNEGIIKGFFQGIAS 75

Query: 187 EGHGCG----TYFLVYEALIANQMNK--RRGLERKDIPAWKLCIFGALSGTALWLMVYPL 240
              G        FL Y     NQ +K  +      D+    + I GA +G+    ++ P+
Sbjct: 76  PLAGAAIENAALFLSY-----NQCSKFLQHYTNVSDLT--NILISGAFAGSCASFVLTPV 128

Query: 241 DVIKSVMQTDNLQKPKFG----NSISS-------VAKTLYANGGIGAFFKGFGPTMLRAA 289
           ++IK  +Q  NLQ    G    N+++          + +  N G    ++G   T +R +
Sbjct: 129 ELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRES 188

Query: 290 PANGATFATFEL 301
               A FAT+EL
Sbjct: 189 FGGVAWFATYEL 200

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 73/196 (37%), Gaps = 31/196 (15%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTS---STP-------------TTAMEVVRKLLAN 72
           L++G   G     V  P +  K +LQ S   S P             T  +  ++ ++ N
Sbjct: 111 LISGAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKN 170

Query: 73  EGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTL----SLPQYYACGV 128
            G  G ++G     I         F   E MK++   R+     +L       +  A G 
Sbjct: 171 RGFIGLWQGQSGTFIRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGA 230

Query: 129 TGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKAL---LRGLTPTIL 185
           + G+  +    P + V+  +QT        E  G    IKK+   K L    RGL  T++
Sbjct: 231 SAGLAFNASIFPADTVKSMMQT--------EHLGLKTAIKKIFVEKGLRGFYRGLGITLI 282

Query: 186 REGHGCGTYFLVYEAL 201
           R      T F VYE L
Sbjct: 283 RAIPANATVFYVYETL 298

 Score = 32.3 bits (72), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 39/92 (42%), Gaps = 3/92 (3%)

Query: 16  EHPQHDNARVVKDLLA-GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEG 74
           E P   N     +LLA G + G+A      P DT K  +QT          ++K+   +G
Sbjct: 212 EDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSMMQTEHLGLKT--AIKKIFVEKG 269

Query: 75  PRGFYKGTLTPLIGVGACVSLQFGVNEAMKRF 106
            RGFY+G    LI      +  F V E + + 
Sbjct: 270 LRGFYRGLGITLIRAIPANATVFYVYETLSKL 301

>Scas_632.9
          Length = 292

 Score =  109 bits (273), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 86/298 (28%), Positives = 140/298 (46%), Gaps = 29/298 (9%)

Query: 16  EHPQHDNA--RVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAMEVVRKLL 70
           +HP   ++    + D++ G+  G    ++  PFDT KVRLQT  +   PTT    ++   
Sbjct: 6   DHPIEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPTT-WSCIKYTY 64

Query: 71  ANEGP-RGFYKGTLTPLIGVG-ACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGV 128
            NEG  RGF++G  +PL G      +L    N+         N    S + L      G 
Sbjct: 65  HNEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVLEKFTNVSPLSNILLS-----GA 119

Query: 129 TGGIVNSFLASPIEHVRIRLQT---QTGSGTNAEFKGPLECIKKLRHNKALL---RGLTP 182
             G   SF+ +P+E ++ +LQ    QT      +    +  +  +   K +L   +G + 
Sbjct: 120 FAGSCASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSS 179

Query: 183 TILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDV 242
           T +RE  G   +F  YE +     ++R+  E K    W+L + GA +G A    ++P D 
Sbjct: 180 TFIRESLGGVAWFATYEVMKQGLKDRRKDTENK---TWELLVSGASAGLAFNASIFPADT 236

Query: 243 IKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           +KS+MQT+++        I++V K L    GI  F++G G T++RA PAN   F  +E
Sbjct: 237 VKSMMQTEHI------TLINAVKKVL-TTYGITGFYRGLGITLIRAVPANATVFYMYE 287

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 72/189 (38%), Gaps = 30/189 (15%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT-------------TAMEVVRKLLANEGP 75
           LL+G   G     V  P +  K +LQ S+  T             T M V+R+    +G 
Sbjct: 115 LLSGAFAGSCASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLRE----KGI 170

Query: 76  RGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNS 135
            G ++G  +  I         F   E MK+    R  D  +     +    G + G+  +
Sbjct: 171 LGLWQGQSSTFIRESLGGVAWFATYEVMKQGLKDRRKDTEN--KTWELLVSGASAGLAFN 228

Query: 136 FLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKAL---LRGLTPTILREGHGCG 192
               P + V+  +QT+  +  NA        +KK+     +    RGL  T++R      
Sbjct: 229 ASIFPADTVKSMMQTEHITLINA--------VKKVLTTYGITGFYRGLGITLIRAVPANA 280

Query: 193 TYFLVYEAL 201
           T F +YE L
Sbjct: 281 TVFYMYETL 289

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score =  109 bits (272), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 86/290 (29%), Positives = 134/290 (46%), Gaps = 24/290 (8%)

Query: 21  DNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAMEVVRKLLANEG-PR 76
           D    +KD+  G+  G    ++  PFDT KVRLQT      PTT    +R    +EG  +
Sbjct: 3   DLESALKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHLYPTT-WSCIRSTYTDEGIWK 61

Query: 77  GFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSF 136
           GFY+G  +PL G     ++ F        F      + +    L +    G   G   SF
Sbjct: 62  GFYQGIASPLFGAALENAVLFVSFNQCTNFLD----EFTQLKPLTKTIYSGAFAGACASF 117

Query: 137 LASPIEHVRIRLQTQTGSGTNAE---FKGPLECIKKLRHNKALL---RGLTPTILREGHG 190
           + +P+E V+ +LQ    S + ++          IK +   K LL   +G   T +RE  G
Sbjct: 118 ILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLG 177

Query: 191 CGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTD 250
              +F  YE ++  +       E+++   W+L + GA +G      V+P D +KSV QT+
Sbjct: 178 GAVWFTTYE-IMKMKFASLHPAEKEN-HTWELLVSGASAGVLFNASVFPADTVKSVCQTE 235

Query: 251 NLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           ++       SI +  K +    GI  F++G G T++RAAPAN   F T+E
Sbjct: 236 HV-------SIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYE 278

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 79/204 (38%), Gaps = 21/204 (10%)

Query: 9   QLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP--------- 59
           Q  + L+E  Q     + K + +G   G     +  P +  K +LQ S+           
Sbjct: 87  QCTNFLDEFTQLK--PLTKTIYSGAFAGACASFILTPVELVKCKLQVSNISNSLSQTTRH 144

Query: 60  TTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH--HRNADMSST 117
           T+    ++ ++  +G  G ++G L+  +      ++ F   E MK  F   H     + T
Sbjct: 145 TSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTYEIMKMKFASLHPAEKENHT 204

Query: 118 LSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALL 177
             L      G + G++ +    P + V+   QT+  S  NA     L+ + +        
Sbjct: 205 WEL---LVSGASAGVLFNASVFPADTVKSVCQTEHVSIVNA-----LKKVLRTHGITGFY 256

Query: 178 RGLTPTILREGHGCGTYFLVYEAL 201
           RGL  T++R      T F  YE L
Sbjct: 257 RGLGITLIRAAPANATVFYTYETL 280

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 40/197 (20%), Positives = 75/197 (38%), Gaps = 18/197 (9%)

Query: 112 ADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLR 171
           +D+ S L    Y   G   G +   +  P + V++RLQTQ        +     CI+   
Sbjct: 2   SDLESALKDIAY---GSVAGAIGKVIEYPFDTVKVRLQTQPAH----LYPTTWSCIRSTY 54

Query: 172 HNKALLRGLTPTILREGHGCG---TYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGAL 228
            ++ + +G    I     G         V      N +++   L+    P  K    GA 
Sbjct: 55  TDEGIWKGFYQGIASPLFGAALENAVLFVSFNQCTNFLDEFTQLK----PLTKTIYSGAF 110

Query: 229 SGTALWLMVYPLDVIKSVMQTDN----LQKPKFGNSISSVAKTLYANGGIGAFFKGFGPT 284
           +G     ++ P++++K  +Q  N    L +     S+    K++    G+   ++G   T
Sbjct: 111 AGACASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLST 170

Query: 285 MLRAAPANGATFATFEL 301
            +R        F T+E+
Sbjct: 171 FVRECLGGAVWFTTYEI 187

 Score = 34.7 bits (78), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 38/91 (41%), Gaps = 2/91 (2%)

Query: 17  HPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPR 76
           HP        + L++G + G+       P DT K   QT     + +  ++K+L   G  
Sbjct: 196 HPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQTEHV--SIVNALKKVLRTHGIT 253

Query: 77  GFYKGTLTPLIGVGACVSLQFGVNEAMKRFF 107
           GFY+G    LI      +  F   E +K+ F
Sbjct: 254 GFYRGLGITLIRAAPANATVFYTYETLKKMF 284

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score =  112 bits (281), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 81/283 (28%), Positives = 131/283 (46%), Gaps = 12/283 (4%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS---STPTTAMEVVRKLLANEGPRGFYKGT 82
           + +   G+  G    +V  P D  K R+Q     S    +++ + K+L+ EG RG Y G 
Sbjct: 525 IYNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLYSGL 584

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIE 142
              LIGV    +++  VN+ M+     R+      LSLP     G T G       +P+E
Sbjct: 585 GPQLIGVAPEKAIKLTVNDHMRATLAGRDG----KLSLPCEIISGATAGACQVVFTNPLE 640

Query: 143 HVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK--ALLRGLTPTILREGHGCGTYFLVYEA 200
            V+IRLQ ++    +A  +  +  I  +++     L RG    +LR+      YF  Y  
Sbjct: 641 IVKIRLQVKSDYVADAA-RNSVNAISVIKNLGLIGLYRGAGACLLRDIPFSAIYFPTYAH 699

Query: 201 LIANQMN--KRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFG 258
           + +N  N   +   +R  +  W+L + G L+G     +  P DVIK+ +Q D  +     
Sbjct: 700 IKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVY 759

Query: 259 NSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFEL 301
           N I   A+T+    GI +FFKG    +LR++P  G T A +E+
Sbjct: 760 NGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEI 802

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 9/86 (10%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTS-----STPTTAMEVVRKLLANEGPRGFYKGTL 83
           L++G   G+    +  PFD  K RLQ       S      +  R +L  EG + F+KG  
Sbjct: 724 LVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYNGIWDAARTILKEEGIKSFFKGGP 783

Query: 84  TPLIGVGACVSLQFGVNEAMKRFFHH 109
             ++      S QFG   A    FH+
Sbjct: 784 ARVLR----SSPQFGFTLAAYEIFHN 805

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score =  106 bits (265), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 93/296 (31%), Positives = 132/296 (44%), Gaps = 37/296 (12%)

Query: 20  HDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAMEVVRKLLANEG-P 75
            D  +  KDLL G   G    LV  PFDT KVRLQT S    PTT    V      EG  
Sbjct: 3   EDADKAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFPTT-WSCVSHTYKQEGLW 61

Query: 76  RGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLS---LPQYYACGVTGGI 132
           RGFY+G  +P+ G        F  +  +   F+   A + +  S   L +    G   G 
Sbjct: 62  RGFYQGMASPVFGA-------FLEHAVLFVSFNRAQAVLENCYSCGPLEKVVFAGAIAGA 114

Query: 133 VNSFLASPIEHVRIRLQTQTGSGTNAEFKGP--------LECIKKLRHNKALLRGLTPTI 184
             S++ +P+E V+ +LQ    +G +    GP        L  I K      L +G + T 
Sbjct: 115 CTSYVLTPVELVKCKLQVSNLTGVS----GPRYTAVLPTLRAIVKQNGLGGLWQGQSGTF 170

Query: 185 LREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIK 244
           +RE  G   +F  YE L    + +RRG     +  W+L   GA +G A    ++P D +K
Sbjct: 171 IRESAGGAVWFTAYEVL-KGWLARRRGSTENTV--WELLASGAGAGAAFHASIFPADTVK 227

Query: 245 SVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           S MQT++L        +    +T+    G   F++G G T+LRA PAN   F  +E
Sbjct: 228 STMQTEHL-------GLGPAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYE 276

>Scas_714.18
          Length = 305

 Score =  106 bits (265), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 83/303 (27%), Positives = 134/303 (44%), Gaps = 44/303 (14%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAMEVVRKLLANEGP-RGFYKG 81
           ++++LAG+  G     +  PFDT KVRLQT      P+T    ++    NEG   GFY+G
Sbjct: 13  LREILAGSIAGAIGKFIEYPFDTVKVRLQTQEAYMFPST-WSCIKYTYENEGILEGFYQG 71

Query: 82  TLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPI 141
             +PLIG     ++ F        F    NA    +  L    + G  G    SF+ +P+
Sbjct: 72  IESPLIGAALENAILFLAYNQCSSFL---NAFTEFSAFLIILISAGFAGSCA-SFVLTPV 127

Query: 142 EHVRIRLQTQT------------------------GSGTNAEFKGPLECIKKLRHNKALL 177
           E ++ +LQ                           G G +      ++ I K +    L 
Sbjct: 128 ELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLW 187

Query: 178 RGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMV 237
           +G + T +RE  G   +F  YE +     + +  +       W+L I GA +G A    V
Sbjct: 188 QGQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVN----TTWQLLISGATAGLAFNGSV 243

Query: 238 YPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFA 297
           +P D +KS+MQT++L       ++    +++    G+  F++G G T+LRA P+N A F 
Sbjct: 244 FPADTVKSIMQTEHL-------ALMETVRSILERDGVAGFYRGLGITLLRAVPSNAAVFY 296

Query: 298 TFE 300
           T+E
Sbjct: 297 TYE 299

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 71/201 (35%), Gaps = 35/201 (17%)

Query: 127 GVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILR 186
           G   G +  F+  P + V++RLQTQ        F     CIK    N+ +L G    I  
Sbjct: 19  GSIAGAIGKFIEYPFDTVKVRLQTQEAY----MFPSTWSCIKYTYENEGILEGFYQGIES 74

Query: 187 EGHGCG----TYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDV 242
              G        FL Y     NQ +       +      + I    +G+    ++ P+++
Sbjct: 75  PLIGAALENAILFLAY-----NQCSSFLNAFTEFSAFLIILISAGFAGSCASFVLTPVEL 129

Query: 243 IKSVMQTDNLQKPKFGNS----------------------ISSVAKTLYANGGIGAFFKG 280
           IK  +Q  NL      N                       I    K++    G+   ++G
Sbjct: 130 IKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLWQG 189

Query: 281 FGPTMLRAAPANGATFATFEL 301
              T +R +  +   FAT+EL
Sbjct: 190 QSSTFIRESIGSVVWFATYEL 210

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score =  103 bits (256), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 79/288 (27%), Positives = 134/288 (46%), Gaps = 21/288 (7%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQT------SSTPTTAMEVVRKLLANEGPRGFYKG 81
           +L+AG   G+ + L   P DT KVR+Q        + P   +     + + EG   FYKG
Sbjct: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119

Query: 82  TLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLA-SP 140
               +IG+   ++++F   E  +     R   + ST +    +  GV  G+  + L  +P
Sbjct: 120 LGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNT---FLAGVGAGVTEAVLVVNP 176

Query: 141 IEHVRIRLQTQT--GSGTNAEFKGPLEC---IKKLRHNKALLRGLTPTILREGHGCGTYF 195
           +E V+IRLQ Q   G+    +++  ++    I K     AL RG++ T  R+    G  F
Sbjct: 177 MEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANF 236

Query: 196 LVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKP 255
            VY  L+  ++ +  G   +++P+W+  + G +SG        PLD IK+ +Q D   + 
Sbjct: 237 TVYSKLM-ERLQEYHG--SQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTR- 292

Query: 256 KFGN--SISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFEL 301
              N   I+++ + L    G  A +KG  P ++R AP    TF  +E 
Sbjct: 293 NLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 340

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 43/106 (40%), Gaps = 6/106 (5%)

Query: 9   QLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVV-- 66
           +L++ L+E+    N    +  L G   G        P DT K RLQ   +       V  
Sbjct: 241 KLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRI 300

Query: 67  ----RKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH 108
               R+L+  EG R  YKG    ++ V    ++ F V E ++R   
Sbjct: 301 TTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLE 346

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score =  100 bits (249), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/287 (27%), Positives = 133/287 (46%), Gaps = 30/287 (10%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTS----STP--TTAMEVVRKLLANEGPRGFYKG 81
              AG   G++++LV  P D  K R+Q      + P  T  ++ ++K++A EG    YKG
Sbjct: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73

Query: 82  TLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPI 141
             +P++      + +F  N+  ++ +  + A     LS P     G + G V +F+  P 
Sbjct: 74  ISSPILMEAPKRATKFACNDEFQKLY--KQAFGVEKLSQPLSMLAGASAGCVEAFVVVPF 131

Query: 142 EHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTILREGHGCGTYF-LV 197
           E V+IRLQ  + S     +KGP++ ++K+   +   A+  GL  T+ R     G YF ++
Sbjct: 132 ELVKIRLQDASSS-----YKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGII 186

Query: 198 YEA--LIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQK- 254
           ++A  L+    NK + +    I     C  G +  T       P DV+KS +Q   +   
Sbjct: 187 FQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-------PFDVVKSRIQNTAVIPG 239

Query: 255 --PKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATF 299
              K+  S+ S+  T+Y   G  A +KGF P +LR  P  G     F
Sbjct: 240 VVRKYNWSLPSLL-TIYREEGFRALYKGFVPKVLRLGPGGGILLVVF 285

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 83/183 (45%), Gaps = 14/183 (7%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQ-TSSTPTTAMEVVRKLLANEGPRGFYKGTLTPL 86
            +LAG + G  +  V  PF+  K+RLQ  SS+    ++VVRK++A EG    Y G  + L
Sbjct: 113 SMLAGASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTL 172

Query: 87  IGVGACVSLQFGV---NEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEH 143
                     FG+     A+    H++   +++ L +     C      +   L++P + 
Sbjct: 173 WRHALWNGGYFGIIFQARALLPAAHNKTQCITNDL-ISDSIGCS-----IGCMLSTPFDV 226

Query: 144 VRIRLQ-TQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTILREGHGCGTYFLVYE 199
           V+ R+Q T    G   ++   L  +  +      +AL +G  P +LR G G G   +V+ 
Sbjct: 227 VKSRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFT 286

Query: 200 ALI 202
            ++
Sbjct: 287 GVL 289

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 87/191 (45%), Gaps = 20/191 (10%)

Query: 115 SSTLSLP---QYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLR 171
           S T SLP   Q++A G   G+    +  P++ V+ R+Q Q   G    + G ++C+KK+ 
Sbjct: 4   SDTKSLPFLYQFFA-GAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIV 62

Query: 172 HNKA---LLRGLTPTILREGHGCGTYFLVYEALIANQMNKRR-GLERKDIPAWKLCIFGA 227
             +    L +G++  IL E     T F   +     ++ K+  G+E+   P   L   GA
Sbjct: 63  AGEGVGRLYKGISSPILMEAPKRATKFACNDEF--QKLYKQAFGVEKLSQPLSMLA--GA 118

Query: 228 LSGTALWLMVYPLDVIKSVMQ--TDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTM 285
            +G     +V P +++K  +Q  + + + P        V + + A  G+ A + G   T+
Sbjct: 119 SAGCVEAFVVVPFELVKIRLQDASSSYKGP------VDVVRKIVAREGVLAMYNGLESTL 172

Query: 286 LRAAPANGATF 296
            R A  NG  F
Sbjct: 173 WRHALWNGGYF 183

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 13/76 (17%)

Query: 25  VVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRK----------LLANEG 74
           +  DL++ + G     ++  PFD  K R+Q ++       VVRK          +   EG
Sbjct: 203 ITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPG---VVRKYNWSLPSLLTIYREEG 259

Query: 75  PRGFYKGTLTPLIGVG 90
            R  YKG +  ++ +G
Sbjct: 260 FRALYKGFVPKVLRLG 275

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score =  100 bits (248), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 84/306 (27%), Positives = 133/306 (43%), Gaps = 55/306 (17%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP----------------TTAMEVVRKL 69
           +    AG   G++++LV  P D  K R+Q   T                 T  M+ + K+
Sbjct: 12  IYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKI 71

Query: 70  LANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAM----KRFFHHRNADMSSTLSLPQYYA 125
           +  EG    YKG  +P++      +++F  N+      K+ F   N +M+  +++     
Sbjct: 72  VKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAI----Y 127

Query: 126 CGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTP 182
            G + G V +F+ +P E V+IRLQ       N++FK P+E +K         +L  GL  
Sbjct: 128 SGASAGAVEAFVVAPFELVKIRLQD-----VNSQFKTPIEVVKNSVVKGGVLSLFNGLEA 182

Query: 183 TILREGHGCGTYF-LVYEALIANQMNKRRGLERKDIPAWKLC--------IFGALSGTAL 233
           TI R       YF ++++              RK +PA K          I GA+ GT  
Sbjct: 183 TIWRHVLWNAGYFGIIFQI-------------RKLLPAAKTSTEKTRNDLIAGAIGGTVG 229

Query: 234 WLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANG 293
            L+  P DV+KS +Q  +    K+  S+ SV   +Y   G  A +KGF P ++R AP  G
Sbjct: 230 CLLNTPFDVVKSRIQRSSGPLRKYNWSLPSVL-LVYREEGFKALYKGFAPKVMRLAPGGG 288

Query: 294 ATFATF 299
                F
Sbjct: 289 LLLVVF 294

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score =  102 bits (255), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 82/288 (28%), Positives = 131/288 (45%), Gaps = 22/288 (7%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQ---TSSTPTTAMEVVRKLLANEGPRGFYKGT 82
           + +   G+  G     V  P D  K R+Q    S     +++ V K+   +G RG Y G 
Sbjct: 505 IHNFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLYSGL 564

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIE 142
              LIGV    +++  VN+ M+++F ++    S T+   Q    G T G       +P+E
Sbjct: 565 GPQLIGVAPEKAIKLTVNDFMRQYFMNK----SRTIKWYQEILSGATAGACQVVFTNPLE 620

Query: 143 HVRIRLQTQTGS-GTNAEFK-GPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEA 200
            V+IRLQ ++   G NA  + G +  I++L   + L +G    +LR+      YF  Y  
Sbjct: 621 IVKIRLQMRSDYVGENARPQLGAVGIIRQLGL-RGLYKGAAACLLRDVPFSAIYFPTYAH 679

Query: 201 LIA-------NQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQ 253
           L         N  NKR  L+      W+L + G ++G     +  P DVIK+ +Q D  +
Sbjct: 680 LKKDVFNFDPNDKNKRNKLK-----TWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPRK 734

Query: 254 KPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFEL 301
                  +   A+T+     I +FFKG    +LR++P  G T A FE+
Sbjct: 735 GETTYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEM 782

>Kwal_26.8669
          Length = 296

 Score = 99.4 bits (246), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 79/284 (27%), Positives = 132/284 (46%), Gaps = 30/284 (10%)

Query: 31  AGTAGGIAQVLVGQPFDTTKVRLQTSSTP------TTAMEVVRKLLANEGPRGFYKGTLT 84
           AG   GI+++LV  P D  K R+Q   +          ++ +++++A EG    YKG  +
Sbjct: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74

Query: 85  PLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHV 144
           P++      + +F  N+  ++ +         T SL      G + G   +F+  P E V
Sbjct: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLS--ILSGASAGCCEAFVVVPFELV 132

Query: 145 RIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTILREGHGCGTYF-LVYE- 199
           +IRLQ  + S     +KGP++ ++K+   +   A+  GL  T+ R G     YF ++++ 
Sbjct: 133 KIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQV 187

Query: 200 -ALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQK---P 255
            AL+    +K +   R D+      I G++ GT   LM  P DV+KS +Q   +      
Sbjct: 188 RALLPEAKSKSQQ-TRNDL------IAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGAR 240

Query: 256 KFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATF 299
           K+  S  S+  T+Y   G  A +KGF P +LR  P  G     F
Sbjct: 241 KYNWSWPSIF-TIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 8/176 (4%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQ-TSSTPTTAMEVVRKLLANEGPRGFYKGTLTPL 86
            +L+G + G  +  V  PF+  K+RLQ  SS+    ++VVRK++A EG    Y G  + L
Sbjct: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170

Query: 87  IGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRI 146
              G   +  FG+   ++       +    T +       G  GG + S +++P + V+ 
Sbjct: 171 WRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRN---DLIAGSIGGTIGSLMSTPFDVVKS 227

Query: 147 RLQTQ---TGSGTNAEFKGP-LECIKKLRHNKALLRGLTPTILREGHGCGTYFLVY 198
           R+Q      G      +  P +  I K    +AL +G  P +LR G G G   +V+
Sbjct: 228 RIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 85/192 (44%), Gaps = 20/192 (10%)

Query: 114 MSSTLSLPQYY--ACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLR 171
           M+    LP +Y  A G   GI    +  P++ V+ R+Q Q   G   ++KG ++CIK++ 
Sbjct: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60

Query: 172 HNKA---LLRGLTPTILREGHGCGTYFLVYEALIANQMNKRR-GLERKDIPAWKLCIF-G 226
             +    L +G++  +L E     T F   +     ++ KR  G+E+       L I  G
Sbjct: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEF--QKIYKREFGVEKL---TQSLSILSG 115

Query: 227 ALSGTALWLMVYPLDVIKSVMQ--TDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPT 284
           A +G     +V P +++K  +Q  + + + P        V + + A  G+ A + G   T
Sbjct: 116 ASAGCCEAFVVVPFELVKIRLQDVSSSYKGP------IDVVRKIIAQEGVLAMYNGLEST 169

Query: 285 MLRAAPANGATF 296
           + R    N   F
Sbjct: 170 LWRHGVWNAGYF 181

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 98.6 bits (244), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 80/288 (27%), Positives = 132/288 (45%), Gaps = 28/288 (9%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTK--VRLQTS--STPTT--AMEVVRKLLANEGPRGFY 79
           V   +AG   G++++LV  P D  K  ++LQ S  S P      + ++++ A EGP   Y
Sbjct: 10  VYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLY 69

Query: 80  KGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLAS 139
           KG  +P++      + +F  N+  ++ +  ++   +  L+ P     G + GI  SF+  
Sbjct: 70  KGISSPILMEAPKRATKFACNDEFQKIY--KDLFGAEKLTQPLSILSGASAGICESFVVV 127

Query: 140 PIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALL---RGLTPTILREGHGCGTYF- 195
           P E V+IRLQ       +++F  P+  +K +   + +L    GL  T+ R G     YF 
Sbjct: 128 PFELVKIRLQD-----VSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG 182

Query: 196 LVYE--ALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQ 253
           ++++  AL+     K     R D+ A      G + GT   L+  P DV+KS +Q   + 
Sbjct: 183 IIFQVRALLPKASTKSEQ-TRNDLLA------GTVGGTLSSLLSTPFDVVKSRVQNTAVI 235

Query: 254 K--PKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATF 299
              P+  N       T+Y   G  A +KGF P +LR  P  G     F
Sbjct: 236 PGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVF 283

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 82/180 (45%), Gaps = 8/180 (4%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQ-TSSTPTTAMEVVRKLLANEGPRGFYKGTLTPL 86
            +L+G + GI +  V  PF+  K+RLQ  SS  T+ + VV+ ++  EG    Y G  + +
Sbjct: 111 SILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTM 170

Query: 87  IGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRI 146
              G   +  FG+   ++      +     T +       G  GG ++S L++P + V+ 
Sbjct: 171 WRHGIWNAGYFGIIFQVRALLPKASTKSEQTRN---DLLAGTVGGTLSSLLSTPFDVVKS 227

Query: 147 RLQTQT---GSGTNAEFKGP-LECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALI 202
           R+Q      G      +  P L  I K    KAL +G  P +LR G G G   +V+  ++
Sbjct: 228 RVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVM 287

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 78/188 (41%), Gaps = 12/188 (6%)

Query: 114 MSSTLSLPQYY--ACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLR 171
           MS    LP  Y    G   G+    +  P++ V+  +Q Q   G+  ++KG  +C+K++ 
Sbjct: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60

Query: 172 HNKA---LLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGAL 228
             +    L +G++  IL E     T F   +           G E+   P   L   GA 
Sbjct: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEF-QKIYKDLFGAEKLTQPLSILS--GAS 117

Query: 229 SGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRA 288
           +G     +V P +++K  +Q  +    KF + I +V K +    GI A + G   TM R 
Sbjct: 118 AGICESFVVVPFELVKIRLQDVS---SKFTSPI-AVVKNIVEKEGILAMYNGLESTMWRH 173

Query: 289 APANGATF 296
              N   F
Sbjct: 174 GIWNAGYF 181

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score =  101 bits (251), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 127/280 (45%), Gaps = 14/280 (5%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAMEVVRKLLANEGPRGFYKGTLTPL 86
           L   AG I   +V  P D  K R+Q   +      +++ + K+++ EG +G Y G    L
Sbjct: 536 LGSIAGCIGATVV-YPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGPQL 594

Query: 87  IGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRI 146
           IGV    +++  VN+ M+    +R  D +  LSL      G + G       +P+E V+I
Sbjct: 595 IGVAPEKAIKLTVNDFMR----NRLTDKNGKLSLFPEIISGASAGACQVIFTNPLEIVKI 650

Query: 147 RLQTQT---GSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIA 203
           RLQ Q+   G       +   + +KKL   + L  G+   ++R+      YF  Y  L  
Sbjct: 651 RLQVQSDYVGENIQQANETATQIVKKLGL-RGLYNGVAACLMRDVPFSAIYFPTYAHLKK 709

Query: 204 N--QMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSI 261
           +    +     +R  +  W+L   GA++G     +  P DVIK+ +Q D  +     N I
Sbjct: 710 DLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKYNGI 769

Query: 262 SSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFEL 301
               +T+       +FFKG G  +LR++P  G T A +EL
Sbjct: 770 FHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYEL 809

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 82/208 (39%), Gaps = 26/208 (12%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---------PTTAMEVVRKLLANEGPRGF 78
           ++++G + G  QV+   P +  K+RLQ  S            TA ++V+KL    G RG 
Sbjct: 627 EIISGASAGACQVIFTNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKL----GLRGL 682

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKR---FFHHRNADMSSTLSLPQYYACGVTGGIVNS 135
           Y G    L+      ++ F     +K+    F   +    + L   +    G   G+  +
Sbjct: 683 YNGVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAA 742

Query: 136 FLASPIEHVRIRLQTQTGSGTNAEFKGPLECIK---KLRHNKALLRGLTPTILREGHGCG 192
           FL +P + ++ RLQ     G   ++ G    I+   K    ++  +G    +LR     G
Sbjct: 743 FLTTPFDVIKTRLQIDPRKGE-TKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFG 801

Query: 193 TYFLVYEALIA------NQMNKRRGLER 214
                YE          N++  R G +R
Sbjct: 802 FTLAAYELFKGFIPSPDNKLKSREGRKR 829

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/182 (20%), Positives = 77/182 (42%), Gaps = 17/182 (9%)

Query: 124 YACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGL 180
           ++ G   G + + +  PI+ ++ R+Q Q      A++K  ++C+ K+      K L  GL
Sbjct: 534 FSLGSIAGCIGATVVYPIDFIKTRMQAQRSL---AQYKNSIDCLLKIISREGIKGLYSGL 590

Query: 181 TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPL 240
            P ++           V +  + N++  + G     +  +   I GA +G    +   PL
Sbjct: 591 GPQLIGVAPEKAIKLTVND-FMRNRLTDKNG----KLSLFPEIISGASAGACQVIFTNPL 645

Query: 241 DVIKSVMQTDNLQKPKFGNSISSVAKT---LYANGGIGAFFKGFGPTMLRAAPANGATFA 297
           +++K  +Q   +Q    G +I    +T   +    G+   + G    ++R  P +   F 
Sbjct: 646 EIVKIRLQ---VQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFP 702

Query: 298 TF 299
           T+
Sbjct: 703 TY 704

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 97.4 bits (241), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 129/292 (44%), Gaps = 25/292 (8%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSS--------TPTTAMEVVRKLLANEGPRGFY 79
           +L+AG   G+ + L   P DT KVR+Q            P   ++  R +   EG    Y
Sbjct: 13  NLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALY 72

Query: 80  KGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLA- 138
           KG    +IG+   ++++F   E  +    ++ + + ST +    +  GV  GI  + L  
Sbjct: 73  KGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNT---FVAGVGAGITEAVLVV 129

Query: 139 SPIEHVRIRLQTQ--TGSGTNA--EFKGPLEC---IKKLRHNKALLRGLTPTILREGHGC 191
           +P+E V+IRLQ Q  T S  NA  ++   +     I K     AL RG++ T  R+    
Sbjct: 130 NPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQ 189

Query: 192 GTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTD- 250
           G  F VY  L     N     +   +P+W+    G +SG        PLD IK+ +Q D 
Sbjct: 190 GANFTVYSKLKEFLQNYH---QMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDK 246

Query: 251 --NLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
             +L+K      I ++   L    G  A +KG  P ++R AP    TF  +E
Sbjct: 247 SISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 298

>Scas_691.4
          Length = 334

 Score = 97.8 bits (242), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 84/315 (26%), Positives = 136/315 (43%), Gaps = 35/315 (11%)

Query: 15  EEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS-----TPTTAMEVVRKL 69
           +++P    +  + +L+AG   G+ + L   P DT KVR+Q +       P   +   R +
Sbjct: 3   QKNPNDKKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNI 62

Query: 70  LANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSS-TLSLPQYYACGV 128
            ++EG    YKG    +IG+   ++++F   E    F+ +   D  + T++    +  GV
Sbjct: 63  YSHEGFLALYKGLGAVVIGIIPKMAIRFSSYE----FYRNALTDKETRTITTGNTFLAGV 118

Query: 129 TGGIVNSFL-ASPIEHVRIRLQTQ------------TGSGTNAEFKGP--------LECI 167
             GI  + L  +P+E V+IRLQ Q            + +GT A    P           I
Sbjct: 119 GAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTI 178

Query: 168 KKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGA 227
            K     AL RG++ T  R+    G  F VY  L  + + K     R+ +P+W+    G 
Sbjct: 179 VKEEGAGALYRGVSLTAARQATNQGANFTVYSYL-KDYLQKYH--NRESLPSWETSCIGL 235

Query: 228 LSGTALWLMVYPLDVIKSVMQTD-NLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTML 286
           +SG        PLD IK+ +Q D ++        I  +   L    G  A +KG  P ++
Sbjct: 236 ISGAIGPFSNAPLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVM 295

Query: 287 RAAPANGATFATFEL 301
           R AP    TF  +E 
Sbjct: 296 RVAPGQAVTFTVYEF 310

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 6/73 (8%)

Query: 45  PFDTTKVRLQ-----TSSTPTTAMEVV-RKLLANEGPRGFYKGTLTPLIGVGACVSLQFG 98
           P DT K RLQ     +S++    + ++  +L+  EG R  YKG    ++ V    ++ F 
Sbjct: 247 PLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFT 306

Query: 99  VNEAMKRFFHHRN 111
           V E +++     N
Sbjct: 307 VYEFVRKHLETLN 319

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 96.7 bits (239), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 79/305 (25%), Positives = 134/305 (43%), Gaps = 29/305 (9%)

Query: 21  DNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQ---TSSTPTTAMEVVRKLLANEGPRG 77
           D + V K++++G   G    +   P D  KVRLQ   T+  P    +VV++++ +     
Sbjct: 4   DFSPVQKEMISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQHS 63

Query: 78  F----YKGTLTPLIGVGACVSLQFGV------------NEAMKRFFHHRNADMSSTLSLP 121
           F    Y+G    L+G      L FG+            N  +KRF +  N D   T SL 
Sbjct: 64  FFRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMT-SL- 121

Query: 122 QYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKAL---LR 178
            Y       G+  S L +PI  ++ R+ + T    +  ++  ++ IKKL   + L    R
Sbjct: 122 MYLLAAAMSGVATSVLTNPIWVIKTRIMS-TSFVDSRSYRSTVDGIKKLYRIEGLAGFWR 180

Query: 179 GLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVY 238
           GL P++     G   YF VY+ L  +    +   ++K +   +     +LS       VY
Sbjct: 181 GLVPSLFGVSQG-AIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVY 239

Query: 239 PLDVIKSVMQT---DNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGAT 295
           PL ++KS +Q+     +  PK  + +  +  T+Y   G+   +KG    ++RA P+   T
Sbjct: 240 PLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCIT 299

Query: 296 FATFE 300
           F  +E
Sbjct: 300 FCVYE 304

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 97.1 bits (240), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 124/288 (43%), Gaps = 27/288 (9%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT--------AMEVVRKLLANEGPRGFYKG 81
           L+G   G    +   P D  K RLQ     T          M  +  ++ +EGPRG YKG
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKG 141

Query: 82  TLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQY----YACG-VTGGIVNSF 136
            +  ++G      + F V E  K+FFH            PQ+     +C  +T G  ++ 
Sbjct: 142 LVPIVLGYFPTWMIYFSVYEFSKKFFHG---------IFPQFDFVAQSCAAITAGAASTT 192

Query: 137 LASPIEHVRIRLQTQTGSGTN-AEFKGPLECIKKLRHN---KALLRGLTPTILREGHGCG 192
           L +PI  V+ RL  Q+  G +   +KG  +  +KL +    KAL  GL P++L   H   
Sbjct: 193 LTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGLFH-VA 251

Query: 193 TYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNL 252
            +F +YE L        R      I   +L +  ++S      + YP +++++ MQ  + 
Sbjct: 252 IHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSD 311

Query: 253 QKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
                   +  + K  YA  G+  F+ GF   ++R  PA+  T  +FE
Sbjct: 312 IPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFE 359

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 98.2 bits (243), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 88/290 (30%), Positives = 128/290 (44%), Gaps = 34/290 (11%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTS---STPTTAMEVVRKLLANEGPRGFYKGTLTPL 86
           L   AG I   +V  P D  K R+Q     S    +++   K+L+ EG RG Y G    L
Sbjct: 549 LGSVAGCIGATIV-YPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVYSGLGPQL 607

Query: 87  IGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRI 146
           IGV    +++  VN+ M+    ++  D +  L L      G + G       +P+E V+I
Sbjct: 608 IGVAPEKAIKLTVNDYMR----NKLKDKNGKLGLLSEIISGASAGACQVIFTNPLEIVKI 663

Query: 147 RLQTQ----TGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALI 202
           RLQ +      +  NA+    L+ IK+L     L +G    +LR+      YF  Y  L 
Sbjct: 664 RLQVKGEYVAENAENAKLTA-LQIIKRLGL-PGLYKGAAACLLRDVPFSAIYFPTYAHLK 721

Query: 203 A-------NQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKP 255
                   N  NKR  L       W+L   GAL+G     +  P DVIK+ +Q D    P
Sbjct: 722 RDLFNFDPNDKNKRSRLN-----TWELLSAGALAGMPAAYLTTPFDVIKTRLQID----P 772

Query: 256 KFGNSISS----VAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFEL 301
           K G +I       A+T+       +FFKG    +LR++P  G T A +EL
Sbjct: 773 KKGETIYKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYEL 822

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 82/190 (43%), Gaps = 20/190 (10%)

Query: 25  VVKDLLAGTAGGIAQVLVGQPFDTTKVRLQT---------SSTPTTAMEVVRKLLANEGP 75
           ++ ++++G + G  QV+   P +  K+RLQ           +   TA++++++L    G 
Sbjct: 637 LLSEIISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAKLTALQIIKRL----GL 692

Query: 76  RGFYKGTLTPLIGVGACVSLQFGVNEAMKR---FFHHRNADMSSTLSLPQYYACGVTGGI 132
            G YKG    L+      ++ F     +KR    F   + +  S L+  +  + G   G+
Sbjct: 693 PGLYKGAAACLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGM 752

Query: 133 VNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKK-LRHN--KALLRGLTPTILREGH 189
             ++L +P + ++ RLQ     G    +KG +   +  LR    K+  +G    +LR   
Sbjct: 753 PAAYLTTPFDVIKTRLQIDPKKGETI-YKGIIHAARTILREESFKSFFKGGAARVLRSSP 811

Query: 190 GCGTYFLVYE 199
             G     YE
Sbjct: 812 QFGFTLAAYE 821

 Score = 35.8 bits (81), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 34/179 (18%), Positives = 72/179 (40%), Gaps = 11/179 (6%)

Query: 124 YACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGL 180
           ++ G   G + + +  PI+ V+ R+Q Q      +++K  ++C  K+      + +  GL
Sbjct: 547 FSLGSVAGCIGATIVYPIDFVKTRMQAQRSL---SQYKNSIDCFLKILSREGIRGVYSGL 603

Query: 181 TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPL 240
            P ++           V + +  N++  + G     +      I GA +G    +   PL
Sbjct: 604 GPQLIGVAPEKAIKLTVNDYM-RNKLKDKNG----KLGLLSEIISGASAGACQVIFTNPL 658

Query: 241 DVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATF 299
           +++K  +Q       +   +    A  +    G+   +KG    +LR  P +   F T+
Sbjct: 659 EIVKIRLQVKGEYVAENAENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFSAIYFPTY 717

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 94.7 bits (234), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 127/292 (43%), Gaps = 27/292 (9%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSS-------TPTTAMEVVRKLLANEGPRGFYK 80
           +L+AG   G+ + L   P DT KVR+Q           P   ++  R +   EG    YK
Sbjct: 13  NLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLALYK 72

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHHRNAD-MSSTLSLPQYYACGVTGGIVNSFLA- 138
           G    +IG+   ++++F   E    F+    AD  + ++S    +  GV  G   + L  
Sbjct: 73  GLGAVVIGIIPKMAIRFSSYE----FYRSALADKQTGSVSTGNTFLAGVGAGTTEAVLVV 128

Query: 139 SPIEHVRIRLQTQ---TGSGTNAEFKGPLEC---IKKLRHNKALLRGLTPTILREGHGCG 192
           +P+E V+IRLQ Q     +  +  ++  L+    I K     AL RG++ T  R+    G
Sbjct: 129 NPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQG 188

Query: 193 TYFLVYEAL--IANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTD 250
             F VY  L     + +K   L     P+W+    G +SG        PLD IK+ +Q D
Sbjct: 189 ANFTVYSKLKEFLQEHHKTDAL-----PSWETSCIGLISGAIGPFSNAPLDTIKTRLQKD 243

Query: 251 NLQKPKFGNS-ISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFEL 301
                  G S I ++ K L    G  A +KG  P ++R AP    TF  +E 
Sbjct: 244 KSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEF 295

 Score = 32.3 bits (72), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 43/102 (42%), Gaps = 6/102 (5%)

Query: 9   QLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP------TTA 62
           +L + L+EH + D     +    G   G        P DT K RLQ   +       +  
Sbjct: 196 KLKEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTANMSGWSRI 255

Query: 63  MEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMK 104
           + + ++L+  EG R  YKG    ++ V    ++ F V E ++
Sbjct: 256 VTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVR 297

>Scas_602.8
          Length = 885

 Score = 96.7 bits (239), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 126/284 (44%), Gaps = 22/284 (7%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT---TAMEVVRKLLANEGPRGFYKGTLTPL 86
           L   AG I   LV  P D  K R+Q   + T    +++ + K+   EG RG Y G    L
Sbjct: 504 LGSVAGCIGATLV-YPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLYSGLGPQL 562

Query: 87  IGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRI 146
           IGV    +++  VN+ M++       D    L L      G T G       +P+E V+I
Sbjct: 563 IGVAPEKAIKLTVNDFMRKSL----VDKKGNLQLGAEVLSGATAGACQVVFTNPLEIVKI 618

Query: 147 RLQTQTGSGTNAEF-KGPLECIKKLRHNK--ALLRGLTPTILREGHGCGTYFLVYEALIA 203
           RLQ ++   TNA   K  L   + ++  K   L +G+   +LR+      YF  Y  L  
Sbjct: 619 RLQVKS-EYTNAMIPKSQLTAFQIIKELKLIGLYKGVGACLLRDVPFSAIYFPTYAHLKK 677

Query: 204 N--QMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNS- 260
           N  Q +     +R  +  W+L   GAL+G     +  P DVIK+ +Q +    P  G + 
Sbjct: 678 NVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIE----PGVGETR 733

Query: 261 ---ISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFEL 301
              I    +T+       +FFKG    ++R++P  G T A +EL
Sbjct: 734 YTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYEL 777

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 84/204 (41%), Gaps = 27/204 (13%)

Query: 22  NARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPR----- 76
           N ++  ++L+G   G  QV+   P +  K+RLQ  S  T AM    +L A +  +     
Sbjct: 589 NLQLGAEVLSGATAGACQVVFTNPLEIVKIRLQVKSEYTNAMIPKSQLTAFQIIKELKLI 648

Query: 77  GFYKGTLTPLIGVGACV-------SLQFGVNEAMKRF---FHHRNADMSSTLSLPQYYAC 126
           G YK       GVGAC+       ++ F     +K+    F   + D    L   +    
Sbjct: 649 GLYK-------GVGACLLRDVPFSAIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTA 701

Query: 127 GVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIK---KLRHNKALLRGLTPT 183
           G   G+  +FL +P + ++ RLQ + G G    + G L  ++   K    ++  +G    
Sbjct: 702 GALAGVPAAFLTTPFDVIKTRLQIEPGVGE-TRYTGILHAVRTILKEESFRSFFKGGAAR 760

Query: 184 ILREGHGCGTYFLVYEALIANQMN 207
           ++R     G     YE L  N  N
Sbjct: 761 VMRSSPQFGFTLAAYE-LFKNMFN 783

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 32/74 (43%), Gaps = 5/74 (6%)

Query: 13  DLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQT-----SSTPTTAMEVVR 67
           D  +  + D  +  + L AG   G+    +  PFD  K RLQ       +  T  +  VR
Sbjct: 683 DPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGETRYTGILHAVR 742

Query: 68  KLLANEGPRGFYKG 81
            +L  E  R F+KG
Sbjct: 743 TILKEESFRSFFKG 756

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 78/183 (42%), Gaps = 19/183 (10%)

Query: 124 YACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGL 180
           ++ G   G + + L  PI+ ++ R+Q Q       ++K  ++C+ K+      + L  GL
Sbjct: 502 FSLGSVAGCIGATLVYPIDFIKTRMQAQRSL---TKYKNSIDCLVKIFGKEGIRGLYSGL 558

Query: 181 TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPL 240
            P ++           V + +  + ++K+  L+   + A  L   GA +G    +   PL
Sbjct: 559 GPQLIGVAPEKAIKLTVNDFMRKSLVDKKGNLQ---LGAEVLS--GATAGACQVVFTNPL 613

Query: 241 DVIKSVMQTD----NLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATF 296
           +++K  +Q      N   PK   +   + K L     +   +KG G  +LR  P +   F
Sbjct: 614 EIVKIRLQVKSEYTNAMIPKSQLTAFQIIKEL----KLIGLYKGVGACLLRDVPFSAIYF 669

Query: 297 ATF 299
            T+
Sbjct: 670 PTY 672

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 93.6 bits (231), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 136/302 (45%), Gaps = 49/302 (16%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS-STPTTA------------MEVVRKLLAN 72
           +   ++G   GI+++ V  P D  K R Q   +TPT A            ++ ++K++  
Sbjct: 13  IYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKK 72

Query: 73  EGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGI 132
           EG    Y+G  +P++      + +F  N+  ++ F +      +T  +    A G + G+
Sbjct: 73  EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS--IAAGASAGM 130

Query: 133 VNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALL---RGLTPTILREGH 189
             + +  P E ++IR+Q        + + GP++C+KK   N+ ++   +G+  T+ R   
Sbjct: 131 TEAAVIVPFELIKIRMQD-----VKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNAL 185

Query: 190 GCGTYF-LVYEALIANQMNKRRGLE-RKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVM 247
             G YF ++Y+   +  + K +G + R D+      I GA+ GT   ++  P DV+KS +
Sbjct: 186 WNGGYFGVIYQVRNSMPVAKTKGQKTRNDL------IAGAIGGTVGTMLNTPFDVVKSRI 239

Query: 248 QTDNLQKPKFGNSISSVAK----------TLYANGGIGAFFKGFGPTMLRAAPANGATFA 297
           Q+         +++SS  K           +Y   G  A +KGF P + R AP       
Sbjct: 240 QSV--------DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLV 291

Query: 298 TF 299
            F
Sbjct: 292 VF 293

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 39/89 (43%), Gaps = 7/89 (7%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLAN-------EGPRGFYK 80
           DL+AG  GG    ++  PFD  K R+Q+    ++A++     L +       EG R  YK
Sbjct: 214 DLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYK 273

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHH 109
           G +  +  +    SL   V   M  FF  
Sbjct: 274 GFVPKVCRLAPGGSLMLVVFTGMMNFFRD 302

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 39/92 (42%), Gaps = 10/92 (10%)

Query: 215 KDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTD---------NLQKPKFGNSISSVA 265
           K +P     I GA++G +   ++YPLDV+K+  Q +           Q  ++ N +    
Sbjct: 8   KPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERY-NGVIDCL 66

Query: 266 KTLYANGGIGAFFKGFGPTMLRAAPANGATFA 297
           K +    G    ++G    ML  AP     FA
Sbjct: 67  KKIVKKEGFSRLYRGISSPMLMEAPKRATKFA 98

>Kwal_47.17321
          Length = 881

 Score = 96.3 bits (238), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 128/287 (44%), Gaps = 20/287 (6%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS---STPTTAMEVVRKLLANEGPRGFYKGT 82
           + + L G+  G        P D  K R+Q     S    +++   K+ + EG RG Y G 
Sbjct: 501 IYNFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGIRGIYSGL 560

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIE 142
              L+GV    +++  VN+ +++       D ++ L+LP     G   G       +P+E
Sbjct: 561 GPQLVGVAPEKAIKLTVNDYVRKLL----MDENNRLTLPLEIISGAAAGACQVIFTNPLE 616

Query: 143 HVRIRLQTQTGSGTNAEFKGPLECIKKLRHN--KALLRGLTPTILREGHGCGTYFLVYEA 200
            V+IRLQ ++    +   K  L  +  ++    + L +GL   ++R+      YF  Y  
Sbjct: 617 IVKIRLQVRSEYADSLP-KSQLTALGVVKSLGLRGLYKGLVACLMRDVPFSAIYFPTYAH 675

Query: 201 LIANQMNK--RRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFG 258
           L  +  N   +   +R  +  W+L   G L+G     +  P DVIK+ +Q D    P+ G
Sbjct: 676 LKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQID----PRKG 731

Query: 259 NS----ISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFEL 301
            +    I   A+T+       +FFKG G  +LR++P  G T A +E+
Sbjct: 732 ETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEI 778

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 92.4 bits (228), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 126/286 (44%), Gaps = 21/286 (7%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAME---------VVRKLLANEGPRGFYK 80
           ++G   G+   +V  P D  K RLQ     T   E          +  ++ +EG RG YK
Sbjct: 73  ISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYK 132

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASP 140
           G +  ++G      + F V E  K          SS  S   +    +T G V++ + +P
Sbjct: 133 GLVPIIMGYFPTWMIYFSVYEFCKDNLRTN----SSNWSFVSHSFSAITAGAVSTVVTNP 188

Query: 141 IEHVRIRLQTQTGSGTNA-EFKGPLECIKKLRHN---KALLRGLTPTILREGHGCGTYFL 196
           I  V+ RL  QT  G+N   ++G  +  KK+ +    KAL  GL P++L   H    +F 
Sbjct: 189 IWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLLGLLH-VAIHFP 247

Query: 197 VYEALIANQMNKRRGLERKD--IPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQK 254
           VYE L  +    +R     +  I   +L +  ++S     ++ YP +++++ +Q  +   
Sbjct: 248 VYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLKS-DL 306

Query: 255 PKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           P     +  + K  Y   GI  F+ GFG  + R  PA+  T  +FE
Sbjct: 307 PSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFE 352

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 93.6 bits (231), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 129/293 (44%), Gaps = 32/293 (10%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS---STPTTAMEVVRKLLANEGPRGFYKGT 82
           + +   G+  G     V  P D  K R+Q     S    +++   K+ + EG RG Y G 
Sbjct: 519 IYNFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGIYSGL 578

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIE 142
              LIGV    +++  VN+ M+     ++A++     +      G   G       +P+E
Sbjct: 579 GPQLIGVAPEKAIKLTVNDYMRGRLMDKHANLKWYFEI----LSGACAGACQVVFTNPLE 634

Query: 143 HVRIRLQTQTGSGTNAEFKGP--------LECIKKLRHNKALLRGLTPTILREGHGCGTY 194
            V+IRLQ +      +E+ G         L  IK+L   K L +G+   ++R+      Y
Sbjct: 635 VVKIRLQVR------SEYAGDVLKSQVTALGVIKQLGI-KGLYKGIAACLMRDVPFSAIY 687

Query: 195 FLVYEALIAN--QMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNL 252
           F  Y  L  +  + + +   +R  +  W+L + G L+G     +  P DVIK+ +Q D  
Sbjct: 688 FPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQID-- 745

Query: 253 QKPKFGNS----ISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFEL 301
             P+ G +    I   A+T+       +FFKG    +LR++P  G T A +E+
Sbjct: 746 --PRKGETRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYEI 796

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 82/195 (42%), Gaps = 19/195 (9%)

Query: 19  QHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS--------TPTTAMEVVRKLL 70
           +H N +   ++L+G   G  QV+   P +  K+RLQ  S        +  TA+ V+++L 
Sbjct: 606 KHANLKWYFEILSGACAGACQVVFTNPLEVVKIRLQVRSEYAGDVLKSQVTALGVIKQL- 664

Query: 71  ANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKR-FFHH--RNADMSSTLSLPQYYACG 127
              G +G YKG    L+      ++ F     +K+  F +  ++    + L   +    G
Sbjct: 665 ---GIKGLYKGIAACLMRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAG 721

Query: 128 VTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLEC---IKKLRHNKALLRGLTPTI 184
              G+  ++L +P + ++ RLQ     G    ++G       I K    K+  +G +  +
Sbjct: 722 GLAGMPAAYLTTPFDVIKTRLQIDPRKGE-TRYEGIFHAARTILKEESFKSFFKGGSARV 780

Query: 185 LREGHGCGTYFLVYE 199
           LR     G     YE
Sbjct: 781 LRSSPQFGFTLAAYE 795

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 31/74 (41%), Gaps = 5/74 (6%)

Query: 13  DLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS-----STPTTAMEVVR 67
           D ++  Q +  +  + L+AG   G+    +  PFD  K RLQ       +         R
Sbjct: 702 DPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYEGIFHAAR 761

Query: 68  KLLANEGPRGFYKG 81
            +L  E  + F+KG
Sbjct: 762 TILKEESFKSFFKG 775

>Scas_640.25
          Length = 306

 Score = 90.1 bits (222), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 128/295 (43%), Gaps = 41/295 (13%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----------MEVVRKLLANEGPRG 77
             +AG   GI++++V  P D  K R+Q   +   A          ++ + +++  EGP  
Sbjct: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75

Query: 78  FYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYAC--GVTGGIVNS 135
            YKG  +P++      +++F  N+   + +      +  T  L Q  +   G + GI  +
Sbjct: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWK----SVFGTKQLTQQISVLSGASAGITEA 131

Query: 136 FLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTILREGHGCG 192
            +  P E V+IRLQ       N++FKGP+E +K +      K L  G+  T+ R      
Sbjct: 132 LVIVPFELVKIRLQD-----VNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNA 186

Query: 193 TY----FLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQ 248
            Y    F V E L   +  + +   R D+ A      G + GT   +   P DV+KS +Q
Sbjct: 187 GYFGVIFQVRELLPVAKSKQEK--TRNDLCA------GFVGGTFGVMFNTPFDVVKSRIQ 238

Query: 249 TDNLQ----KPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATF 299
           +D  +      K+  +  SV K +Y   G  A +KGF P +LR  P        F
Sbjct: 239 SDGNEIINGVRKYNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/195 (20%), Positives = 77/195 (39%), Gaps = 14/195 (7%)

Query: 111 NADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSG----TNAEFKGPLEC 166
           N +  + L     +  G   GI    +  P++ V+ R+Q Q  +G    +   +KG ++C
Sbjct: 4   NHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDC 63

Query: 167 IKKLRHNKA---LLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLC 223
           + ++   +    + +G++  +L E       F   +  I      +     K +      
Sbjct: 64  LSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLW---KSVFGTKQLTQQISV 120

Query: 224 IFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGP 283
           + GA +G    L++ P +++K  +Q  N    KF   +  V K +    G+   + G   
Sbjct: 121 LSGASAGITEALVIVPFELVKIRLQDVN---SKFKGPV-EVLKHIIKQDGLKGLYSGVES 176

Query: 284 TMLRAAPANGATFAT 298
           T+ R A  N   F  
Sbjct: 177 TVWRNAVWNAGYFGV 191

>Kwal_47.18216
          Length = 333

 Score = 90.1 bits (222), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 82/316 (25%), Positives = 130/316 (41%), Gaps = 49/316 (15%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA-------MEVVRKLLANEGPRGFYK 80
           +L+AG   G+ + L   P DT KVR+Q  S            +   R +   EG    YK
Sbjct: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLA-S 139
           G    +IG+   ++++F   E  +     R   + ST      +  GV  GI  + +  +
Sbjct: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVST---GNTFVAGVGAGITEAVMVVN 129

Query: 140 PIEHVRIRLQTQ-----------TGS------------------GTNAEFKGPLEC---I 167
           P+E V+IRLQ Q            GS                      +++  ++    I
Sbjct: 130 PMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYVI 189

Query: 168 KKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKD-IPAWKLCIFG 226
            K    +AL RG++ T  R+    G  F VY  L     ++ +   + D +P+W+  + G
Sbjct: 190 VKEEGPRALYRGVSLTAARQATNQGANFTVYSTL----KSRLQEYHQTDMLPSWETSLIG 245

Query: 227 ALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNS-ISSVAKTLYANGGIGAFFKGFGPTM 285
            +SG        PLD IK+ +Q D       G S I ++ + L    G  A +KG  P +
Sbjct: 246 LISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRV 305

Query: 286 LRAAPANGATFATFEL 301
           +R AP    TF  +EL
Sbjct: 306 MRVAPGQAVTFTVYEL 321

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 53/243 (21%), Positives = 89/243 (36%), Gaps = 47/243 (19%)

Query: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQ-VLVGQPFDTTKVRLQ----- 54
           M+  F S +    L    Q          +AG   GI + V+V  P +  K+RLQ     
Sbjct: 85  MAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVR 144

Query: 55  ----------------------------TSSTPT--TAMEVVRKLLANEGPRGFYKGTLT 84
                                        ++TP    A++    ++  EGPR  Y+G   
Sbjct: 145 YVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSL 204

Query: 85  PLIGVGACVSLQFGVNEAMK-RFFHHRNADMSSTLSLPQYYAC--GVTGGIVNSFLASPI 141
                       F V   +K R   +   DM     LP +     G+  G +  F  +P+
Sbjct: 205 TAARQATNQGANFTVYSTLKSRLQEYHQTDM-----LPSWETSLIGLISGALGPFSNAPL 259

Query: 142 EHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTILREGHGCGTYFLVY 198
           + ++ RLQ    +  ++ +   L   ++L      +AL +G+TP ++R   G    F VY
Sbjct: 260 DTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVY 319

Query: 199 EAL 201
           E +
Sbjct: 320 ELI 322

 Score = 35.4 bits (80), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 6/102 (5%)

Query: 10  LIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT------AM 63
           L   L+E+ Q D     +  L G   G        P DT K RLQ   + +        +
Sbjct: 223 LKSRLQEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRIL 282

Query: 64  EVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKR 105
            + R+L+  EG R  YKG    ++ V    ++ F V E +++
Sbjct: 283 AIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324

>Scas_662.12
          Length = 308

 Score = 89.0 bits (219), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 137/307 (44%), Gaps = 32/307 (10%)

Query: 20  HDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAME------VVRKLLAN- 72
           H+   + K++++G + G    L+  P D  KVRLQ  +T TT         ++ +L+ N 
Sbjct: 2   HELTPIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNS 61

Query: 73  -----EGP-----RGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQ 122
                +GP     +  Y+G    L+G     SL F +  + K +    N   ++  ++  
Sbjct: 62  KKMGSQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTI-- 119

Query: 123 YYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRG 179
           +   G+  GI  + L +P+  ++ R+ + T       +K      K L      KA+  G
Sbjct: 120 FLTSGLISGISTTLLTNPLWVIKTRIMS-TSRHHKDSYKSIRHGFKSLLTKEGPKAIWMG 178

Query: 180 LTPTILREGHGCGTYFLVYEAL-IANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVY 238
           L P++L    G   YF++Y+ L +   +N  +  +       K+ +  +LS     + VY
Sbjct: 179 LLPSLLGVSQG-AIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVY 237

Query: 239 PLDVIKSVMQ-----TDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANG 293
           P  ++KS +Q     T+N+  P+      ++ + +Y + GI   +KG    +LRA P+  
Sbjct: 238 PFQLLKSNLQTFRSVTNNI--PQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTC 295

Query: 294 ATFATFE 300
            TF  +E
Sbjct: 296 ITFCIYE 302

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 46/111 (41%), Gaps = 16/111 (14%)

Query: 10  LIDDLEEH-------PQHDNARV-VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT 61
           + D+L+ H        + DNA   +K +L  +   +  V+   PF   K  LQT  + T 
Sbjct: 195 IYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYPFQLLKSNLQTFRSVTN 254

Query: 62  AM--------EVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMK 104
            +         ++RK+  + G +G YKG    L+       + F + E  K
Sbjct: 255 NIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTCITFCIYENFK 305

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 85.9 bits (211), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 83/294 (28%), Positives = 126/294 (42%), Gaps = 32/294 (10%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT-----------TAMEVVRKLLANEGPR 76
           +L+AG   G+ + L   P DT KVR+Q                 T  E+ R    NEG  
Sbjct: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYR----NEGFL 68

Query: 77  GFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSS-TLSLPQYYACGVTGGIVNS 135
            FYKG    +IG+   ++++F   E    F+    AD  +  +S    +  GV  GI  +
Sbjct: 69  AFYKGLGAVVIGITPKMAIRFSSYE----FYRTLLADKETGKVSTGNTFIAGVGAGITEA 124

Query: 136 FLASPIEHV-RIRLQTQTGSGTNA--EFKGPLEC---IKKLRHNKALLRGLTPTILREGH 189
            +      V +IRLQ Q  +      ++K  ++    I K     AL RG++ T  R+  
Sbjct: 125 VVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQAT 184

Query: 190 GCGTYFLVYEALIANQMNKRRGLERKD-IPAWKLCIFGALSGTALWLMVYPLDVIKSVMQ 248
             G  F VY  L        +G   ++ +P+W+  + G +SG        PLD IK+ +Q
Sbjct: 185 NQGANFTVYSKL----KEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ 240

Query: 249 TDNLQKPKFG-NSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFEL 301
            D   K   G   I+ + K L    G  A +KG  P ++R AP    TF  +E 
Sbjct: 241 KDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEF 294

>Scas_709.9
          Length = 365

 Score = 84.7 bits (208), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 126/291 (43%), Gaps = 30/291 (10%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLL-------ANEGPRGFYKGT 82
           L+G   G    ++  P D TK RLQ     +      R +L        +EG RG YKG 
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGL 128

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHHR--NADMSSTLSLPQYYAC-GVTGGIVNSFLAS 139
           +  ++G      + F V E  K  +     N+D  S       ++C  +T G  ++ L +
Sbjct: 129 IPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFIS-------HSCSAITAGAASTVLTN 181

Query: 140 PIEHVRIRLQTQTGSG-TNAEFKGPLECIKKLRHN---KALLRGLTPTILREGHGCGTYF 195
           PI  V+ RL  QT  G +   ++G ++  KK+      + L  GL P++    H    +F
Sbjct: 182 PIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGLLH-VAIHF 240

Query: 196 LVYEALI----ANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQ--T 249
            VYE L      + +      +   +   +L I  + S     ++ YP +++++ MQ  +
Sbjct: 241 PVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKS 300

Query: 250 DNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           D L   K  + +  + K  Y   G+  F+ GF   +LR  PA+  T  +FE
Sbjct: 301 DKLLISK--HKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFE 349

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 127/324 (39%), Gaps = 57/324 (17%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQ------------------------------- 54
           V +L+AG   G+ + L   P DT KVR+Q                               
Sbjct: 12  VVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGG 71

Query: 55  ---TSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRN 111
               +  P   +   R + A EG    YKG    +IG+   ++++F   E  +     + 
Sbjct: 72  DATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADKQ 131

Query: 112 ADMSSTLSLPQYYACGVTGGIVNSFLA-SPIEHVRIRLQTQ---------TGSGTNAEFK 161
             + ST +    +  GV  G+  + L  +P+E V+IRLQ Q             TNA   
Sbjct: 132 TGVVSTSNT---FIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQA 188

Query: 162 GPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWK 221
           G    I K     AL RG++ T  R+    G  F VY  L    + +  G E   +P+W+
Sbjct: 189 G--YTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKL-REFLQEYHGTE--TLPSWE 243

Query: 222 LCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNS----ISSVAKTLYANGGIGAF 277
               G +SG        PLD IK+ +Q D     K G S    I+ +   L    G  A 
Sbjct: 244 TSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTSFK-GESGWKRIAHIGTQLLKEEGFRAL 302

Query: 278 FKGFGPTMLRAAPANGATFATFEL 301
           +KG  P ++R AP    TF  +E 
Sbjct: 303 YKGITPRVMRVAPGQAVTFTVYEF 326

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 8/73 (10%)

Query: 45  PFDTTKVRLQTSSTPTTAME--------VVRKLLANEGPRGFYKGTLTPLIGVGACVSLQ 96
           P DT K RLQ   + +   E        +  +LL  EG R  YKG    ++ V    ++ 
Sbjct: 261 PLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAVT 320

Query: 97  FGVNEAMKRFFHH 109
           F V E ++R   +
Sbjct: 321 FTVYEFVRRHLEN 333

>Scas_589.10
          Length = 316

 Score = 82.0 bits (201), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 81/317 (25%), Positives = 133/317 (41%), Gaps = 60/317 (18%)

Query: 23  ARVVKD---------LLAGTAGGIAQVLVGQPFDTTKVRLQ---------TSSTP----- 59
           AR+ KD          ++G   G+++ ++  P D  K R Q         TSS       
Sbjct: 2   ARIDKDPVKLPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQP 61

Query: 60  --TTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNE-----AMKRFFHHRNA 112
             ++ +  + K+L  EG +  YKG   PL+      +++F  NE      MK+F   +  
Sbjct: 62  EHSSILSCLSKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKF---KLK 118

Query: 113 DMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRH 172
           +++ST++L      G   GI  S +  P E V+IRLQ        ++++ P+ C + +  
Sbjct: 119 EVTSTVTL----LAGTFAGITESLIVVPFELVKIRLQ-----DAQSDYRSPIRCTRTIIE 169

Query: 173 NKALL---RGLTPTILREGHGCGTYF-LVYEALI----ANQMNKRRGLERKDIPAWKLCI 224
           N+ L     G   TI R      +YF L+++       A    K +G+ R D       +
Sbjct: 170 NQGLFGIYAGFESTIWRNTIWNASYFGLIFQVKKFIPRAKSTTKFQGI-RNDF------L 222

Query: 225 FGALSGTALWLMVYPLDVIKSVMQTDNLQKPK--FGNSISSVAKTLYANGGIGAFFKGFG 282
            GA++G     +  P DV+K+ MQ          +G +  SV   +Y   GI   +KG  
Sbjct: 223 VGAIAGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVF-LIYRTEGIKGIYKGIL 281

Query: 283 PTMLRAAPANGATFATF 299
           P + R  P  G     F
Sbjct: 282 PIICRYGPGGGLLLVVF 298

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 82/177 (46%), Gaps = 5/177 (2%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTS-STPTTAMEVVRKLLANEGPRGFYKGTLTPLI 87
           LLAGT  GI + L+  PF+  K+RLQ + S   + +   R ++ N+G  G Y G  + + 
Sbjct: 126 LLAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYAGFESTIW 185

Query: 88  GVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIR 147
                 +  FG+   +K+F   R    +    +   +  G   G ++ FL+ P + V+ R
Sbjct: 186 RNTIWNASYFGLIFQVKKFI-PRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTR 244

Query: 148 LQ--TQTGSGTNAEFKG-PLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEAL 201
           +Q   +T SG    +    +  I +    K + +G+ P I R G G G   +V+  +
Sbjct: 245 MQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGPGGGLLLVVFNGV 301

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 41/93 (44%), Gaps = 12/93 (12%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM------EVVRKLLANEGPRGFYKG 81
           D L G   G     +  PFD  K R+Q S   ++ M      + V  +   EG +G YKG
Sbjct: 220 DFLVGAIAGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKG 279

Query: 82  TLTPLI-----GVGACVSLQFGVNEAMKRFFHH 109
            L P+I     G G  + +  GVNE  +   H+
Sbjct: 280 IL-PIICRYGPGGGLLLVVFNGVNELFRMSDHY 311

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 11/88 (12%)

Query: 224 IFGALSGTALWLMVYPLDVIKSVMQ---------TDNLQKPK--FGNSISSVAKTLYANG 272
           I GA++G +  +M+YPLDV+K+  Q         T ++  PK    +SI S    +    
Sbjct: 18  ISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKEE 77

Query: 273 GIGAFFKGFGPTMLRAAPANGATFATFE 300
           G    +KG  P +L   P     FA+ E
Sbjct: 78  GFKNLYKGMSPPLLMEVPKRAVKFASNE 105

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 131/309 (42%), Gaps = 35/309 (11%)

Query: 20  HDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST--------PTTAMEVVRKLLA 71
           H    + K++++G + G    LV  P D  KVRLQ S+T        P   ++ + +  A
Sbjct: 4   HQWTPLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSA 63

Query: 72  NEG---PRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSST----------L 118
           N G       Y+G    L G      + FG+    K   +   A    T          +
Sbjct: 64  NSGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKM 123

Query: 119 SLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KA 175
           +   Y + G + G++ + L +PI  ++ R+ + T  G    +      +++L      + 
Sbjct: 124 NSLIYLSAGASSGLMTAILTNPIWVIKTRIMS-TSKGAQGAYTSMYNGVQQLLRTDGFQG 182

Query: 176 LLRGLTPTILREGHGCGTYFLVYEALIANQMNKRR--GLE--RKDIPAWKLCIFGALSGT 231
           L +GL P +     G   YF VY+ L   ++ ++R  GL+    ++   ++   G +   
Sbjct: 183 LWKGLVPALFGVSQGA-LYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSV 241

Query: 232 ALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPA 291
            L   VYP  ++KS +Q+    + KF   +  + K + AN G    +KG    ++RA P+
Sbjct: 242 TL---VYPFQLLKSNLQSFRANEQKF--RLFPLIKLIIANDGFVGLYKGLSANLVRAIPS 296

Query: 292 NGATFATFE 300
              TF  +E
Sbjct: 297 TCITFCVYE 305

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 80.1 bits (196), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 76/297 (25%), Positives = 129/297 (43%), Gaps = 39/297 (13%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT--------AMEVVRKLLANEGPRG 77
           +   ++G A G++++LV  P D  K R+Q      T         ++ + +++  EG   
Sbjct: 9   IYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSR 68

Query: 78  FYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYAC--GVTGGIVNS 135
            YKG  +P++      + +F  N++ ++ F     D+     L Q  +   G   G+  +
Sbjct: 69  LYKGISSPMLMEAPKRATKFACNDSYQKMFK----DLYGVDKLTQQISILSGSLAGVTEA 124

Query: 136 FLASPIEHVRIRLQTQTGSGTNAEFKGPLECI-KKLRHNK--ALLRGLTPTILREGHGCG 192
            +  P E V+IRLQ       N++F GP+E + K +R     +L  GL  T+ R     G
Sbjct: 125 CVIVPFELVKIRLQD-----VNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNG 179

Query: 193 TYFLVYEALIANQMNKRRGLER--KDIPAWKLCIFGALSGTALWLMVYP-LDVIKSVMQT 249
            YF V   + A     +   E+   D+ A      G + G   +   +  L V+KS +Q+
Sbjct: 180 GYFGVIFQIRALLPKAKTNTEKTTNDLIA------GTIGGYCRYSTEHTILSVVKSRIQS 233

Query: 250 -------DNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATF 299
                  D    PK+  +  S+ K +Y+  G  A +KGF P +LR  P  G     F
Sbjct: 234 GATTTLADGTVVPKYNWTWPSLFK-IYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 38/89 (42%), Gaps = 3/89 (3%)

Query: 212 LERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTL--- 268
           +  K +P     + GA +G +  L++YPLDV+K+ MQ         G + + V   L   
Sbjct: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQI 60

Query: 269 YANGGIGAFFKGFGPTMLRAAPANGATFA 297
               G    +KG    ML  AP     FA
Sbjct: 61  VKREGFSRLYKGISSPMLMEAPKRATKFA 89

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 42/111 (37%), Gaps = 12/111 (10%)

Query: 11  IDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQP-FDTTKVRLQTSSTPTTAMEVVR-- 67
           I  L    + +  +   DL+AGT GG  +           K R+Q+ +T T A   V   
Sbjct: 188 IRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPK 247

Query: 68  ---------KLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHH 109
                    K+ + EG    YKG +  ++ +G    +   V   M  FF  
Sbjct: 248 YNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQE 298

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 78.6 bits (192), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 129/294 (43%), Gaps = 26/294 (8%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAMEVVRKLLAN-----EGPRGF 78
           K++++G   G    +V  P D  K+RLQ ++    P++    V++++ +     +  +  
Sbjct: 14  KEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKEA 73

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNAD------------MSSTLSLPQYYAC 126
           Y+G    +IG      L FG+    K   +  +++            M+S++    Y   
Sbjct: 74  YRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSM----YLVS 129

Query: 127 GVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILR 186
               G+  + L +P+  ++ R+ +   S         +  I      K   RGL P++  
Sbjct: 130 AGASGLATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEEGLKTFWRGLVPSLFG 189

Query: 187 EGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSV 246
              G   YF +Y+ L    ++ R  ++ + + A +     +LS       VYPL ++K+ 
Sbjct: 190 VTQGA-LYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLLKTN 248

Query: 247 MQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           +QT   +  +  + ++S+ ++++   GI  F+KG    ++RA P+   TF  +E
Sbjct: 249 LQTFRTEHNE-NSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVYE 301

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 25/66 (37%), Gaps = 4/66 (6%)

Query: 45  PFDTTKVRLQTSSTP----TTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVN 100
           P    K  LQT  T     +    ++R +    G  GFYKG    L+       + FGV 
Sbjct: 241 PLQLLKTNLQTFRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVY 300

Query: 101 EAMKRF 106
           E  K  
Sbjct: 301 EHFKHI 306

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 129/290 (44%), Gaps = 32/290 (11%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM-------EVVRKLLANEGPRGFY 79
           K++++G   G    L+  P D  KVRLQ   T TT         E+V   L+    R  Y
Sbjct: 10  KEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLS--LTRELY 67

Query: 80  KGTLTPLIGVGACVSLQFGVNEAMKRF---FHHR---NADMSSTLSLPQYYACGVTGGIV 133
           +G    L+G      L F      K +   ++HR   + D+SS +    Y +   + G++
Sbjct: 68  RGLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWM----YLSASASSGML 123

Query: 134 NSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTILREGHG 190
            + L +P+  ++ R+ ++  S   +     ++ ++ L  N   + L +GL P ++    G
Sbjct: 124 TTVLTNPLWVIKTRMMSKANSDLTS-----MKVLRDLIKNDGVQGLWKGLVPALVGVSQG 178

Query: 191 CGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTD 250
              +F  Y+ L    + K R  +  +I   +     ++S       VYP  ++KS +Q+ 
Sbjct: 179 -ALHFTCYDTLKHKLVLKNR--DSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQSF 235

Query: 251 NLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
              +  F   +  ++K +Y+  G+  F+KG    +LR+ P+   TF  +E
Sbjct: 236 QASENDF--KLLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYE 283

>Scas_379.2
          Length = 301

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 120/299 (40%), Gaps = 25/299 (8%)

Query: 13  DLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA--MEVVRKLL 70
           D E  P  D+A +   LLAG   GI +  V  P D  K R+Q++S  +T+  +  + K+ 
Sbjct: 13  DYEALP--DSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKIS 70

Query: 71  ANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTG 130
             EG    +KG  + ++G G   ++ F   E  K++      DM +   L    + G   
Sbjct: 71  TAEGSLALWKGVQSVILGAGPAHAVYFATYEYTKKYLIDEK-DMQTHQPLKTALS-GTVA 128

Query: 131 GIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHG 190
            I    L +P + ++ R+Q      TN       + I K     A       T+      
Sbjct: 129 TIAADALMNPFDTLKQRMQL----NTNTTVWNVTKQIYKNEGFSAFYYSYPTTLAMNIPF 184

Query: 191 CGTYFLVYEALIA--NQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQ 248
               F++YE+     N  N    L          C+ G LSG     +  PLD IK+V+Q
Sbjct: 185 AAFNFMIYESATKFFNPTNDYNPLVH--------CLSGGLSGATCAAITTPLDCIKTVLQ 236

Query: 249 -----TDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELA 302
                + +LQ  K  N+     K +Y   G   F++G  P +    PA    +  +E A
Sbjct: 237 VRGSESVSLQVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYECA 295

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 77.4 bits (189), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 78/325 (24%), Positives = 136/325 (41%), Gaps = 65/325 (20%)

Query: 25  VVKDLLAG-TAGGIAQVLVGQPFDTTKVRLQTSSTPTTA---------MEVVRKLLANEG 74
           +VK  LAG  AG  A+ LV  P D  K+  QTS+ P  A         +   + ++A++G
Sbjct: 19  IVKSGLAGGIAGSCAKTLVA-PLDRIKILFQTSN-PQFAQFAGSMGGLVRASKYIMAHDG 76

Query: 75  PRGFYKGTLTPLIGVGACVSLQFGVNEAMK-------RFFHHRNADMSSTLSLPQYYACG 127
           PRGF++G    L+ +    +++F   E ++       R   H    +S +L+        
Sbjct: 77  PRGFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWRRLLSGSLA-------- 128

Query: 128 VTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKAL----------- 176
              G+ + F+  P++ VR+RL   T    +A+ +  + CI   R ++AL           
Sbjct: 129 ---GLCSVFVTYPLDLVRVRLAYVT-ERHDAKVRKIMACIYNERPSEALRKWYIPQWFAH 184

Query: 177 ----LRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLE-------------RKDIP- 218
                RG TPT++      G  F  ++  +   + +   LE              + +P 
Sbjct: 185 WSNFYRGYTPTVIGMIPYAGVSFFAHD--LCQDIFRHPMLEPYSVLSPGGSSAYDRTVPL 242

Query: 219 -AWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKP--KFGNSISSVAKTLYANGGIG 275
             W   + G L+G A     YP ++I+  +Q   +  P  +    I+ +AK +Y  GG  
Sbjct: 243 KTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWR 302

Query: 276 AFFKGFGPTMLRAAPANGATFATFE 300
            FF G     ++  P    +F  +E
Sbjct: 303 GFFVGLSIGYIKVTPMVACSFFIYE 327

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 77/328 (23%), Positives = 138/328 (42%), Gaps = 35/328 (10%)

Query: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           M+E     +  + +++  + D+   +  L  G AG +++ +V  PF+  K+ LQ  S+ T
Sbjct: 1   MAEVLTVLEQPNSIKDFLKQDSN--IAFLAGGVAGAVSRTVV-SPFERVKILLQVQSSTT 57

Query: 61  T----AMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAM-KRFFHHRNADMS 115
           +        +R++   EG +G ++G     I +    ++QF V EA  K+ FH    +  
Sbjct: 58  SYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQ 117

Query: 116 STLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTG-------SGTNAEFKGP----- 163
             L+  Q    G   G  +     P++ ++ RL  QT        S   +  K P     
Sbjct: 118 EQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQL 177

Query: 164 LECIKKLRHN-KALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDI-PAWK 221
           L    +L    + L RG+ PT L         F VYE L      +  G+   D  P+WK
Sbjct: 178 LSETYRLEGGLRGLYRGVWPTSLGVVPYVALNFAVYEQL------REFGVNSSDAQPSWK 231

Query: 222 LCIF----GALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANG---GI 274
             ++    GA+SG     + YP D+++   Q   +   + G   +SV   L   G   G+
Sbjct: 232 SNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGV 291

Query: 275 GAFFKGFGPTMLRAAPANGATFATFELA 302
             ++KG    + +  P+   ++  +E+ 
Sbjct: 292 SGYYKGLAANLFKVVPSTAVSWLVYEVV 319

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 128/323 (39%), Gaps = 53/323 (16%)

Query: 25  VVKDLLAG-TAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM--------EVVRKLLANEGP 75
           VV+  LAG  +G  A+ L+  P D  K+  QTS+   +          E  + +  N+G 
Sbjct: 18  VVRSGLAGGVSGSCAKTLIA-PLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGI 76

Query: 76  RGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNS 135
           RGF++G    L+ +    +++F   E ++          S    L    A G   G+ + 
Sbjct: 77  RGFFQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRRL----ASGSLAGLCSV 132

Query: 136 FLASPIEHVRIRLQTQTGSGTNAEFKGPLECI----------------KKLRHNKALLRG 179
           F+  P++  R+RL   T      + +  ++ I                K   H     RG
Sbjct: 133 FITYPLDLTRVRLAYVT-EHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRG 191

Query: 180 LTPTILREGHGCGTYFLVYE--------ALIA----NQMNKRRGLERKDIP------AWK 221
             PT+L      G  F  ++        +L+A     Q++ +  LERK +        W 
Sbjct: 192 YVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTWA 251

Query: 222 LCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGN----SISSVAKTLYANGGIGAF 277
             + G LSG       YPL++I+  +Q   L   K  +    SISS+A+ +Y   G   F
Sbjct: 252 ELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGF 311

Query: 278 FKGFGPTMLRAAPANGATFATFE 300
           F G     ++  P    +F  +E
Sbjct: 312 FVGLSIGYIKVTPMVACSFFVYE 334

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 81/198 (40%), Gaps = 30/198 (15%)

Query: 125 ACGVTGGIVNSFLASPIEHVRIRLQTQT--GSGTNAEFKGPLECIKKLRHN---KALLRG 179
           A GV+G    + +A P++ ++I  QT     S       G  E  K +  N   +   +G
Sbjct: 24  AGGVSGSCAKTLIA-PLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQG 82

Query: 180 LTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYP 239
            + T+LR        F+ YE  I + +   R  E      W+    G+L+G     + YP
Sbjct: 83  HSVTLLRIFPYAAVKFVAYEQ-IRSILIPSREYESH----WRRLASGSLAGLCSVFITYP 137

Query: 240 LDVIKSVMQTDNLQKPKFGNSISSVAKTLY---ANGGIGA-------------FFKGFGP 283
           LD+ +  +      K      +  + KT+Y   A+ G+ +             F++G+ P
Sbjct: 138 LDLTRVRLAYVTEHK---RVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVP 194

Query: 284 TMLRAAPANGATFATFEL 301
           T+L   P  G +F   +L
Sbjct: 195 TVLGMIPYAGVSFFAHDL 212

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 37/95 (38%), Gaps = 9/95 (9%)

Query: 19  QHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM---------EVVRKL 69
           Q    R   +L+AG   GI       P +  + RLQ S+     M          + R +
Sbjct: 243 QKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARII 302

Query: 70  LANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMK 104
              +G RGF+ G     I V   V+  F V E MK
Sbjct: 303 YQEKGWRGFFVGLSIGYIKVTPMVACSFFVYERMK 337

>Kwal_23.4731
          Length = 314

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 131/297 (44%), Gaps = 26/297 (8%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA---MEVVRKLLANEGP-----RGF 78
           ++++AG A G    +   P D  K+RLQ     T +    EV++ ++ +        R  
Sbjct: 15  REIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFREA 74

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRF-FHHRNADMSS-TLSLPQ---------YYACG 127
           Y+G    LIG      L FG+    K   + +  A M + T S  Q         Y A  
Sbjct: 75  YRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASA 134

Query: 128 VTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKAL---LRGLTPTI 184
              G+  + L +PI  ++ R+ + T S  +  +K   + I+K+  ++      RGL P++
Sbjct: 135 ALSGLGTAILTNPIWVIKTRIMS-TSSQASERYKTTWDGIRKVYAHEGFSGFWRGLVPSL 193

Query: 185 LREGHGCGTYFLVYEALIANQMNKRRGL-ERKDIPAWKLCIFGALSGTALWLMVYPLDVI 243
                G   YF +Y++L  +Q   RRG+ E + +   +     ++S       VYP  ++
Sbjct: 194 FGVAQGA-IYFTIYDSL-RHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAVYPFQLL 251

Query: 244 KSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           KS +Q+    + +      ++ K+++   G+   +KG    +LRA P+   TF  +E
Sbjct: 252 KSNLQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITFCIYE 308

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 74.7 bits (182), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 73/315 (23%), Positives = 122/315 (38%), Gaps = 42/315 (13%)

Query: 8   PQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST--------- 58
           P+L  D E  P+  NA +V  L AG   GI +  +  P D  K R+Q  ST         
Sbjct: 4   PEL--DYEALPE--NAPLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRL 59

Query: 59  PTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMK-RFFHHRNADMSST 117
           P+  +  + K+   EG    +KG  + ++G G   ++ F   E  K R     +      
Sbjct: 60  PSNMLAQIAKISTTEGSLALWKGVQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTHQP 119

Query: 118 LSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK--- 174
           L   +    G    +    L +P + ++ RLQ               +C  ++   +   
Sbjct: 120 L---KTALSGTLATVAADALMNPFDTIKQRLQLHPSDSMT-------KCAVRMYQREGIA 169

Query: 175 ALLRGLTPTILREGHGCGTYFLVYEAL--IANQMNKRRGLERKDIPAWKLCIFGALSGTA 232
           A       TI          F++YE+   I N  N            W  C+ G +SG  
Sbjct: 170 AFFYSYPTTIAMNIPFAALNFVIYESSTKIFNPSNNYN--------PWIHCLCGGISGAT 221

Query: 233 LWLMVYPLDVIKSVMQ---TDNLQKPKF--GNSISSVAKTLYANGGIGAFFKGFGPTMLR 287
              +  PLD +K+V+Q    D++Q   F   ++    A  ++   G   FF+G  P ++ 
Sbjct: 222 CAAITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIIS 281

Query: 288 AAPANGATFATFELA 302
             PA   ++ ++E A
Sbjct: 282 NMPATAISWTSYEFA 296

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 74.3 bits (181), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 119/283 (42%), Gaps = 29/283 (10%)

Query: 21  DNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYK 80
           D++  +  L +G A G +  L   P DT K RLQ                AN G +G Y+
Sbjct: 2   DSSSFLVSLASGAAAGTSTDLAFFPIDTLKTRLQAKG----------GFFANGGYKGVYR 51

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRF-------FHHRNADMSSTLSLPQYYACGVTGGIV 133
           G  + +I      SL F   ++MK +       +   N  M+ TLS    ++  + G + 
Sbjct: 52  GLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLS--HMFSSSI-GEVS 108

Query: 134 NSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGT 193
              +  P E ++ R QT   + +   F   L+        + L RG   TI+RE      
Sbjct: 109 ACLVRVPAEVIKQRTQTHKTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCI 168

Query: 194 YFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQ 253
            F +YE  +     KR G  +  +  W+  + G+++G        PLDV+K+ +   +  
Sbjct: 169 QFPLYE-FLKKTWAKRNG--QDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLMLSHKS 225

Query: 254 KPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATF 296
            P     ++ +AK +YA  G   FF G GP  +  + A GA F
Sbjct: 226 IP-----VAQLAKNIYAEEGFKVFFSGVGPRTMWIS-AGGAIF 262

 Score = 33.5 bits (75), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 35/75 (46%), Gaps = 15/75 (20%)

Query: 226 GALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTM 285
           GA +GT+  L  +P+D +K+ +Q                    +ANGG    ++G G  +
Sbjct: 13  GAAAGTSTDLAFFPIDTLKTRLQAKG---------------GFFANGGYKGVYRGLGSAV 57

Query: 286 LRAAPANGATFATFE 300
           + +AP+    F +++
Sbjct: 58  IASAPSASLFFVSYD 72

>Kwal_55.20868
          Length = 380

 Score = 74.7 bits (182), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 124/295 (42%), Gaps = 33/295 (11%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTS---STPTTAME----VVRKLLANEGPRGFYKGT 82
           L+G   G    +   P D  K RLQ     S P+   +     +  ++ +EG RG YKG 
Sbjct: 80  LSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGL 139

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIE 142
           +  ++G      + F V E  K+ +      +  +     + A  +T G V++ L +P+ 
Sbjct: 140 VPIIMGYFPTWMIYFSVYERSKKLY----PRIFPSFDFISHSASALTAGTVSTILTNPVW 195

Query: 143 HVRIRLQTQTGSGTNA-EFKGPLECIKKLRHNKAL---LRGLTPTILREGHGCGTYFLVY 198
            V+ RL  QT    N+  +    +   K+   + L     GL P++L   H    +F +Y
Sbjct: 196 VVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGLFH-VAIHFPIY 254

Query: 199 EAL-----IANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQ----- 248
           E L         M++    E  ++   +L I  + S      + YP +++++ MQ     
Sbjct: 255 EKLKVWLHCTPSMSRT---EDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKAYP 311

Query: 249 TD---NLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           TD    LQK      I  +  T Y + G+  F+ GF   + R  PA+  T  +FE
Sbjct: 312 TDPLAALQKTSRHGLIRLIKHT-YKSEGLRGFYSGFTANLARTLPASAITLVSFE 365

>Kwal_0.232
          Length = 274

 Score = 73.6 bits (179), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 113/287 (39%), Gaps = 37/287 (12%)

Query: 21  DNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYK 80
           D +  +  LLAG A G +  L   P DT K RLQ +              AN G  G Y+
Sbjct: 2   DRSSFITSLLAGAAAGTSTDLFFFPIDTLKTRLQAAG----------GFFANGGYLGVYR 51

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRF----FHHRNADMSSTLSLPQYYACGVTGGIVNSF 136
           G  + ++      SL F   + MK +    F++             +      G I    
Sbjct: 52  GLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAACM 111

Query: 137 LASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN-------KALLRGLTPTILREGH 189
           +  P E ++ R QT     +       L+ +KKL  N       + L RG + T++RE  
Sbjct: 112 VRVPAEVIKQRTQTHKSDSS-------LQTLKKLLQNENGEGIRRNLYRGWSTTVMREIP 164

Query: 190 GCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQT 249
                F +YE  +  Q     G  R+ +  W+    G ++G        PLDV+K+ +  
Sbjct: 165 FTCIQFPLYE-FLKKQWAISGG--REQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLML 221

Query: 250 DNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATF 296
            +   P     +  +A+ +YA  G   FF G GP  +  + A GA F
Sbjct: 222 SHTSVP-----VLHLARQIYATEGWKVFFSGVGPRTVWIS-AGGAIF 262

 Score = 35.8 bits (81), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 34  AGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACV 93
           AGGIA      P D  K RL  S T    + + R++ A EG + F+ G     + + A  
Sbjct: 201 AGGIAAATT-TPLDVLKTRLMLSHTSVPVLHLARQIYATEGWKVFFSGVGPRTVWISAGG 259

Query: 94  SLQFGVNEAM 103
           ++  GV E +
Sbjct: 260 AIFLGVYETV 269

 Score = 35.0 bits (79), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 15/75 (20%)

Query: 226 GALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTM 285
           GA +GT+  L  +P+D +K+ +Q                A   +ANGG    ++G G  +
Sbjct: 13  GAAAGTSTDLFFFPIDTLKTRLQ---------------AAGGFFANGGYLGVYRGLGSAV 57

Query: 286 LRAAPANGATFATFE 300
           + +AP+    F T++
Sbjct: 58  VASAPSASLFFVTYD 72

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 73.9 bits (180), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 71/312 (22%), Positives = 133/312 (42%), Gaps = 39/312 (12%)

Query: 8   PQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----M 63
           P  + D E  P H  A +   L+AG   GI +  V  P D  K R+Q+++  + +    +
Sbjct: 18  PMDLPDYEALPTH--APLYHQLIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNML 75

Query: 64  EVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQY 123
             +  +  +EG    +KG  + ++G G   ++ FG  E     F  +N   SS       
Sbjct: 76  SQISHISTSEGTLALWKGVQSVILGAGPAHAVYFGTYE-----FCKKNLIDSSDTQTHHP 130

Query: 124 YACGVTGGIVNSF---LASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKAL--LR 178
           +   ++G    +    L +P + ++ R+Q  T +          +  K++  ++ L    
Sbjct: 131 FKTAISGACATTASDALMNPFDTIKQRIQLNTSASV-------WQTTKQIYQSEGLAAFY 183

Query: 179 GLTPTILREGHGCGTY-FLVYEALIA--NQMNKRRGLERKDIPAWKLCIFGALSGTALWL 235
              PT L        + F++YE+     N  N+   L          C+ G++SG+    
Sbjct: 184 YSYPTTLVMNIPFAAFNFVIYESSTKFLNPSNEYNPLIH--------CLCGSISGSTCAA 235

Query: 236 MVYPLDVIKSVM-----QTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAP 290
           +  PLD IK+V+     QT +L+  +  ++ S  A  +Y   G   F++G+ P ++   P
Sbjct: 236 ITTPLDCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMP 295

Query: 291 ANGATFATFELA 302
           A   ++  +E A
Sbjct: 296 ATAISWTAYECA 307

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 72.0 bits (175), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 74/320 (23%), Positives = 125/320 (39%), Gaps = 56/320 (17%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA--------MEVVRKLLANEGPRGFYK 80
           L  G +G  A+ L+  P D  K+  QTS+   T         +E  + +  N+G RGF++
Sbjct: 38  LAGGISGSCAKTLIA-PLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQ 96

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTL--SLPQYYACGVTGGIVNSFLA 138
           G    L+ +    +++F   E +      RN  + S    S  +    G   G+ + F+ 
Sbjct: 97  GHSATLLRIFPYAAVKFVAYEQI------RNTLIPSKEFESHWRRLVSGSLAGLCSVFIT 150

Query: 139 SPIEHVRIRLQTQT-------GSGTNAEFKGPLEC--IKK------LRHNKALLRGLTPT 183
            P++ VR+RL  +T       G      +K P     IK         H     RG  PT
Sbjct: 151 YPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPT 210

Query: 184 ILREGHGCGTYFLVYEALIA------------------NQMNKRRGLERKDIPAWKLCIF 225
           +L      G  F  ++ L                    +++ + +  +R+ +  W   I 
Sbjct: 211 VLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAELIS 270

Query: 226 GALSGTALWLMVYPLDVIKSVMQTDNLQ-----KPKFGNSISSVAKTLYANGGIGAFFKG 280
           G L+G A     YP ++I+  +Q   L        KF  SIS +A  ++   G+  FF G
Sbjct: 271 GGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKF-QSISEIAHIIFKERGVRGFFVG 329

Query: 281 FGPTMLRAAPANGATFATFE 300
                ++  P    +F  +E
Sbjct: 330 LSIGYIKVTPMVACSFFVYE 349

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 83/195 (42%), Gaps = 24/195 (12%)

Query: 125 ACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTN--AEFKGPLECIKKLRHN---KALLRG 179
           A G++G    + +A P++ ++I  QT     T       G +E  K +  N   +   +G
Sbjct: 39  AGGISGSCAKTLIA-PLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQG 97

Query: 180 LTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYP 239
            + T+LR        F+ YE  I N +   +  E      W+  + G+L+G     + YP
Sbjct: 98  HSATLLRIFPYAAVKFVAYEQ-IRNTLIPSKEFESH----WRRLVSGSLAGLCSVFITYP 152

Query: 240 LDVIKSVMQTDNLQKP-KFGNSISSVAK-----TLYANGGI-------GAFFKGFGPTML 286
           LD+++  +  +   K  K G  I  + K     TL  N  I         F++G+ PT+L
Sbjct: 153 LDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPTVL 212

Query: 287 RAAPANGATFATFEL 301
              P  G +F   +L
Sbjct: 213 GMIPYAGVSFFAHDL 227

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 44/107 (41%), Gaps = 11/107 (10%)

Query: 12  DDLE--EHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM------ 63
           D+LE  +  Q    R   +L++G   G+A      PF+  + RLQ S+     M      
Sbjct: 249 DELERVQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQ 308

Query: 64  ---EVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFF 107
              E+   +    G RGF+ G     I V   V+  F V E MK  F
Sbjct: 309 SISEIAHIIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYERMKWNF 355

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 71.2 bits (173), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 133/300 (44%), Gaps = 34/300 (11%)

Query: 20  HDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS---TPTTAMEVVRKLLA-NEGP 75
           H+   + +++++G   G    +   P D  K+RLQ S+     TT   ++R +    +  
Sbjct: 3   HELTSLQREVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLIRDIFERQQWG 62

Query: 76  RGFYKGTLTPLIGVGACVSLQFGVNEAMK----RFFHHRNAD--MSSTLSLPQYYACGVT 129
           R  Y+G    L+G     +L FG     K    R   + +A   M   L    Y     +
Sbjct: 63  RELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGS 122

Query: 130 GGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALL---RGLTPTILR 186
            GI  + L +PI  ++ R+   + +G    +K   + + KL   + +L   RG+ P++L 
Sbjct: 123 SGIATAVLTNPIWVIKTRIMATSRAG---PYKSTFDGVYKLYQTEGVLAFWRGVVPSLLG 179

Query: 187 EGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKL----CIFGALSGTALWLMVYPLDV 242
              G   YF +Y+ L  + ++       + +   ++    CI   +S T+    VYP  +
Sbjct: 180 VSQG-AIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTS----VYPFQL 234

Query: 243 IKSVMQTDNLQKPKFG--NSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           +KS +Q        FG  + I+ + +T+Y+  GI  F++G    +LRA PA   TF  +E
Sbjct: 235 LKSKLQ-------DFGAPSGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYE 287

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%)

Query: 45  PFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMK 104
           PF   K +LQ    P+   ++V+ + + EG RGFY+G    L+       + F V E +K
Sbjct: 231 PFQLLKSKLQDFGAPSGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYENIK 290

>Scas_717.20
          Length = 356

 Score = 71.6 bits (174), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 73/326 (22%), Positives = 123/326 (37%), Gaps = 68/326 (20%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM--------EVVRKLLANEGPRGFYK 80
           L  G +G  A+ L+  P D  K+  QTS+   T          E  + +  N+G RGF++
Sbjct: 37  LAGGISGSCAKTLIA-PLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQ 95

Query: 81  GTLTPLIGVGACVSLQFGVNEAM-------KRFFHHRNADMSSTLSLPQYYACGVTGGIV 133
           G    L+ +    +++F   E +       K +  H    MS +L+           G+ 
Sbjct: 96  GHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYESHWRRLMSGSLA-----------GLC 144

Query: 134 NSFLASPIEHVRIRLQTQTG-----------------SGTNAEFKGPLECIKKLRHNKAL 176
           + F   P++ +R+RL   T                  + T  E KG +       H    
Sbjct: 145 SVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIP--NWFAHWCNF 202

Query: 177 LRGLTPTILREGHGCGTYFLVYEAL----------------IANQMNKRRGLERKDIP-- 218
            RG TPT+L      G  F  ++ L                ++    + R  + + +P  
Sbjct: 203 YRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRLPLR 262

Query: 219 AWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGN----SISSVAKTLYANGGI 274
            W   + G L+G A     YP ++I+  +Q   L   +  +    SIS +AK +Y   G 
Sbjct: 263 TWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGW 322

Query: 275 GAFFKGFGPTMLRAAPANGATFATFE 300
             FF G     ++  P    +F  +E
Sbjct: 323 RGFFVGLSIGYIKVTPMVACSFFVYE 348

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 43/101 (42%), Gaps = 11/101 (10%)

Query: 15  EEHPQHDNA--RVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM--------- 63
           E H +H     R   +LL+G   G+A      PF+  + RLQ S+   + M         
Sbjct: 251 ERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSIS 310

Query: 64  EVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMK 104
           E+ + +    G RGF+ G     I V   V+  F V E MK
Sbjct: 311 EIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYERMK 351

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 81/198 (40%), Gaps = 30/198 (15%)

Query: 125 ACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTN--AEFKGPLECIKKLRHN---KALLRG 179
           A G++G    + +A P++ ++I  QT     T       G  E  K +  N   +   +G
Sbjct: 38  AGGISGSCAKTLIA-PLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQG 96

Query: 180 LTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYP 239
            + T++R        F+ YE  I N +   +  E      W+  + G+L+G       YP
Sbjct: 97  HSVTLMRIFPYAAVKFVAYEQ-IRNTLIPSKEYESH----WRRLMSGSLAGLCSVFTTYP 151

Query: 240 LDVIKSVMQTDNLQKPKFGNSISSVAKTLY---------ANGGI-------GAFFKGFGP 283
           LD+I+  +      K     S+  + KT+Y         A G I         F++G+ P
Sbjct: 152 LDLIRVRLAYVTEHK---RISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGYTP 208

Query: 284 TMLRAAPANGATFATFEL 301
           T+L   P  G +F   +L
Sbjct: 209 TVLGMIPYAGVSFFAHDL 226

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 71.6 bits (174), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 82/328 (25%), Positives = 131/328 (39%), Gaps = 61/328 (18%)

Query: 20  HDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS-------------STPTT----- 61
           H N   +  L    AG +A V+V  P D  K RLQ               S  TT     
Sbjct: 99  HFNDTEITALSGALAGFLAGVIVC-PLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKY 157

Query: 62  ---AMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMK----RFFHHRNADM 114
                  +  ++ +E  RG YKG +  ++G      + F V E  K    R+F++    +
Sbjct: 158 YSGIWGTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEF-L 216

Query: 115 SSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNA--EFKGPLEC---IKK 169
           S ++S        +T G +++ L +PI  V+ RL  Q+G        +K  L+    I K
Sbjct: 217 SHSMS-------ALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYK 269

Query: 170 LRHNKALLRGLTPTILREGHGCGTYFLVYEALI-----------------ANQMNKRRGL 212
           +   K+   GL P++    H    +F VYE L                   N  +  +  
Sbjct: 270 VEGIKSFYSGLIPSLFGLLH-VAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTT 328

Query: 213 ERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANG 272
              +    +L +    S      + YP +++++ +Q  +  KP    SI S+ +T YA  
Sbjct: 329 GSTNFQLGRLIVASCGSKMIASTLTYPHEILRTRLQLKSDMKP----SIKSIIRTTYAKE 384

Query: 273 GIGAFFKGFGPTMLRAAPANGATFATFE 300
           GI  F+ GF   M R  PA+  T  +FE
Sbjct: 385 GIRGFYSGFLTNMFRTVPASAITLVSFE 412

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 70.9 bits (172), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 117/294 (39%), Gaps = 31/294 (10%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAME---------VVRKLLANEGPRGFYK 80
           ++G   G    ++  PFD  K RLQ         +             +  +EG  G YK
Sbjct: 43  ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYK 102

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASP 140
           G    ++G    + + F V +  +++    + D+          +  +T G +++   +P
Sbjct: 103 GLQPTVLGYIPTLMIYFSVYDFCRKY----SVDIFPHSPFLSNASSAITAGAISTVATNP 158

Query: 141 IEHVRIRLQTQTGSGT-NAEFKGPLECIKKLRHN---KALLRGLTPTILREGHGCGTYFL 196
           I  V+ RL  QTG G  +  +KG ++  +K+      KAL  GL P +L   +     F 
Sbjct: 159 IWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGMLN-VAIQFP 217

Query: 197 VYEALIANQMNKRRGL-ERKDIPA-------WKLCIFGALSGTALWLMVYPLDVIKSVMQ 248
           +YE L       R G  E  D+          KL +   LS      + YP +++++ MQ
Sbjct: 218 LYENL-----KIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQ 272

Query: 249 TDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELA 302
             +         +  + K  Y   G   F+ GF   ++R  PA   T  +FE +
Sbjct: 273 LKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEYS 326

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 131/323 (40%), Gaps = 31/323 (9%)

Query: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           +++  P P  +  + ++  +     V  L  G AG +++ +V  PF+  K+ LQ  ++ T
Sbjct: 4   LAQVLPQPSYVKSILKNDSN-----VAFLAGGLAGAVSRTVV-SPFERVKILLQVQNSTT 57

Query: 61  TAME----VVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKR-FFHHRNADMS 115
              +     VR++   EG  G ++G     I +    ++QF V EA K+ FFH   +   
Sbjct: 58  AYNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGR 117

Query: 116 STLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAE-------FKGP----L 164
             L   Q    G   G  +     P++ VR RL  QT + T           K P    L
Sbjct: 118 EQLQNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDL 177

Query: 165 EC--IKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKL 222
            C   K+    K L RG+ PT L         F VYE     +     G +      +KL
Sbjct: 178 LCRTYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQF---KEFMPEGTDNTLANFYKL 234

Query: 223 CIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANG---GIGAFFK 279
            I GALSG     + YP D+++   Q   +   + G    SV   L   G   G   ++K
Sbjct: 235 SI-GALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYK 293

Query: 280 GFGPTMLRAAPANGATFATFELA 302
           G    + +  P+   ++  +E+ 
Sbjct: 294 GLTANLFKVIPSTAVSWLVYEVV 316

 Score = 32.3 bits (72), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 44/108 (40%), Gaps = 9/108 (8%)

Query: 9   QLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP--------T 60
           Q  + + E   +  A   K  +   +GG+AQ  V  PFD  + R Q  +           
Sbjct: 215 QFKEFMPEGTDNTLANFYKLSIGALSGGVAQT-VTYPFDLLRRRFQVLAMGGNELGFRYK 273

Query: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH 108
           + M+ +  +   EG RG+YKG    L  V    ++ + V E +    H
Sbjct: 274 SVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDLMH 321

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 124/309 (40%), Gaps = 33/309 (10%)

Query: 11  IDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQT----SST-----PTT 61
           + D E  P  D+A +   L+AG   GIA+  V  P D  K RLQ     S+T     P+T
Sbjct: 6   VIDYEALP--DHAPLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPST 63

Query: 62  AMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLP 121
            +  +  + A EG    +KG  + L+G G   ++ F   E +K F      D +++ S  
Sbjct: 64  MLRQLSSISAQEGSMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFL----IDEATSTSKY 119

Query: 122 QYYA---CGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLR 178
            ++     G T  I    L +P + ++ R+Q      TN       + I      +A   
Sbjct: 120 HFFKTAFSGATATIAADALMNPFDVIKQRIQLN----TNISVWDTAKRIYSKEGFQAFYS 175

Query: 179 GLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVY 238
               T+          F +Y+   A +     G+    I     C+ G +SG A   +  
Sbjct: 176 SYPTTLAINIPFAAFNFGIYDT--ATRYFNPSGVYNPFIH----CLCGGISGAACAGLTT 229

Query: 239 PLDVIKSVMQTDNLQKP-----KFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANG 293
           PLD IK+ +Q    +K      K  ++     + +Y   G   F+ G  P +L   PA  
Sbjct: 230 PLDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATA 289

Query: 294 ATFATFELA 302
            ++  +E A
Sbjct: 290 ISWTAYEFA 298

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 32/90 (35%), Gaps = 10/90 (11%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEV----------VRKLLANEGPRGFY 79
           L G   G A   +  P D  K  LQ   +   +MEV           R +    G RGF+
Sbjct: 215 LCGGISGAACAGLTTPLDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFW 274

Query: 80  KGTLTPLIGVGACVSLQFGVNEAMKRFFHH 109
            G    ++      ++ +   E  K F  H
Sbjct: 275 SGVKPRILANMPATAISWTAYEFAKHFLFH 304

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 77/308 (25%), Positives = 129/308 (41%), Gaps = 37/308 (12%)

Query: 9   QLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA------ 62
           QL+DD +          V   LAG   GI       P D  K RLQ     +        
Sbjct: 79  QLLDDTQ-------VTAVSGALAGFVSGIMVC----PLDVAKTRLQAQGAGSGERYYRGI 127

Query: 63  MEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMK-RFFHHRNADMSSTLSLP 121
           +  +  +L +EG  G YKG    ++G      L F V E  K R+  +      S     
Sbjct: 128 VGTLSAILRDEGVAGLYKGLAPIVLGYFPTWMLYFSVYEKCKQRYPSYLPGGFVS----- 182

Query: 122 QYYACGVTGGIVNSFLASPIEHVRIRLQTQTG-SGTNAEFKGPLECIKKLRHN---KALL 177
            + A  +T G +++ L +PI  V+ RL  Q+  S  +  ++  L+  +K+  +   K   
Sbjct: 183 -HAASALTAGAISTALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFY 241

Query: 178 RGLTPTILREGHGCGTYFLVYEAL-IANQMN----KRRGLERKDIPAWKLCIFGALSGTA 232
            GL P++    H    +F VYE L I    N      + L+   +   +L +   LS   
Sbjct: 242 SGLVPSLFGLFH-VAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVV 300

Query: 233 LWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPAN 292
             ++ YP +++++ MQ  +   P    S+ ++   + A+ G   F+ GF   ++R  PA+
Sbjct: 301 ASVITYPHEILRTRMQVRHSGVPP---SLLNLLGRIRASEGYVGFYSGFATNLVRTVPAS 357

Query: 293 GATFATFE 300
             T  +FE
Sbjct: 358 VITLVSFE 365

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 66/320 (20%), Positives = 126/320 (39%), Gaps = 39/320 (12%)

Query: 11  IDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS------------- 57
           I +++     D A +   L+AG   GI +  +  P D  K R+Q  S             
Sbjct: 6   IQEIDYEALPDTAPLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGG 65

Query: 58  --------TPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHH 109
                      T ++ + ++ + EG    ++G  + ++G G   ++ F   E  K     
Sbjct: 66  AGAASGGAGAGTLLQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKE--QL 123

Query: 110 RNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKK 169
            +A   +T    +    GV   +    L +P + ++ RLQ Q+ S  ++ ++     I K
Sbjct: 124 IDAKDFNTHQPLKTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFN-IYK 182

Query: 170 LRHNKALLRGLTPTILREGHGCGTYFLVYEALIA--NQMNKRRGLERKDIPAWKLCIFGA 227
                A       T+          F++YE+     N  N            W  C+ G 
Sbjct: 183 NEGPMAFFYSYPTTLAMNIPFAALNFVIYESSTKFFNPTNAYN--------PWIHCLCGG 234

Query: 228 LSGTALWLMVYPLDVIKSVMQ-----TDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFG 282
           ++G     +  PLD IK+V+Q     T +++  K  N+    A+ ++ + G   F++G  
Sbjct: 235 IAGATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQ 294

Query: 283 PTMLRAAPANGATFATFELA 302
           P ++   PA   ++ ++E A
Sbjct: 295 PRVISNIPATAISWTSYEFA 314

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 85/207 (41%), Gaps = 22/207 (10%)

Query: 4   EFPSPQLID--DLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQ--TSSTP 59
           EF   QLID  D   H      + +K  ++G A  +A   +  PFDT K RLQ  + S+ 
Sbjct: 117 EFCKEQLIDAKDFNTH------QPLKTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSD 170

Query: 60  TTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLS 119
           ++   +   +  NEGP  F+    T L       +L F + E+  +FF+  NA       
Sbjct: 171 SSMWRMAFNIYKNEGPMAFFYSYPTTLAMNIPFAALNFVIYESSTKFFNPTNAYNPWIHC 230

Query: 120 LPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAE-------FKGPLECIKKLRH 172
           L     CG   G   + + +P++ ++  LQ +     + E       FK   + I +   
Sbjct: 231 L-----CGGIAGATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYG 285

Query: 173 NKALLRGLTPTILREGHGCGTYFLVYE 199
            K   RGL P ++         +  YE
Sbjct: 286 WKGFWRGLQPRVISNIPATAISWTSYE 312

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 80/305 (26%), Positives = 124/305 (40%), Gaps = 45/305 (14%)

Query: 15  EEHPQHDNARVVKDLLAGTAGGIAQ---VLVGQPFDTTKVRLQ-----------TSSTPT 60
           E+H Q   A  V    +  AGG+A    V V  PFD  K R+Q             + P 
Sbjct: 7   EKHNQKTAAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPI 66

Query: 61  TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH---HRNADMSST 117
            A  V+ K   NEG  G  KG  +  +   A    + G  E ++   +   + N +    
Sbjct: 67  QAFGVIFK---NEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKV 123

Query: 118 LSLPQYYACGVTGGIVNSFLASPIEHVRIRLQT-----QTGSGTN--AEFKGPLECIKKL 170
             +    A G T G+V +F+ SP+  V+ R+Q+       G  T+  + F G L  I + 
Sbjct: 124 QHIGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNG-LATIFRS 182

Query: 171 RHNKALLRGLTPTILREGHGCGTYFLVYEA-----LIANQMNKRRGLERKDIPAWKLCIF 225
              K L RG+   +LR G G      +Y       L  + MN   GL           + 
Sbjct: 183 EGIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLH---------LLS 233

Query: 226 GALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTM 285
             ++G  + + + P DV+  + +  N +   +   I    KT+  N G+ A +KGFG  +
Sbjct: 234 STIAGFGVGVAMNPWDVV--LTRVYNQKGNLYSGPIDCFIKTV-RNEGLSALYKGFGAQI 290

Query: 286 LRAAP 290
           LR  P
Sbjct: 291 LRIGP 295

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 68.2 bits (165), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 79/319 (24%), Positives = 125/319 (39%), Gaps = 25/319 (7%)

Query: 7   SPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVL---VGQPFDTTKVRLQTSSTPTTA- 62
           S  ++  +EE  Q  N       +A  AGGIA  +   V  PF+  K+ LQ  S+ T   
Sbjct: 2   SEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN 61

Query: 63  ---MEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKR-FFHHRNADMSSTL 118
               + + ++   E  +G ++G     I V    ++QF V E  K+  FH         L
Sbjct: 62  KGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQL 121

Query: 119 SLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTN------AEFKGPLECIKKLRH 172
           +  Q    G   G  +     P++ VR RL  QT + +       ++   P    K L  
Sbjct: 122 NNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSK 181

Query: 173 NKA-------LLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIF 225
             A       L RG+ PT L         F VYE L     +   G        +KL + 
Sbjct: 182 AYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM- 240

Query: 226 GALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANG---GIGAFFKGFG 282
           GA+SG     + YP D+++   Q   +   + G   +SV   L   G   G   ++KG  
Sbjct: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300

Query: 283 PTMLRAAPANGATFATFEL 301
             + +  P+   ++  +EL
Sbjct: 301 ANLFKVVPSTAVSWLVYEL 319

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 67.8 bits (164), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 122/296 (41%), Gaps = 30/296 (10%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----MEVVRKLLANEGPRGFYKGTLT 84
            +AG  GG     V  P +  K+ LQ  S+ T      +  V+++   EG +G ++G   
Sbjct: 20  FVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGNGI 79

Query: 85  PLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHV 144
             + +    ++Q+ V E  K    H        L   +    G  GG  +  +  P++ V
Sbjct: 80  NCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPLDLV 139

Query: 145 RIRLQTQTGS------GTNAEFKGPLECIKKLRHN-------KALLRGLTPTILREGHGC 191
           R RL  QT +          + + P   ++ LR         +   RG+ PT L      
Sbjct: 140 RTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVPFV 199

Query: 192 GTYFLVYE---ALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQ 248
              F +YE   ALI +  +         + A KL I GA+SG     +VYP D+++   Q
Sbjct: 200 ALNFALYERLKALIPHDYDA------GSVAAAKLAI-GAVSGGIAQTVVYPFDLLRRRFQ 252

Query: 249 TDNLQKPKFGNSISSVAKTLYANG---GIGAFFKGFGPTMLRAAPANGATFATFEL 301
              + + + G   +SVA  L+  G   G+  ++KG    +++  PA    +  +EL
Sbjct: 253 VLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 79/188 (42%), Gaps = 25/188 (13%)

Query: 41  LVGQPFDTTKVRLQTSST---------------PTTAMEVVRKLLANEGP-RGFYKGTLT 84
           LV  P D  + RL   +                P   +E++R++   EG  RG+Y+G   
Sbjct: 131 LVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYP 190

Query: 85  PLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHV 144
             +GV   V+L F + E +K    H + D  S ++  +     V+GGI  + +  P + +
Sbjct: 191 TSLGVVPFVALNFALYERLKALIPH-DYDAGS-VAAAKLAIGAVSGGIAQT-VVYPFDLL 247

Query: 145 RIRLQTQTGSGTNAEFK-----GPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYE 199
           R R Q  T   +   F+       L  I +    +   +GLT  +++        + VYE
Sbjct: 248 RRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYE 307

Query: 200 ALIANQMN 207
            LI+  M+
Sbjct: 308 -LISENMH 314

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 9/90 (10%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM--------EVVRKLLANEGPRGF 78
           K  +   +GGIAQ +V  PFD  + R Q  +   + +        + +  +   EG RG+
Sbjct: 226 KLAIGAVSGGIAQTVV-YPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGY 284

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFH 108
           YKG    L+ V   +++Q+ V E +    H
Sbjct: 285 YKGLTANLVKVVPAMAVQWFVYELISENMH 314

>Kwal_33.14050
          Length = 314

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 69/311 (22%), Positives = 120/311 (38%), Gaps = 38/311 (12%)

Query: 13  DLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST-----------PTT 61
           D E  P   NA +   L AG   GI +  +  P D  K R+Q  S            P+ 
Sbjct: 6   DYESLPT--NAPLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSN 63

Query: 62  AMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLP 121
            ++ + ++   EG    +KG  + ++G G   ++ F   E  K +      D  +   L 
Sbjct: 64  IVQQIARISTTEGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQ-DFQTHQPL- 121

Query: 122 QYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLR 178
           +  A G+   +    L +P + ++ R+Q +T S              ++  N+   A   
Sbjct: 122 KTAASGIAATVAADLLMNPFDTIKQRMQLRTFSKDRM-----WSVASRIYRNEGLAAFFY 176

Query: 179 GLTPTILREGHGCGTYFLVYEALIA--NQMNKRRGLERKDIPAWKLCIFGALSGTALWLM 236
               TI          F +YE+     N  N    L          C+ G +SG     +
Sbjct: 177 SYPTTIAMNIPFAAFNFAIYESATKFFNPENTYNPLIH--------CLCGGISGATCAAI 228

Query: 237 VYPLDVIKSVMQ---TDNLQKPKF--GNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPA 291
             PLD IK+V+Q   ++++  P F   ++ S  A  +    G   F++G  P ++   PA
Sbjct: 229 TTPLDCIKTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPA 288

Query: 292 NGATFATFELA 302
              ++  +E A
Sbjct: 289 TAISWTAYECA 299

>Scas_582.7
          Length = 329

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/304 (23%), Positives = 115/304 (37%), Gaps = 29/304 (9%)

Query: 13  DLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQ------TSSTPTTAMEVV 66
           D E  P H  A +   LLAG   GI +     P D  K R+Q      T  T T+ ++ +
Sbjct: 26  DYEALPAH--APLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQI 83

Query: 67  RKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYAC 126
            K+   EG    +KG  + ++G G   ++ F   E  K    H   D       P   A 
Sbjct: 84  SKISTMEGSLALWKGVQSVILGAGPAHAVYFATYEFTKA---HLIPDSQRETHQPIKVAV 140

Query: 127 -GVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTIL 185
            G T  + + F  +P + ++ R+Q         +     + I  L    A       TI 
Sbjct: 141 SGATATVASDFFMNPFDTIKQRMQI--SDLKKEKVYNVAKKIYNLEGLSAFYYSYPTTIA 198

Query: 186 REGHGCGTYFLVYEAL--IANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVI 243
                    F++YE+     N ++    L          C+ G +SG     +  PLD I
Sbjct: 199 MNIPFAAFNFMIYESASKFFNPLHHYNPLIH--------CLCGGISGAIAAAVTTPLDCI 250

Query: 244 KSVMQTD-----NLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFAT 298
           K+V+Q       +L+  K  N+       +    G   F++G  P +L   PA   ++  
Sbjct: 251 KTVIQIRGSSVVSLEVMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTA 310

Query: 299 FELA 302
           +E A
Sbjct: 311 YECA 314

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 85/222 (38%), Gaps = 32/222 (14%)

Query: 4   EFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM 63
           EF    LI D     Q +  + +K  ++G    +A      PFDT K R+Q S      +
Sbjct: 118 EFTKAHLIPD----SQRETHQPIKVAVSGATATVASDFFMNPFDTIKQRMQISDLKKEKV 173

Query: 64  -EVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFF---HHRNADMSSTLS 119
             V +K+   EG   FY    T +       +  F + E+  +FF   HH N  +     
Sbjct: 174 YNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFMIYESASKFFNPLHHYNPLI----- 228

Query: 120 LPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAE-------FKGPLECIKKLRH 172
              +  CG   G + + + +P++ ++  +Q +  S  + E       FK     I  +  
Sbjct: 229 ---HCLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVVSLEVMKKANTFKKATSAILMVYG 285

Query: 173 NKALLRGLTPTILRE---------GHGCGTYFLVYEALIANQ 205
            K   RGL P IL            + C  +FL    L+ N 
Sbjct: 286 WKGFWRGLQPRILANMPATAISWTAYECAKHFLFSTRLLKND 327

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 121/309 (39%), Gaps = 43/309 (13%)

Query: 13  DLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS----STPTTAMEVVRK 68
           D E  P H  A +   LLAG   GI +  +  P D  K R+Q +    +  T  +  + K
Sbjct: 13  DYEALPSH--APLHSQLLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISK 70

Query: 69  LLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMK-RFFHHRNAD----MSSTLSLPQY 123
           +   EG    +KG  + ++G G   ++ FG  E  K R     +      M + LS    
Sbjct: 71  ISTMEGSMALWKGVQSVILGAGPAHAVYFGTYEFCKARLISPEDMQTHQPMKTALS---- 126

Query: 124 YACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK--ALLRGLT 181
              G    I    L +P + V+ RLQ  T               K++  N+  A      
Sbjct: 127 ---GTIATIAADALMNPFDTVKQRLQLDTNLRV-------WNVTKQIYQNEGFAAFYYSY 176

Query: 182 PTILREGHGCGTY-FLVYEAL--IANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVY 238
           PT L        + F++YE+     N  N    L          C+ G +SG     +  
Sbjct: 177 PTTLAMNIPFAAFNFMIYESASKFFNPQNSYNPLIH--------CLCGGISGATCAALTT 228

Query: 239 PLDVIKSVMQ-----TDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANG 293
           PLD IK+V+Q     T +++  K  N+    ++ +    G   F++G  P ++   PA  
Sbjct: 229 PLDCIKTVLQVRGSETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATA 288

Query: 294 ATFATFELA 302
            ++  +E A
Sbjct: 289 ISWTAYECA 297

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 83/205 (40%), Gaps = 21/205 (10%)

Query: 4   EFPSPQLI--DDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT 61
           EF   +LI  +D++ H      + +K  L+GT   IA   +  PFDT K RLQ   T   
Sbjct: 103 EFCKARLISPEDMQTH------QPMKTALSGTIATIAADALMNPFDTVKQRLQL-DTNLR 155

Query: 62  AMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLP 121
              V +++  NEG   FY    T L       +  F + E+  +FF+ +N+       L 
Sbjct: 156 VWNVTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNFMIYESASKFFNPQNSYNPLIHCL- 214

Query: 122 QYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAE-------FKGPLECIKKLRHNK 174
               CG   G   + L +P++ ++  LQ +     + E       F      I ++   K
Sbjct: 215 ----CGGISGATCAALTTPLDCIKTVLQVRGSETVSIEIMKDANTFGRASRAILEVHGWK 270

Query: 175 ALLRGLTPTILREGHGCGTYFLVYE 199
              RGL P I+         +  YE
Sbjct: 271 GFWRGLKPRIVANIPATAISWTAYE 295

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 65.5 bits (158), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 113/293 (38%), Gaps = 40/293 (13%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVR---KLLANEGPRGFYKGTLT 84
            LLAG   GI +  V  P D  K R+Q+SS+      +++   K+   EG    +KG  +
Sbjct: 19  QLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKGVQS 78

Query: 85  PLIGVGACVSLQFGVNEAMKRFF-----HHRNADMSSTLSLPQYYACGVTGGIVNSFLAS 139
            ++G G   ++ F   E  K         H +  + + +S       G+    V   L +
Sbjct: 79  VILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQPIKTAIS-------GMAATTVADALMN 131

Query: 140 PIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTILREGHGCGTYFL 196
           P + ++ R+Q  T               K + H +   A       T++         F 
Sbjct: 132 PFDVIKQRMQLNTRESV-------WHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFA 184

Query: 197 VYEAL--IANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQ-----T 249
           +YE+     N  N+              CI G LSG     +  PLD IK+V+Q     T
Sbjct: 185 IYESATKFMNPSNEYNPFIH--------CISGGLSGATCAAITTPLDCIKTVLQVRGSET 236

Query: 250 DNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELA 302
            + +  K  N+    A  +Y   G   F +G  P ++   PA   ++ ++E A
Sbjct: 237 VSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYECA 289

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 84/213 (39%), Gaps = 32/213 (15%)

Query: 4   EFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM 63
           EF   +LID  + H      + +K  ++G A       +  PFD  K R+Q  +T  +  
Sbjct: 95  EFSKSKLIDPQDMHTH----QPIKTAISGMAATTVADALMNPFDVIKQRMQL-NTRESVW 149

Query: 64  EVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQY 123
            V + +   EG   FY    T L+      +  F + E+  +F +  N           +
Sbjct: 150 HVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYESATKFMNPSN-------EYNPF 202

Query: 124 YACGVTGGIVNSFLA---SPIEHVRIRLQTQTGSGTNAE-------FKGPLECIKKLRHN 173
             C ++GG+  +  A   +P++ ++  LQ +     + E       F+     I K+   
Sbjct: 203 IHC-ISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGW 261

Query: 174 KALLRGLTPTILRE---------GHGCGTYFLV 197
           K  LRGL P ++            + C  +FLV
Sbjct: 262 KGFLRGLKPRVIANMPATAISWTSYECAKHFLV 294

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 65.1 bits (157), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 109/277 (39%), Gaps = 30/277 (10%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLI 87
            LL+G A G +  LV  P DT K RLQ                AN G +G Y+G  + ++
Sbjct: 7   SLLSGAAAGTSTDLVFFPIDTIKTRLQAKG----------GFFANGGYKGIYRGLGSAVV 56

Query: 88  GVGACVSLQFGVNEAMK--------RFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLAS 139
                 SL F   + MK        + +   +  +  T +   +      G I    +  
Sbjct: 57  ASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTT---HMLSSSIGEICACLVRV 113

Query: 140 PIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYE 199
           P E V+ R Q  + + +    +  L    K    K L RG + TI+RE       F +YE
Sbjct: 114 PAEVVKQRTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPLYE 173

Query: 200 ALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGN 259
            L      K  G  +  +  WK  I G+++G        PLD +K+ +  +     K   
Sbjct: 174 YL-KKTWAKANG--QSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLN-----KTTA 225

Query: 260 SISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATF 296
           S+ SV   +Y   G   FF G GP  +  + A GA F
Sbjct: 226 SLGSVIIRIYREEGPAVFFSGVGPRTMWIS-AGGAIF 261

 Score = 34.7 bits (78), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 15/75 (20%)

Query: 226 GALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTM 285
           GA +GT+  L+ +P+D IK+ +Q                    +ANGG    ++G G  +
Sbjct: 11  GAAAGTSTDLVFFPIDTIKTRLQAKG---------------GFFANGGYKGIYRGLGSAV 55

Query: 286 LRAAPANGATFATFE 300
           + +AP     F +++
Sbjct: 56  VASAPGASLFFISYD 70

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 34  AGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACV 93
           AGGIA      P D  K RL  + T  +   V+ ++   EGP  F+ G     + + A  
Sbjct: 200 AGGIAAATT-TPLDFLKTRLMLNKTTASLGSVIIRIYREEGPAVFFSGVGPRTMWISAGG 258

Query: 94  SLQFGVNEAM 103
           ++  G+ E +
Sbjct: 259 AIFLGMYETV 268

>Kwal_26.7967
          Length = 297

 Score = 65.1 bits (157), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 66/293 (22%), Positives = 121/293 (41%), Gaps = 17/293 (5%)

Query: 19  QHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----MEVVRKLLANEG 74
           Q      +   LAG+  G  +  +  PF+  K RLQ     +TA    + ++ +    +G
Sbjct: 3   QKKQVDPLHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQG 62

Query: 75  PRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVN 134
               Y G    ++G  A   ++F   +A+K          +  LS P+    G+  G++ 
Sbjct: 63  LGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNILRD---PTTGELSGPRGIVAGLGAGLLE 119

Query: 135 SFLA-SPIEHVRIRLQTQTGSGT---NAEFKGPLECIKKLRHNK---ALLRGLTPTILRE 187
           S +A +P E ++  L     S +   +   +G L     L ++K    L RG+ P  +R+
Sbjct: 120 SVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQ 179

Query: 188 GHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVM 247
                     Y  +     +     + K + +    + GA SG        P+D +K+ M
Sbjct: 180 AANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRM 239

Query: 248 QTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           Q+  L   K+ ++I+  A T++   G+  F+KG  P + R   + G  F  +E
Sbjct: 240 QS--LDSSKYSSTINCFA-TVFREEGLKTFWKGATPRLGRLILSGGIVFTIYE 289

>Kwal_14.2210
          Length = 315

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 123/299 (41%), Gaps = 47/299 (15%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----MEVVRKLLANEGPRGFYKGTLTPLI 87
           G AG +++ +V  PF+  K+ LQ  S+           V+++   EG  G  +G     I
Sbjct: 25  GIAGAVSRTVV-SPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGNGLNCI 83

Query: 88  GVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLAS-PIEHVRI 146
            +    ++QF V E  K+ +  +N D +  L+  +  +  + GG   S LA+ P++ VR 
Sbjct: 84  RIFPYSAVQFLVYEFCKKQWFQQNPD-TVVLNWHRLVSGALCGGC--SVLATYPLDLVRT 140

Query: 147 RLQTQTGSGTNAEFK---------GPLECIKKLRHNKA----LLRGLTPTILREGHGCGT 193
           RL  QT +                G  E ++K    +     L RG+ PT +        
Sbjct: 141 RLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVPYVAL 200

Query: 194 YFLVYEALIANQMNKRRGLERKDIPA---------WKLCIFGALSGTALWLMVYPLDVIK 244
            F VYE L            R+ IPA         +KL I GA+SG     + YP D+++
Sbjct: 201 NFAVYEQL------------REYIPASFDPASASLYKLSI-GAISGGVAQTITYPFDLLR 247

Query: 245 SVMQTDNLQKPKFGNSISSVAKTLYANG---GIGAFFKGFGPTMLRAAPANGATFATFE 300
              Q   + + + G    SV   L   G   G   ++KG    + +  P+   ++  +E
Sbjct: 248 RRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYE 306

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 83/194 (42%), Gaps = 25/194 (12%)

Query: 124 YACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKA---LLRGL 180
           +  G   G V+  + SP E V+I LQ Q  S T+A   G    +K++   +    LLRG 
Sbjct: 21  FCAGGIAGAVSRTVVSPFERVKILLQVQ--SSTHAYNHGLFRAVKQVYLEEGVPGLLRGN 78

Query: 181 TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKD---IPAWKLCIFGALSGTALWLMV 237
               +R        FLVYE        K++  ++     +  W   + GAL G    L  
Sbjct: 79  GLNCIRIFPYSAVQFLVYE------FCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLAT 132

Query: 238 YPLDVIKS--VMQTDNLQKPKFGNSISS---------VAKTLYANGGIGAFFKGFGPTML 286
           YPLD++++   +QT NL +     + S+         + KT    GGI   ++G  PT +
Sbjct: 133 YPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSI 192

Query: 287 RAAPANGATFATFE 300
              P     FA +E
Sbjct: 193 GVVPYVALNFAVYE 206

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 41/99 (41%), Gaps = 17/99 (17%)

Query: 22  NARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQT------------SSTPTTAMEVVRKL 69
           +A + K  +   +GG+AQ +   PFD  + R Q              S P   + + R  
Sbjct: 220 SASLYKLSIGAISGGVAQTIT-YPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGR-- 276

Query: 70  LANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH 108
              EG +G+YKG    L  V    ++ + V E ++ +  
Sbjct: 277 --TEGFKGYYKGLTANLFKVVPSTAVSWVVYETVRDYMQ 313

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/277 (23%), Positives = 117/277 (42%), Gaps = 20/277 (7%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPT-TAMEVVRKLLANEGPRGFYKGTLTPLIGVG 90
           G  GGI   +   P D  KVRLQT+  P  T + +  ++L NEG  G Y G    ++   
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPTLVRMASQILRNEGVPGLYSGLTAAILRQC 74

Query: 91  ACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQT 150
              + +FGV + +K  +  +    S    LP    C +  G V   + +P + V IR+Q 
Sbjct: 75  TYTTARFGVYDFVKERYIPKEYLNSMLYLLP----CSMFSGAVGGLIGNPADVVNIRMQN 130

Query: 151 QTG--SGTNAEFKGPLECIKKLRHNKA---LLRGLTPTILREGHGCGTYFLVYEALIANQ 205
            +   +     +K   + + K+   +    L  G  P ++R      +  + Y+ +  N 
Sbjct: 131 DSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYD-IAKNY 189

Query: 206 MNKRRGLERKDIPAWKLCIFGA--LSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISS 263
           + +  GL++ +    K   F +  L+G     +  P DVIK+  +  N  K    +++  
Sbjct: 190 LVQNVGLDKDN----KSTHFASSLLAGLVATTVCSPADVIKT--RVMNAHKHSHDSAVRI 243

Query: 264 VAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           +   +   G     F+G+ P+ +R  P     F T E
Sbjct: 244 LLDAVKQEGP-SFMFRGWLPSFVRLGPNTILIFLTVE 279

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 34/84 (40%), Gaps = 8/84 (9%)

Query: 218 PAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAF 277
           P W    +G   G    +  +PLD+ K  +QT    KP    ++  +A  +  N G+   
Sbjct: 11  PWW----YGGFGGIVACVATHPLDLAKVRLQTAPAPKP----TLVRMASQILRNEGVPGL 62

Query: 278 FKGFGPTMLRAAPANGATFATFEL 301
           + G    +LR      A F  ++ 
Sbjct: 63  YSGLTAAILRQCTYTTARFGVYDF 86

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/278 (24%), Positives = 114/278 (41%), Gaps = 22/278 (7%)

Query: 22  NARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKG 81
           ++  +  L++G A G +  +V  P DT K RLQ                 N G RG Y+G
Sbjct: 2   DSTFLASLVSGAAAGTSTDVVFFPIDTLKTRLQAKG----------GFFHNGGYRGIYRG 51

Query: 82  TLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQ---YYACGVTGGIVNSFLA 138
             + ++      SL F   ++MK+         +++  L +   +      G +    + 
Sbjct: 52  LGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVR 111

Query: 139 SPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVY 198
            P E ++ R QT   + +    +  L         + L RG   TI+RE       F +Y
Sbjct: 112 VPAEVIKQRTQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQFPLY 171

Query: 199 EALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFG 258
           E L   +      +ER  + AW+  + G+L+G        PLDV+K+ M     + P   
Sbjct: 172 EYL-KKKWAAYAEIER--VSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRVPML- 227

Query: 259 NSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATF 296
                +A+TL+   G   FF+G GP  +  + A GA F
Sbjct: 228 ----HLARTLFREEGARVFFRGIGPRTMWIS-AGGAIF 260

 Score = 32.3 bits (72), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 27/63 (42%)

Query: 45  PFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMK 104
           P D  K R+         + + R L   EG R F++G     + + A  ++  GV EA+ 
Sbjct: 209 PLDVLKTRMMLHERRVPMLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAVH 268

Query: 105 RFF 107
             F
Sbjct: 269 SLF 271

 Score = 31.6 bits (70), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 35/77 (45%), Gaps = 15/77 (19%)

Query: 224 IFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGP 283
           + GA +GT+  ++ +P+D +K+ +Q                    + NGG    ++G G 
Sbjct: 10  VSGAAAGTSTDVVFFPIDTLKTRLQAKG---------------GFFHNGGYRGIYRGLGS 54

Query: 284 TMLRAAPANGATFATFE 300
            ++ +AP     F T++
Sbjct: 55  AVVASAPGASLFFVTYD 71

>Scas_558.2
          Length = 289

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 108/282 (38%), Gaps = 32/282 (11%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTP 85
           V  LL+G A G +  LV  P DT K RLQ                 N G  G Y+G  + 
Sbjct: 7   VMSLLSGAAAGTSTDLVFFPIDTLKTRLQAKG----------GFFQNGGYHGIYRGLGSA 56

Query: 86  LIGVGACVSLQFGVNEAMK--------RFFHHRNADMSSTLSLPQYYACGVTGGIVNSFL 137
           ++      SL F   ++MK        R  +        ++    +      G +    +
Sbjct: 57  VVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGELAACLV 116

Query: 138 ASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLV 197
             P E ++ R Q  + + +   F+  L+   +    + L RG + TI+RE       F +
Sbjct: 117 RVPAEVIKQRTQVHSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIPFTCIQFPL 176

Query: 198 YEALIANQMNKRRGL---ERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQK 254
           YE      M K   L   E   +  WK  I G+++G        PLD +K+ +  +    
Sbjct: 177 YEF-----MKKEWALYDNEVGHLKPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKDSI 231

Query: 255 PKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATF 296
           P     I S+ + +Y   G   FF G  P  +  + A GA F
Sbjct: 232 P-----IKSLIRNIYKEEGFKIFFSGIYPRTMWIS-AGGAIF 267

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 35/75 (46%), Gaps = 15/75 (20%)

Query: 226 GALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTM 285
           GA +GT+  L+ +P+D +K+ +Q                    + NGG    ++G G  +
Sbjct: 13  GAAAGTSTDLVFFPIDTLKTRLQAKG---------------GFFQNGGYHGIYRGLGSAV 57

Query: 286 LRAAPANGATFATFE 300
           + +AP+    F T++
Sbjct: 58  VASAPSASLFFVTYD 72

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 1/70 (1%)

Query: 34  AGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACV 93
           AGGIA      P D  K RL  +        ++R +   EG + F+ G     + + A  
Sbjct: 206 AGGIAAATT-TPLDFLKTRLMLNKDSIPIKSLIRNIYKEEGFKIFFSGIYPRTMWISAGG 264

Query: 94  SLQFGVNEAM 103
           ++  GV E M
Sbjct: 265 AIFLGVYETM 274

>Scas_721.129
          Length = 323

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 117/293 (39%), Gaps = 59/293 (20%)

Query: 34  AGGIAQ---VLVGQPFDTTKVRLQTSS-----------TPTTAMEVVRKLLANEGPRGFY 79
           AGG+A    V    P +  K+R+Q               P   M V+ +   NEG RG  
Sbjct: 27  AGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFR---NEGIRGLQ 83

Query: 80  KGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTL----------SLPQYYACGVT 129
           KG +   I        Q G+N +   F+      ++ST            +    A G +
Sbjct: 84  KGLVAAYI-------YQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGAS 136

Query: 130 GGIVNSFLASPIEHVRIRLQTQTGS---GTNAEFKGP---LECIKKLRHNKALLRGLTPT 183
            GI+ + + SP+  V+ R+Q+ + +   G    ++     L  I +    K L RG+   
Sbjct: 137 SGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAA 196

Query: 184 ILREGHGCGTYFLVYEA----LIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYP 239
           ILR G G      +Y      L+ N +        KD P   L     +SG  + +++ P
Sbjct: 197 ILRTGAGSSVQLPIYNTAKNFLLKNDL-------MKDGPGLHLTA-STISGLGVAVVMNP 248

Query: 240 LDVIKSVM--QTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAP 290
            DVI + +  Q  NL K      +    KT+    GI A +KGF   +LR AP
Sbjct: 249 WDVILTRIYNQKGNLYK----GPVDCFVKTVRTE-GISALYKGFQAQILRIAP 296

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 76/179 (42%), Gaps = 19/179 (10%)

Query: 20  HDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEV---------VRKLL 70
           H   +V  ++ AG + GI   ++G P    K R+Q+ S      E          +  + 
Sbjct: 122 HKIQKVSINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIA 181

Query: 71  ANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTG 130
             EG +G ++G    ++  GA  S+Q  +    K F   +N  M     L  +       
Sbjct: 182 RTEGFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL-LKNDLMKDGPGL--HLTASTIS 238

Query: 131 GIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLEC-IKKLRHN--KALLRGLTPTILR 186
           G+  + + +P + +  R+  Q G+     +KGP++C +K +R     AL +G    ILR
Sbjct: 239 GLGVAVVMNPWDVILTRIYNQKGN----LYKGPVDCFVKTVRTEGISALYKGFQAQILR 293

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 112/278 (40%), Gaps = 18/278 (6%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPT-TAMEVVRKLLANEGPRGFYKGTLTPLIGVG 90
           G A GI  V+   P D TKVRLQ +  P  T ++++R +L NEG  G Y G    L+   
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQAAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLLRQC 72

Query: 91  ACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQT 150
              + +FG+ +A+K     R+   +    L      G  GG+  +F     + + IR+Q 
Sbjct: 73  TYTTARFGMYDALKEHVIPRDKLTNMWYLLGASMVSGALGGLAGNF----ADLINIRMQN 128

Query: 151 QTGSGTNAE--FKGPLECIKKLRHNKA----LLRGLTPTILREGHGCGTYFLVYEALIAN 204
            +    +    +K  ++ + K+   +      L G  P ++R      +  + Y+     
Sbjct: 129 DSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVTYDMFKNF 188

Query: 205 QMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSV 264
            + K     +K+       +      T +     P DVIK+++   N  K    N  SS 
Sbjct: 189 LVTKYNMDPKKNSTHLTSSLLAGFVATTV---CSPADVIKTIVM--NAHKKPGHNHDSSF 243

Query: 265 AKTLYA--NGGIGAFFKGFGPTMLRAAPANGATFATFE 300
              + A    G    F+G+ P+  R AP     F   E
Sbjct: 244 KILMEAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAME 281

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 77/191 (40%), Gaps = 25/191 (13%)

Query: 121 PQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGP--LECIKKLRHNKA--- 175
           P +Y  G   GI       P++  ++RLQ        A    P  ++ ++ +  N+    
Sbjct: 9   PWWY--GGAAGIFAVMNTHPLDLTKVRLQA-------APIPKPTIVQMLRSILKNEGIVG 59

Query: 176 LLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIP-AWKLCIFGALSGTALW 234
           L  GL+ ++LR+       F +Y+AL      K   + R  +   W L     +SG    
Sbjct: 60  LYAGLSASLLRQCTYTTARFGMYDAL------KEHVIPRDKLTNMWYLLGASMVSGALGG 113

Query: 235 LMVYPLDVIKSVMQTDNL----QKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAP 290
           L     D+I   MQ D+     ++  + N+I  + K   A G    F  G+ P M+R   
Sbjct: 114 LAGNFADLINIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVL 173

Query: 291 ANGATFATFEL 301
              +   T+++
Sbjct: 174 MTASQVVTYDM 184

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 62.0 bits (149), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 109/276 (39%), Gaps = 30/276 (10%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLI 87
            LL+G A G +  LV  P DT K RLQ                 N G RG Y+G  + ++
Sbjct: 8   SLLSGAAAGTSTDLVFFPIDTLKTRLQAKG----------GFFRNGGYRGVYRGLGSAVV 57

Query: 88  GVGACVSLQFGVNEAMK---RFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHV 144
                 SL F   +  K   R F       S+   +  +      G I    +  P E V
Sbjct: 58  ASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGEIAACMVRVPAEVV 117

Query: 145 RIRLQTQTGSGTNAEFKGPL--ECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEAL- 201
           + R QT     +    +  L  E  + +R N  L RG + TI+RE       F +YE + 
Sbjct: 118 KQRSQTHASHSSWETLREILKNENGEGVRRN--LYRGWSTTIMREIPFTCIQFPLYEYMK 175

Query: 202 -IANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNS 260
            +  +++     E   +  WK  + G+++G        PLD +K+ +       P     
Sbjct: 176 KVWAELD-----ESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCKKSIP----- 225

Query: 261 ISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATF 296
           + ++  T+Y   G   FF G GP  +  + A GA F
Sbjct: 226 LGTLVSTIYKEEGFKVFFSGVGPRTMWIS-AGGAIF 260

 Score = 32.0 bits (71), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 34/75 (45%), Gaps = 15/75 (20%)

Query: 226 GALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTM 285
           GA +GT+  L+ +P+D +K+ +Q                    + NGG    ++G G  +
Sbjct: 12  GAAAGTSTDLVFFPIDTLKTRLQAKG---------------GFFRNGGYRGVYRGLGSAV 56

Query: 286 LRAAPANGATFATFE 300
           + +AP     F T++
Sbjct: 57  VASAPGASLFFITYD 71

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 62.8 bits (151), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 74/311 (23%), Positives = 126/311 (40%), Gaps = 64/311 (20%)

Query: 41  LVGQPFDTTKVRLQT------------SSTPTTA-------------MEVVRKLLANEGP 75
           +V  PFD  K RLQ+            S  P  A               ++  +  NEG 
Sbjct: 68  VVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGF 127

Query: 76  RGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQ-----YYACGVTG 130
           R  +KG    L+GV    S+ F      K  +       S TL+  Q     +     T 
Sbjct: 128 RSLFKGLGPNLVGVIPARSINFFTYGTTKEIY-------SKTLNNGQEAVWIHLMAAATA 180

Query: 131 GIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALL---RGLTPTILRE 187
           G   S   +PI  V+ RLQ    +GT  ++K   +C+K +   + +L   +GL+ + L  
Sbjct: 181 GWATSTATNPIWLVKTRLQLDK-AGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLGS 239

Query: 188 GHGCGTYFLVYEALIANQMNKRRGLER------------KDIPAWKLCIFGALSGTALW- 234
             G   + L YE +    + K+R +E+              I  W  C     +G A + 
Sbjct: 240 VEGILQWVL-YEQM--KHIIKQRSMEKFGNISEVEKSTSDKIKEW--CQRSGSAGLAKFV 294

Query: 235 --LMVYPLDVIKSVMQTDNLQ--KPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAP 290
             ++ YP +V+++ ++   L+  K K+   + S+ + +    G+ + + G  P +LR  P
Sbjct: 295 ASIITYPHEVVRTRLRQAPLENGKLKYTGLVQSI-RVIIKEEGLASMYGGLTPHLLRTVP 353

Query: 291 ANGATFATFEL 301
            +   F T+EL
Sbjct: 354 NSIIMFGTWEL 364

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 44/105 (41%), Gaps = 20/105 (19%)

Query: 215 KDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQK----------PKFGNSISS- 263
           K++  W   + G + G A  ++  P DV+K+ +Q+D  Q           P   N I+  
Sbjct: 48  KEVKPWVHFVAGGIGGMAGAVVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQG 107

Query: 264 ---------VAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATF 299
                    +   +Y N G  + FKG GP ++   PA    F T+
Sbjct: 108 VRHFKETFGIISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTY 152

>Kwal_26.7653
          Length = 325

 Score = 62.4 bits (150), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 76/321 (23%), Positives = 122/321 (38%), Gaps = 53/321 (16%)

Query: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
           MS+E  +  L  + ++ P           +AG       V V  P +  K R+Q     +
Sbjct: 1   MSKEIDTKALAAEADK-PAAQKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMS 59

Query: 61  --------TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNA 112
                     M+ ++ +  NEG RG  KG     I        Q G+N +   F+    +
Sbjct: 60  ADAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYI-------YQIGLNGSRLGFYEPIRS 112

Query: 113 DMSSTL----------SLPQYYACGVTGGIVNSFLASPIEHVRIRLQT-----QTGSGTN 157
            ++ T           ++      G T GI+ + + SP+  ++ R+Q+     Q G  T+
Sbjct: 113 VLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTH 172

Query: 158 -AEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEA-----LIANQMNKRRG 211
                  L  I +    K L RG+   ILR G G      +Y       L  + M +  G
Sbjct: 173 YTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTG 232

Query: 212 LERKDIPAWKLCIFGALSGTALWLMVYPLDVI--KSVMQTDNLQKPKFGNSISSVAKTLY 269
           L           +   +SG  + +++ P DVI  +   Q  NL K      +    KT+ 
Sbjct: 233 LH---------LVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYK----GPLDCFVKTVR 279

Query: 270 ANGGIGAFFKGFGPTMLRAAP 290
             G IGA +KGF   + R AP
Sbjct: 280 IEG-IGALYKGFEAQIFRIAP 299

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 62.0 bits (149), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 64/304 (21%), Positives = 122/304 (40%), Gaps = 23/304 (7%)

Query: 15  EEHPQHDN-ARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANE 73
           ++H + D        L+AG+  G+       P DT K++LQ +     A  V+  +L  E
Sbjct: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNA-NVLINILKRE 62

Query: 74  GPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYAC--GVTGG 131
           G RGF+KG +   I        QFG    +  F      D++ +   PQ Y+C  G   G
Sbjct: 63  GIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRG-GLDLNIS---PQLYSCLVGSLAG 118

Query: 132 IVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGC 191
           + +S  + P + +R R    +  G   + +  +  I           G   +++  G   
Sbjct: 119 MTSSLASYPFDVLRTRFAANS-QGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNT 177

Query: 192 GTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQ--- 248
              F VYE++      + +  +R+D       + G +SG    L  +PLD ++  +Q   
Sbjct: 178 AIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRN 237

Query: 249 -----------TDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFA 297
                      T ++ K         V  ++    G  + ++G   +++++ P+   +  
Sbjct: 238 SPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLW 297

Query: 298 TFEL 301
           ++EL
Sbjct: 298 SYEL 301

>Kwal_27.12081
          Length = 369

 Score = 62.4 bits (150), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 72/306 (23%), Positives = 123/306 (40%), Gaps = 55/306 (17%)

Query: 41  LVGQPFDTTKVRLQTSSTPTTAME----------------------VVRKLLANEGPRGF 78
           +V  PFD  K RLQ+    +T                         ++  L   EG R  
Sbjct: 68  IVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSL 127

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHH--RNADMSSTLSLPQYYACGVTGGIVNSF 136
           +KG    L+GV    S+ F      K+ +     N + +  + L        T G   S 
Sbjct: 128 FKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPWIHL----ISAATAGWATST 183

Query: 137 LASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTILREGHGCGT 193
             +PI  ++ RLQ    +G   ++K   +C+K +   +    L +GL+ + L    G   
Sbjct: 184 ATNPIWLIKTRLQLDK-AGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLGSVEGI-L 241

Query: 194 YFLVYEALIANQMNKRRGLER------------KDIPAWKLCIFGALSGTALWL---MVY 238
            +L+YE +   QM K R +E+            + I  W  C     +G A +L   + Y
Sbjct: 242 QWLLYEQM--KQMIKMRSIEKFGHISEGEKNTSEKIKEW--CQRSGSAGLAKFLASIVTY 297

Query: 239 PLDVIKSVMQTDNLQ--KPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATF 296
           P +V+++ ++   L+  K K+   I S  + +    G+ + + G  P +LR  P +   F
Sbjct: 298 PHEVVRTRLRQAPLENDKLKYTGLIQSF-RVIIKEEGLASMYGGLTPHLLRTVPNSIIMF 356

Query: 297 ATFELA 302
            T+EL 
Sbjct: 357 GTWELV 362

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/307 (23%), Positives = 117/307 (38%), Gaps = 36/307 (11%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKV----RLQTSST------------PTTAMEVVRK---- 68
            +AG   G+       PFD  KV    R   SST            P   +  ++     
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIK 262

Query: 69  ----LLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHH-RNADMSSTLSLPQY 123
               L    G R FY G    ++ V    +++FG  E  KR      N   +S LS    
Sbjct: 263 AATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLST 322

Query: 124 YACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGL 180
           Y  G  GG+   F   PI+ ++ R+Q    +    +    L+  K++      +   RG+
Sbjct: 323 YIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFYRGV 382

Query: 181 TPTIL----REGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIF--GALSGTALW 234
              ++          GT+  + +  I  +  K+ GL   ++    L +   GA SGT   
Sbjct: 383 HIGVMGIFPYAALDLGTFSALKKWYIKKEA-KKTGLPEDEVIISNLIVLPMGAFSGTVGA 441

Query: 235 LMVYPLDVIKSVMQTD-NLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANG 293
            +VYP++++++ +Q       P   N  S V K      G    FKG  P + +  PA  
Sbjct: 442 TLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCPAVS 501

Query: 294 ATFATFE 300
            ++  +E
Sbjct: 502 ISYLCYE 508

 Score = 35.4 bits (80), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%)

Query: 251 NLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELA 302
           N    K  + +   A TLY  GG+ AF+ G G  +++  P +   F +FE+A
Sbjct: 250 NADLSKIKSPLIKAATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMA 301

 Score = 32.3 bits (72), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 7/79 (8%)

Query: 34  AGGIAQVLVGQPFDTTKVRLQTSST---PTTA---MEVVRKLLANEGPRGFYKGTLTPLI 87
           +G +   LV  P +  + RLQ   T   P T     +V++K +  EG +G +KG +  L 
Sbjct: 436 SGTVGATLV-YPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLA 494

Query: 88  GVGACVSLQFGVNEAMKRF 106
            V   VS+ +   E +KR 
Sbjct: 495 KVCPAVSISYLCYENLKRL 513

>Kwal_26.7972
          Length = 358

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/315 (22%), Positives = 121/315 (38%), Gaps = 56/315 (17%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSS-----TPTTAMEVVR---KLLANEGPRGFYK 80
           L  G AG  A+ L+  P D  K+  QTS+        + M ++R    + A++G RGFY+
Sbjct: 32  LAGGIAGSCAKTLIA-PLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQ 90

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASP 140
           G    LI +    +++F   E ++ F        +    L    A G   G+ + F+  P
Sbjct: 91  GHSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETHARRL----ASGSMAGLCSVFMTYP 146

Query: 141 IEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKA-------------------LLRGLT 181
           ++ +R+RL   T     +  K  L  IK++   +A                     RG T
Sbjct: 147 LDLIRVRLAYVTD---RSRIKM-LPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFT 202

Query: 182 PTILREGHGCGTYFLVYEAL----------------IANQMNKRRGLERKDIP--AWKLC 223
           PT+L      G  F  ++                  I+++    R  ++   P   W   
Sbjct: 203 PTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLKTWAEL 262

Query: 224 IFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGN--SISSVAKTLYANGGIGAFFKGF 281
           + G L+G A     YP ++I+  +Q   +      N  +I  + + +Y   G   FF G 
Sbjct: 263 VAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWRGFFVGL 322

Query: 282 GPTMLRAAPANGATF 296
               ++  P    +F
Sbjct: 323 SIGYIKVTPMVACSF 337

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 226 GALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKT---LYANGGIGAFFKGFG 282
           G ++G+    ++ PLD IK + QT N    K+  S   + +    + A+ GI  F++G  
Sbjct: 34  GGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQGHS 93

Query: 283 PTMLRAAPANGATFATFE 300
            T++R  P     F  +E
Sbjct: 94  ATLIRIFPYAAIKFIAYE 111

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 51/112 (45%), Gaps = 19/112 (16%)

Query: 12  DDLEEHPQHDNARVVK---DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM----- 63
           ++L    +  ++R +K   +L+AG   G+A      PF+  + RLQ S    T++     
Sbjct: 242 EELTIRSKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQT 301

Query: 64  --EVVRKLLANEGPRGFYKG------TLTPLIGVGACVSLQFGVNEAMKRFF 107
             +++R +    G RGF+ G       +TP++   AC   +   NE +  + 
Sbjct: 302 IPDMIRIIYKERGWRGFFVGLSIGYIKVTPMV---ACSFFRLRKNEVVSEYL 350

 Score = 31.6 bits (70), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 83/198 (41%), Gaps = 30/198 (15%)

Query: 127 GVTGGIVNSF---LASPIEHVRIRLQTQTGSGTNAEFKGP-LECIKKLRHNKA------L 176
           G+ GGI  S    L +P++  RI++  QT +    ++ G  +  I+   H  A       
Sbjct: 31  GLAGGIAGSCAKTLIAPLD--RIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGF 88

Query: 177 LRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLM 236
            +G + T++R        F+ YE  I + M   +  E     A +L   G+++G     M
Sbjct: 89  YQGHSATLIRIFPYAAIKFIAYEQ-IRHFMIPSKEYETH---ARRLAS-GSMAGLCSVFM 143

Query: 237 VYPLDVIKSVMQ--TD-----------NLQKPKFGNSISSVAKTLYANGGIGAFFKGFGP 283
            YPLD+I+  +   TD            +   +   S++S +           F++GF P
Sbjct: 144 TYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFTP 203

Query: 284 TMLRAAPANGATFATFEL 301
           T+L   P  G +F   +L
Sbjct: 204 TVLGMIPYAGVSFFAHDL 221

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 115/292 (39%), Gaps = 55/292 (18%)

Query: 33  TAGGIAQ---VLVGQPFDTTKVRLQ-----------TSSTPTTAMEVVRKLLANEGPRGF 78
            AGG+A    V V  P +  K+R+Q               P   M V+ K   NEG +G 
Sbjct: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFK---NEGIKGL 83

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTL----------SLPQYYACGV 128
            KG       + A    Q G+N +   F+    + ++             S+      G 
Sbjct: 84  QKG-------LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGA 136

Query: 129 TGGIVNSFLASPIEHVRIRLQTQT---GSGTNAEFKGP---LECIKKLRHNKALLRGLTP 182
             GI+ + + SP+  V+ RLQ+ +     G    + G    L  I K    K L RG+  
Sbjct: 137 ASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDA 196

Query: 183 TILREGHGCGTYFLVYEA----LIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVY 238
            ILR G G      +Y      L+ N +        KD PA  L     +SG  + +++ 
Sbjct: 197 AILRTGAGSSVQLPIYNTAKNILVKNDL-------MKDGPALHLTA-STISGLGVAVVMN 248

Query: 239 PLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAP 290
           P DVI  + +  N +   +   I  + KT+    G+ A +KGF   + R AP
Sbjct: 249 PWDVI--LTRIYNQKGDLYKGPIDCLVKTVRIE-GVTALYKGFAAQVFRIAP 297

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 75/184 (40%), Gaps = 20/184 (10%)

Query: 15  EEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSST---------PTTAMEV 65
           ++ P H    V  ++ +G A GI   ++G P    K RLQ+ S           T     
Sbjct: 119 DQEP-HKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNG 177

Query: 66  VRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYA 125
           +  +   EG +G ++G    ++  GA  S+Q  +    K     +N  M    +L  +  
Sbjct: 178 LVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNIL-VKNDLMKDGPAL--HLT 234

Query: 126 CGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKK---LRHNKALLRGLTP 182
                G+  + + +P + +  R+  Q G      +KGP++C+ K   +    AL +G   
Sbjct: 235 ASTISGLGVAVVMNPWDVILTRIYNQKGD----LYKGPIDCLVKTVRIEGVTALYKGFAA 290

Query: 183 TILR 186
            + R
Sbjct: 291 QVFR 294

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 79/179 (44%), Gaps = 15/179 (8%)

Query: 137 LASPIEHVRIRLQTQTGSGTNAE--FKGPLECIKKLRHN---KALLRGLTPTILREGHGC 191
           + +PIE ++IR+Q Q     +A   +K P++ +  +  N   K L +GL    + +    
Sbjct: 39  VTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLN 98

Query: 192 GTYFLVYEALIANQMNKRR--GLERKDIPAWKLCIF-GALSGTALWLMVYPLDVIKSVMQ 248
           G+    YE  I + +N+      E   + +  + +F GA SG    ++  PL ++K+ +Q
Sbjct: 99  GSRLGFYEP-IRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQ 157

Query: 249 TDNLQKPKFGNS-----ISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELA 302
           + + +  K G       + +   T++   G+   F+G    +LR    +      +  A
Sbjct: 158 SYS-EFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTA 215

>Scas_716.29
          Length = 316

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/321 (21%), Positives = 130/321 (40%), Gaps = 45/321 (14%)

Query: 11  IDDLEEHPQH----DNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQ-----TSSTPTT 61
           IDD + +  H    ++ +V + L+AG+  G+    V  P DT K+RLQ     T   P+ 
Sbjct: 4   IDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSG 63

Query: 62  AMEVVRKLLANEGP-RGFYK----GTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSS 116
            +++++ ++ NEG  R F+K    GT+  ++  GA    QF         F    +DM+ 
Sbjct: 64  LLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGA----QFSSYSFYNNLFGE-TSDMNG 118

Query: 117 TLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKAL 176
            L   Q    G   G+ +SF++ P + +R R         ++   G  E I  +      
Sbjct: 119 QL---QSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKE-IWNMEGIPGF 174

Query: 177 LRGLTPTILREGHGCGTYFLVYEA--LIANQMNKRRGLERKDIPAWKLCIFGALSGTALW 234
            RG T ++          F  YE+  +  ++ +K       D   +      ++SG    
Sbjct: 175 FRGCTASMFTITLSASILFGTYESIKIYCDEYSK-----ESDYTNYLRYSASSISGVTSK 229

Query: 235 LMVYPLDVIKSVMQTDN---------------LQKPKFGNSISSVAKTLYANGGIGAFFK 279
           ++ YPLD I+  +Q  N               + +   G S   +   +    G+ + ++
Sbjct: 230 MVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQ 289

Query: 280 GFGPTMLRAAPANGATFATFE 300
           G   ++ +  P+   +   +E
Sbjct: 290 GVSMSLCKTVPSTVVSLWAYE 310

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 123/291 (42%), Gaps = 39/291 (13%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVV---RKLLANEG-PRGFYKGTLT 84
           +++G  GG          DT K R Q +        ++   R +   EG  RG Y G + 
Sbjct: 57  VVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYMA 116

Query: 85  PLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHV 144
            ++G     ++ FG  E  KR     +  ++ T++   + + G  G  ++SF+  P E +
Sbjct: 117 AMLGSFPSAAIFFGTYEYTKRTMIE-DWQINDTIT---HLSAGFLGDFISSFVYVPSEVL 172

Query: 145 RIRLQTQT-------GSGTN-AEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFL 196
           + RLQ Q         SG N +  +  ++ + K    ++L  G   T+ R+       F 
Sbjct: 173 KTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFSALQFA 232

Query: 197 VYEAL--IANQMNKRRGLERK-DIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTD--- 250
            YE    +A ++ ++ G + +  IP   L   GA +G    ++  P+DV+K+ +QT    
Sbjct: 233 FYEKFRQLAFKIEQKDGRDGELSIPNEILT--GACAGGLAGIITTPMDVVKTRVQTQQPP 290

Query: 251 ---------------NLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTML 286
                          N +     NSIS   +T+Y + G+  FF G GP  +
Sbjct: 291 SQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVGPRFV 341

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 127/309 (41%), Gaps = 54/309 (17%)

Query: 15  EEHPQHDNARVVK--DLLAGTAGGIAQVLVGQPFDTTKVRLQ----TSST-------PTT 61
           +EH +    +V K    +AG       V V  PF+  K R+Q     S+T       P  
Sbjct: 11  KEHEKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQ 70

Query: 62  AMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTL--- 118
           A+ V+ K   NEG +G  +G ++  +        Q G+N +   F+      ++ T    
Sbjct: 71  ALGVIFK---NEGVKGLQRGLVSAYV-------YQIGLNGSRLGFYEPIRTVLNKTFFPE 120

Query: 119 -------SLPQYYACGVTGGIVNSFLASPIEHVRIRLQT-----QTGSGTN-AEFKGPLE 165
                  ++      G T GI+ + + SP+  V+ R+Q+     + G  T+       L 
Sbjct: 121 SDPHKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLA 180

Query: 166 CIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEA----LIANQMNKRRGLERKDIPAWK 221
            I K      L RG+   ILR G G      +Y      L+ N +        K+  A  
Sbjct: 181 TIFKKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDI-------MKEGTALH 233

Query: 222 LCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGF 281
           L +   ++G  + +++ P DV+  + +  N +   +   I  + KT+   G IGA +KGF
Sbjct: 234 L-LSSTVTGLGVGIVMNPWDVV--LTRVYNQKGNTYKGPIDCMFKTIKIEG-IGALYKGF 289

Query: 282 GPTMLRAAP 290
           G  + R AP
Sbjct: 290 GAQLFRIAP 298

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 119/288 (41%), Gaps = 38/288 (13%)

Query: 21  DNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYK 80
           D+   +  L++G A G +  L   P DT K RLQ                AN G +G Y+
Sbjct: 2   DSQMFIASLVSGAAAGTSTDLAFFPIDTLKTRLQAKG----------GFFANGGYKGVYR 51

Query: 81  GTLTPLIGVGACVSLQFGVNEAMK--------RFFHHRNADMSSTLSLPQYYACGVTGGI 132
           G  + ++      SL F   ++MK        +         + TLS   +      G I
Sbjct: 52  GLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLS---HMVSSSFGEI 108

Query: 133 VNSFLASPIEHVRIRLQTQTGSGTNAEFKGPL--ECIKKLRHNKALLRGLTPTILREGHG 190
               +  P E ++ R QT   + +    +  L  E  + LR N  L RG + TI+RE   
Sbjct: 109 SACMVRVPAEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRN--LYRGWSTTIMREIPF 166

Query: 191 CGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTD 250
               F +YE  +  +  + +G ER     W+  + G ++G        PLDV+K+ +   
Sbjct: 167 TCIQFPLYE-YMKKRWAEVQGKERA--APWQGSVCGCIAGGIAAAATTPLDVLKTRIMLH 223

Query: 251 NLQKPKFGNSISS--VAKTLYANGGIGAFFKGFGPTMLRAAPANGATF 296
           +        S+S+  +AKT+    G+  FF G GP  +  + A GA F
Sbjct: 224 H-------KSVSALHLAKTMLQEEGVKVFFSGVGPRTMWIS-AGGAIF 263

 Score = 33.1 bits (74), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 35/77 (45%), Gaps = 15/77 (19%)

Query: 224 IFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGP 283
           + GA +GT+  L  +P+D +K+ +Q                    +ANGG    ++G G 
Sbjct: 11  VSGAAAGTSTDLAFFPIDTLKTRLQAKG---------------GFFANGGYKGVYRGLGS 55

Query: 284 TMLRAAPANGATFATFE 300
            ++ +AP+    F  ++
Sbjct: 56  AVVASAPSASLFFVAYD 72

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 28/63 (44%)

Query: 45  PFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMK 104
           P D  K R+       +A+ + + +L  EG + F+ G     + + A  ++  GV E + 
Sbjct: 212 PLDVLKTRIMLHHKSVSALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETVH 271

Query: 105 RFF 107
             F
Sbjct: 272 SLF 274

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 65/277 (23%), Positives = 107/277 (38%), Gaps = 20/277 (7%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPT-TAMEVVRKLLANEGPRGFYKGTLTPLIGVG 90
           G A GI   +V  P D  KVRLQ +  P  T   ++  +LANEG  G Y G    ++   
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQC 79

Query: 91  ACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQT 150
              +++FG  + +K     R    +    LP     G  GG+  +F     + V IR+Q 
Sbjct: 80  TYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGNF----ADVVNIRMQN 135

Query: 151 QTG--SGTNAEFKGPLECIKKL-RHN---KALLRGLTPTILREGHGCGTYFLVYEALIAN 204
            +   +     +K  ++ + K+ R+    K L  G  P ++R      +  + Y+     
Sbjct: 136 DSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVFKNY 195

Query: 205 QMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKS-VMQTDNLQKPKFGNSISS 263
            + K      K+       +   L  T +     P DV+K+ +M      +P       +
Sbjct: 196 LVTKLDFDASKNYTHLTASLLAGLVATTV---CSPADVMKTRIMNGSGDHQPALKILADA 252

Query: 264 VAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           V K      G    F+G+ P+  R  P     F   E
Sbjct: 253 VRKE-----GPSFMFRGWLPSFTRLGPFTMLIFFAIE 284

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 78/196 (39%), Gaps = 29/196 (14%)

Query: 118 LSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGP-----LECIKKLRH 172
           +  P +Y  G   GI  + +  P++  ++RLQ        A    P     LE I     
Sbjct: 13  IKYPWWY--GGAAGIFATMVTHPLDLAKVRLQA-------APMPKPTLFRMLESILANEG 63

Query: 173 NKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKL-CIF--GALS 229
              L  GL+  +LR+       F  Y+ L  N + +    E+    A+ L C    GA+ 
Sbjct: 64  VVGLYSGLSAAVLRQCTYTTVRFGAYDLLKENVIPR----EQLTNMAYLLPCSMFSGAIG 119

Query: 230 GTALWLMVYPLDVIKSVMQTDNL----QKPKFGNSISSVAKTLYANGGIGAFFKGFGPTM 285
           G A        DV+   MQ D+     ++  + N+I  V K     GG+   F G+ P M
Sbjct: 120 GLAGNFA----DVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNM 175

Query: 286 LRAAPANGATFATFEL 301
           +R      +   T+++
Sbjct: 176 VRGILMTASQVVTYDV 191

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 37/91 (40%), Gaps = 4/91 (4%)

Query: 21  DNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS-TPTTAMEVVRKLLANEGPRGFY 79
           D ++    L A    G+    V  P D  K R+   S     A++++   +  EGP   +
Sbjct: 203 DASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSGDHQPALKILADAVRKEGPSFMF 262

Query: 80  KGTLTPLIGVGACVSLQFGVNEAMKRFFHHR 110
           +G L     +G    L F   E +K+   HR
Sbjct: 263 RGWLPSFTRLGPFTMLIFFAIEQLKK---HR 290

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 59.3 bits (142), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 82/304 (26%), Positives = 111/304 (36%), Gaps = 64/304 (21%)

Query: 9   QLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS---STPTTAMEV 65
            L DD E  P      +    LAG  GGI         DT K R Q +         ++ 
Sbjct: 43  NLFDDYEHSP------IWHCFLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQA 96

Query: 66  VRKLLANEG-PRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFF---HHRNADMSSTLSLP 121
            R +   EG  RG Y G    ++G     ++ F   E  KR     +H N   S      
Sbjct: 97  YRTMFIEEGFRRGLYGGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDTFS------ 150

Query: 122 QYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLT 181
            +   G  G   +SF+  P E ++ RLQ Q G   N  F           +N   LR   
Sbjct: 151 -HLTAGFLGDFFSSFVYVPSEVLKTRLQLQ-GCYNNPHFNSG--------YNYKSLRNAI 200

Query: 182 PTILREGHGCGTYFLVYEALIANQM----------NKRRG----LERKDIPAWKLCI--- 224
            TI R   G    F  Y+A +A  +           K R     LE KDI    L I   
Sbjct: 201 ATIYRT-EGVAALFFGYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNE 259

Query: 225 --FGALSGTALWLMVYPLDVIKSVMQTD--------------NLQKP-KFGNSISSVAKT 267
              GA +G    ++  PLDV+K+ +QT               N+ KP    NSI    +T
Sbjct: 260 IVTGACAGGLAGILTTPLDVVKTRVQTQLPSQIDISTDTKIKNVSKPVTLTNSIFKSLRT 319

Query: 268 LYAN 271
           +Y +
Sbjct: 320 VYTS 323

>Scas_669.6
          Length = 373

 Score = 59.3 bits (142), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 78/278 (28%), Positives = 111/278 (39%), Gaps = 52/278 (18%)

Query: 47  DTTKVRLQTSS-TP-----TTAMEVVRKLLANEG-PRGFYKGTLTPLIGVGACVSLQFGV 99
           DT K R Q +  TP     TTA    R +   EG  RG Y G    ++G     ++ FG 
Sbjct: 73  DTVKTRQQGAPMTPKYKNMTTAY---RTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFGT 129

Query: 100 NEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQ-------T 152
            E  KR     +   + T+S   + + G+ G  V+SF+  P E ++ RLQ Q        
Sbjct: 130 YEWCKRKMIG-DLGFNDTVS---HLSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFF 185

Query: 153 GSGTNAE-FKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRG 211
            SG N    +  +  I      KAL  G   T+ R+       F  YE            
Sbjct: 186 QSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTAFK---- 241

Query: 212 LERKDIPAWKLCI-----FGALSGTALWLMVYPLDVIKSVMQT----------------- 249
           LE+KDI    L I      GA++G    ++  P+DVIK+ +QT                 
Sbjct: 242 LEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADINPNSATTVGAIS 301

Query: 250 ---DNLQKP-KFGNSISSVAKTLYANGGIGAFFKGFGP 283
              +   +P    NSI    K +Y + G+  FF G GP
Sbjct: 302 AKTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGP 339

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 55/139 (39%), Gaps = 13/139 (9%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQ-----------TSSTPTTAMEVVRKLLANEG 74
           V  L AG  G      V  P +  K RLQ           +     +    +R ++  EG
Sbjct: 147 VSHLSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEG 206

Query: 75  PRGFYKGTLTPLIGVGACVSLQFGVNEAMKRF-FHHRNADMSS-TLSLPQYYACGVTGGI 132
            +  + G    L       +LQFG  E  ++  F     D++   LS+P     G   G 
Sbjct: 207 VKALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLEKKDITKHNLSIPNEIFTGAIAGG 266

Query: 133 VNSFLASPIEHVRIRLQTQ 151
           +   + +P++ ++ RLQTQ
Sbjct: 267 LAGIITTPMDVIKTRLQTQ 285

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 65/283 (22%), Positives = 114/283 (40%), Gaps = 17/283 (6%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQ----TSSTPTTAMEVVRKLLANEGPRGFYKGTLT 84
            LAG+  G A+  +  PF+  K RLQ     S      + ++ K    +G    Y G   
Sbjct: 16  FLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGIGSIYVGCPA 75

Query: 85  PLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLA-SPIEH 143
            +IG  A   ++F   + +K          +  LS  +    G+  G++ S  A +P E 
Sbjct: 76  FIIGNTAKAGIRFLGFDTIKDMLRDSE---TGELSGTRGVIAGLGAGLLESVAAVTPFEA 132

Query: 144 VRIRLQTQTGSGT---NAEFKGPLECIKKLRHNK---ALLRGLTPTILREGHGCGTYFLV 197
           ++  L     S T   +   +G +     L  +K    L RG+ P  +R+          
Sbjct: 133 IKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAVRLGC 192

Query: 198 YEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKF 257
           Y  +     +     + K + +    + GA SG        PLD +K+ MQ+  L   K+
Sbjct: 193 YNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQS--LDSTKY 250

Query: 258 GNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
            ++++  A T++   G+  F+KG  P + R   + G  F  +E
Sbjct: 251 SSTMNCFA-TIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYE 292

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 3/81 (3%)

Query: 10  LIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQT--SSTPTTAMEVVR 67
           LI D  + P+          L G   GI  V    P DT K R+Q+  S+  ++ M    
Sbjct: 199 LIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQSLDSTKYSSTMNCFA 258

Query: 68  KLLANEGPRGFYKGTLTPLIG 88
            +   EG + F+KG  TP +G
Sbjct: 259 TIFKEEGLKTFWKGA-TPRLG 278

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 79/191 (41%), Gaps = 23/191 (12%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA------MEVVRKLLANEGPRGFYKGTL 83
           +AG  GGI       P DT K R+Q +   T        ++  + +    G R FY+G  
Sbjct: 300 VAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLG 359

Query: 84  TPLIGVGACVSLQFGVNEAMKRFFHHRNAD----------MSSTLSLPQYYACGVTGGIV 133
             ++GV    +L  G   A+KR++  R A+          MS+ + LP     G   G V
Sbjct: 360 VGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPM----GAFSGTV 415

Query: 134 NSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTILREGHG 190
            + +  PI  +R RLQ Q        + G  +  +K    +    L +GL PT+ +    
Sbjct: 416 GATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVCPA 475

Query: 191 CGTYFLVYEAL 201
               +L YE L
Sbjct: 476 VAISYLCYENL 486

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 96/241 (39%), Gaps = 18/241 (7%)

Query: 74  GPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHH-RNADMSSTLSLPQYYACGVTGGI 132
           G R FY G    +I V    +++FG  E  KR          +  LS    Y  G  GGI
Sbjct: 248 GLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSRLSTYVAGGLGGI 307

Query: 133 VNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN------KALLRGLTPTIL- 185
           +  F   PI+ ++ R+Q    +  +   +G    IK  +        +   RGL   IL 
Sbjct: 308 MAQFSVYPIDTLKFRIQC---APLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLGVGILG 364

Query: 186 ---REGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIF--GALSGTALWLMVYPL 240
                    GT+  +    I  + N   G+   ++    L +   GA SGT    +VYP+
Sbjct: 365 VFPYAALDLGTFSALKRWYITRRANA-LGISENEVVMSNLVVLPMGAFSGTVGATVVYPI 423

Query: 241 DVIKSVMQTD-NLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATF 299
           +++++ +Q       P   +    V +      G+   +KG  PT+ +  PA   ++  +
Sbjct: 424 NLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVCPAVAISYLCY 483

Query: 300 E 300
           E
Sbjct: 484 E 484

 Score = 34.7 bits (78), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%)

Query: 256 KFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELA 302
           K  + +   A +LY  GG+ AF+ G G  +++  P +   F +FELA
Sbjct: 231 KIRSPLVKAATSLYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFELA 277

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 39/94 (41%), Gaps = 9/94 (9%)

Query: 21  DNARVVKDLLA---GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA------MEVVRKLLA 71
           +N  V+ +L+    G   G     V  P +  + RLQ   T           +V RK + 
Sbjct: 395 ENEVVMSNLVVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQ 454

Query: 72  NEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKR 105
            EG  G YKG +  L  V   V++ +   E +KR
Sbjct: 455 REGLPGLYKGLVPTLAKVCPAVAISYLCYENLKR 488

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 82/186 (44%), Gaps = 24/186 (12%)

Query: 127 GVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILR 186
           G  GG+ ++    P++ ++ R Q QT  GT        + +K L     L RG  P+ +R
Sbjct: 11  GFAGGLSSAVALQPLDLLKTRFQ-QTKGGT------LWQTVKSLDTPWQLWRGTLPSAIR 63

Query: 187 EGHGCGTYFLVYEALIANQMNKRRGLERKD------------IPAWKLCIFGALSGTALW 234
              G   Y L    L+   + KR+  +  D            +  ++  + GA +   + 
Sbjct: 64  TSVGSALY-LSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVG 122

Query: 235 LMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGA 294
            +  P+ +IK V     L   K   SI+  AK++ A  GI  FF+GFGPT LR AP +G 
Sbjct: 123 YITMPITIIK-VRYESTLYNYK---SIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGL 178

Query: 295 TFATFE 300
               +E
Sbjct: 179 YVLLYE 184

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 81/189 (42%), Gaps = 26/189 (13%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLI- 87
           L+ G AGG++  +  QP D  K R Q  +   T  + V+ L   + P   ++GTL   I 
Sbjct: 8   LIGGFAGGLSSAVALQPLDLLKTRFQ-QTKGGTLWQTVKSL---DTPWQLWRGTLPSAIR 63

Query: 88  -GVGACVSLQFGVNEAMKRFFHHRNADMSSTL------SLPQ--YYACGVTGGIVN---S 135
             VG+ + L   +N         +  D + ++      +LPQ   Y   VTG        
Sbjct: 64  TSVGSALYLS-SLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVG 122

Query: 136 FLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKAL---LRGLTPTILREGHGCG 192
           ++  PI  +++R ++     T   +K   E  K +   + +    RG  PT LR+    G
Sbjct: 123 YITMPITIIKVRYES-----TLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSG 177

Query: 193 TYFLVYEAL 201
            Y L+YE L
Sbjct: 178 LYVLLYEKL 186

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 69/176 (39%), Gaps = 13/176 (7%)

Query: 42  VGQPFDTTKVRLQTSSTPTTAM-EVVRKLLANEGPRGFYKG----TLTPLIGVGACVSLQ 96
           +  P    KVR +++     ++ E  + + A EG RGF++G     L      G  V L 
Sbjct: 124 ITMPITIIKVRYESTLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLY 183

Query: 97  FGVNEAMKRFFHHRNADMSSTLSLPQYYACGV--TGGIVNSFLAS----PIEHVRIRLQT 150
             +   +          + S      Y +  +  T  I+++ +A+    P + ++ R+Q 
Sbjct: 184 EKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQL 243

Query: 151 QTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQM 206
           +        F   L  I    H   +  GL+  + R+    G  + +YE LI + M
Sbjct: 244 EPTKFKT--FWSTLTTIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYEELIKHFM 297

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 93/202 (46%), Gaps = 25/202 (12%)

Query: 126 CGVTGGIVNSFLASPIEHVRIRLQT----QTGSGTNAEFKGPL-ECIKKLRHN--KALLR 178
           CG T  +V +   +P+E ++ RLQ+    +  + T   FK  L E   ++R    K L +
Sbjct: 159 CGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFK 218

Query: 179 GLTPTILREGHGCGTYFLVYEALIAN-QMNKRRGLERKDI-PAWKLCIF----GALSGTA 232
           GL  T+ R+      Y+  YE    N  ++      R ++ P W   I     G++SG++
Sbjct: 219 GLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGSVSGSS 278

Query: 233 LWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANG------------GIGAFFKG 280
             L+ +P DV K+ MQ     + K  N++ S  K + A G            G GA + G
Sbjct: 279 AALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYGALYTG 338

Query: 281 FGPTMLRAAPANGATFATFELA 302
             P +++ AP+     +T+EL+
Sbjct: 339 LIPRVMKIAPSCAIMISTYELS 360

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 85/246 (34%), Gaps = 62/246 (25%)

Query: 111 NADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQT-----GSGTNAEFKGP-- 163
           + D SST  + +       G  + SF  +P++ VRIRLQ Q        G  +E KG   
Sbjct: 2   SGDRSSTAIMKERMLSACAGSFLTSFFLTPMDVVRIRLQQQVMLPDCSCGAASELKGSVG 61

Query: 164 --------------------------LECIKK-LRHNK---------------ALLRGLT 181
                                     ++C    LR N                 L RGL+
Sbjct: 62  TEVIYDHVVANKNSPKIFWQDVCFQDIQCKNSALRFNSTWEAFTKISEVEGLATLWRGLS 121

Query: 182 PTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLD 241
            T+L        YF  YE      M +     R   P+      GA +       V PL+
Sbjct: 122 ITLLMAIPANVVYFSGYE------MFRDHSPMRDSYPSLNPLFCGATARMVAATTVAPLE 175

Query: 242 VIKSVMQT------DNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGAT 295
           +IK+ +Q+      D   +  F + +      +  +GG    FKG   T+ R  P +   
Sbjct: 176 LIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEI-RSGGYKVLFKGLEITLWRDVPFSAIY 234

Query: 296 FATFEL 301
           + ++E 
Sbjct: 235 WGSYEF 240

>Scas_578.3*
          Length = 524

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/259 (22%), Positives = 103/259 (39%), Gaps = 12/259 (4%)

Query: 53  LQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNA 112
           L  +   +  ++ +R L    G R FY G    +  +    S++FG  E  KR   + + 
Sbjct: 258 LNLAKIRSPIIKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSG 317

Query: 113 D-MSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLR 171
           D + + LS  Q Y  G   G++      PI+ ++ R+Q     G N +    L    K  
Sbjct: 318 DKLVNDLSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEG-NLKGNALLISTAKEM 376

Query: 172 HNKALLRGLTPTILREGHGCGTY-------FLVYEALIANQMNKRRGLERKDIPAWKLCI 224
           + +  +R     +L    G   Y       F   +     + +K+  +  KD+    L +
Sbjct: 377 YKEGGIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLV 436

Query: 225 F--GALSGTALWLMVYPLDVIKSVMQTD-NLQKPKFGNSISSVAKTLYANGGIGAFFKGF 281
              GA SGT     VYP++++++ +Q       P        V        G+  F+KG 
Sbjct: 437 LPMGAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGL 496

Query: 282 GPTMLRAAPANGATFATFE 300
            PT+++  PA    +  +E
Sbjct: 497 VPTLVKVCPAVSIGYLCYE 515

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 83/206 (40%), Gaps = 30/206 (14%)

Query: 20  HDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP------TTAMEVVRKLLANE 73
           +D +++   +  G AG +AQ+ +  P DT K R+Q +            +   +++    
Sbjct: 322 NDLSKLQTYVAGGIAGVMAQISI-YPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEG 380

Query: 74  GPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNAD----------MSSTLSLPQY 123
           G R FY+G L   +G+    +L  G   A+K+++  R +           +S  L LP  
Sbjct: 381 GIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPM- 439

Query: 124 YACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAE------FKGPLECIKKLRHNKALL 177
              G   G V +    PI  +R RLQ Q   GT A       F+       K        
Sbjct: 440 ---GAFSGTVGATAVYPINLLRTRLQAQ---GTYAHPYTYTGFRDVFMQTLKREGVPGFY 493

Query: 178 RGLTPTILREGHGCGTYFLVYEALIA 203
           +GL PT+++        +L YE   A
Sbjct: 494 KGLVPTLVKVCPAVSIGYLCYEKFKA 519

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 43/103 (41%), Gaps = 17/103 (16%)

Query: 217 IPAWKLCIFGALSGTALWLMVYPLDVIKS--VMQTD---------------NLQKPKFGN 259
           I  +   I G LSG        PLD IK   + +TD                L   K  +
Sbjct: 206 IKGFGYFIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRS 265

Query: 260 SISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELA 302
            I    ++LY  GG+ AF+ G G ++ +  P +   F TFELA
Sbjct: 266 PIIKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELA 308

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/285 (22%), Positives = 113/285 (39%), Gaps = 17/285 (5%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQ----TSSTPTTAMEVVRKLLANEGPRGFYKGT 82
           K  +AG   G  +  V  PF+  K RLQ     S      + ++      +G    Y G 
Sbjct: 11  KSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKTQGIGSVYVGC 70

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLA-SPI 141
              ++G  A   ++F   + +K          +  LS P+    G+  G++ S +A +P 
Sbjct: 71  PAFIVGNTAKAGVRFLGFDTIKNLLRDPK---TGELSGPRGVIAGLGAGLLESVVAVTPF 127

Query: 142 EHVRIRLQTQTGSGT---NAEFKGPLECIKKLRHNK---ALLRGLTPTILREGHGCGTYF 195
           E ++  L     S T   +   KG L     L   +    L RG+ P  +R+        
Sbjct: 128 EAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMRQAANQAVRL 187

Query: 196 LVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKP 255
             Y  +     +     + K + +    + GA SG        P+D +K+ MQ+  L   
Sbjct: 188 GCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQS--LDSK 245

Query: 256 KFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           ++ ++I+    T++   G+ AF+KG  P + R   + G  F  +E
Sbjct: 246 RYSSTINCFT-TIFKEEGLKAFWKGATPRLGRLFLSGGIVFTVYE 289

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 84/206 (40%), Gaps = 18/206 (8%)

Query: 11  IDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVG-QPFDTTKVRL---QTSSTPTT----- 61
           I +L   P+       + ++AG   G+ + +V   PF+  K  L   + S+TP       
Sbjct: 91  IKNLLRDPKTGELSGPRGVIAGLGAGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGK 150

Query: 62  -AMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH-HRNADMSSTLS 119
             +     L+  +G  G Y+G L   +   A  +++ G    +K     + NA     LS
Sbjct: 151 GMLRNYTALVRKQGLSGLYRGVLPVSMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLS 210

Query: 120 LPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLEC---IKKLRHNKAL 176
               +  G   GIV  +   PI+ V+ R+Q    S  +  +   + C   I K    KA 
Sbjct: 211 SGLTFVVGAFSGIVTVYTTMPIDTVKTRMQ----SLDSKRYSSTINCFTTIFKEEGLKAF 266

Query: 177 LRGLTPTILREGHGCGTYFLVYEALI 202
            +G TP + R     G  F VYE ++
Sbjct: 267 WKGATPRLGRLFLSGGIVFTVYEKVL 292

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 34/81 (41%), Gaps = 3/81 (3%)

Query: 10  LIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQT--SSTPTTAMEVVR 67
           ++ D    P+          + G   GI  V    P DT K R+Q+  S   ++ +    
Sbjct: 196 MVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSKRYSSTINCFT 255

Query: 68  KLLANEGPRGFYKGTLTPLIG 88
            +   EG + F+KG  TP +G
Sbjct: 256 TIFKEEGLKAFWKGA-TPRLG 275

>Scas_721.27
          Length = 374

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/312 (22%), Positives = 127/312 (40%), Gaps = 62/312 (19%)

Query: 41  LVGQPFDTTKVRLQT----------SSTPTTAME-------------------VVRKLLA 71
           +V  PFD  K RLQ+          ++T T A                     ++  +  
Sbjct: 68  VVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYK 127

Query: 72  NEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHH--RNADMSSTLSLPQYYACGVT 129
            EG R  +KG    L+GV    S+ F      K  +     N   +  + L        T
Sbjct: 128 REGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQETPLIHL----MSAAT 183

Query: 130 GGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTILR 186
            G   S   +PI  ++ R+Q    +GT  ++K   +C+K +  ++    L RGL+ + L 
Sbjct: 184 AGWATSTATNPIWMIKTRVQLDK-AGTTRKYKNSWDCLKTVLKSEGIYGLYRGLSASYLG 242

Query: 187 EGHGCGTYFLVYEALIANQMNKRRGLER------------KDIPAWKLCIFGALSGTALW 234
              G    +L+YE +    + K+R +E+            + I  W  C     +G A +
Sbjct: 243 SIEGI-LQWLLYEQM--KHLIKQRSIEKFGHEGQLTKSRTEKIKEW--CQRSGSAGVAKF 297

Query: 235 ---LMVYPLDVIKSVMQTDNLQ--KPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAA 289
              ++ YP +V+++ ++   ++  KPK+   + S  + +    G+ + + G  P ++R  
Sbjct: 298 IASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQSF-RVIIKEEGLASMYSGLTPHLMRTV 356

Query: 290 PANGATFATFEL 301
           P +   F T+EL
Sbjct: 357 PNSIIMFGTWEL 368

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 83/205 (40%), Gaps = 33/205 (16%)

Query: 24  RVVKDL------LAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA------MEVVRKLLA 71
           R  KDL      +AG   G+A      P DT K R+Q +   T         +  + +  
Sbjct: 340 RDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFR 399

Query: 72  NEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYAC----- 126
             G R FY+G    ++G+    +L  G   A+K+++  + A    TL+LPQ         
Sbjct: 400 EGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQA---KTLNLPQDQVTLSNLV 456

Query: 127 ----GVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAE------FKGPLECIKKLRHNKAL 176
               G   G V + +  PI  +R RLQ Q   GT A       FK  L    +    + L
Sbjct: 457 VLPMGAFSGTVGASVVYPINLLRTRLQAQ---GTYAHPYVYNGFKDVLLKTLEREGYQGL 513

Query: 177 LRGLTPTILREGHGCGTYFLVYEAL 201
            +GL PT+ +        +L YE L
Sbjct: 514 FKGLVPTLAKVCPAVSISYLCYENL 538

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 74/324 (22%), Positives = 122/324 (37%), Gaps = 49/324 (15%)

Query: 22  NARVVKDLLAG----TAGGIAQVL---VGQPFDTTKVRLQTSSTPTTAM----------- 63
           +  ++ D + G     AGGI+ V+      PFD  KV L   +  ++ +           
Sbjct: 217 DVTLINDFIRGFGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKN 276

Query: 64  -------------EVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHH- 109
                        + V+ L    G + FY G    +I V    S++FG  E  K+     
Sbjct: 277 PNADINKISSPLAKAVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKL 336

Query: 110 RNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQ----TQTGSGTNAEFKGPLE 165
                +  LS    Y  G   G+   F   PI+ ++ R+Q         G N  F+   +
Sbjct: 337 EGCRDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKD 396

Query: 166 CIKK--LRHNKALLRGLTPTIL----REGHGCGTYFLVYEALIANQMNKRRGLERKDIPA 219
             ++  LR      RG+T  I+          GT+  + +  IA Q  K   L +  +  
Sbjct: 397 MFREGGLR---LFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQA-KTLNLPQDQVTL 452

Query: 220 WKLCIF--GALSGTALWLMVYPLDVIKSVMQTD-NLQKPKFGNSISSVAKTLYANGGIGA 276
             L +   GA SGT    +VYP++++++ +Q       P   N    V        G   
Sbjct: 453 SNLVVLPMGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQG 512

Query: 277 FFKGFGPTMLRAAPANGATFATFE 300
            FKG  PT+ +  PA   ++  +E
Sbjct: 513 LFKGLVPTLAKVCPAVSISYLCYE 536

 Score = 35.4 bits (80), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 51/132 (38%), Gaps = 19/132 (14%)

Query: 189 HGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVM- 247
           H   +YF ++   +         L    I  +   I G +SG        P D +K  + 
Sbjct: 197 HTAYSYFYLFNEDVDLSSEGDVTLINDFIRGFGFFIAGGISGVISRTCTAPFDRLKVFLI 256

Query: 248 ------------QTDNLQKP------KFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAA 289
                       +TD L K       K  + ++   K+LY  GGI AF+ G G  +++  
Sbjct: 257 ARTDLSSILLNSKTDLLAKNPNADINKISSPLAKAVKSLYRQGGIKAFYVGNGLNVIKVF 316

Query: 290 PANGATFATFEL 301
           P +   F +FE+
Sbjct: 317 PESSIKFGSFEV 328

 Score = 32.0 bits (71), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 35/83 (42%), Gaps = 6/83 (7%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM------EVVRKLLANEGPRGFYKGTLTP 85
           G   G     V  P +  + RLQ   T           +V+ K L  EG +G +KG +  
Sbjct: 461 GAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPT 520

Query: 86  LIGVGACVSLQFGVNEAMKRFFH 108
           L  V   VS+ +   E +K+F +
Sbjct: 521 LAKVCPAVSISYLCYENLKKFMN 543

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 78/310 (25%), Positives = 128/310 (41%), Gaps = 68/310 (21%)

Query: 45  PFDTTKVRLQT----SSTPTTAME---------VVRKLL-------------ANEGPRGF 78
           PFD  K RLQ+    +   + AM+         V R LL               EG R  
Sbjct: 70  PFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRSL 129

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQ-----YYACGVTGGIV 133
           +KG    L+GV    S+ F      K  +       S TL+  Q     +     T G  
Sbjct: 130 FKGLGPNLVGVIPARSINFLTYGTTKDIY-------SRTLNNGQEAPWIHLLAAATAGWA 182

Query: 134 NSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALL---RGLTPTILREGHG 190
            S + +PI  V+ RLQ    +GT   +K  L+CIK +  N+ +L   +GL+ + L    G
Sbjct: 183 TSTVTNPIWLVKTRLQLDK-AGTKT-YKNSLDCIKSVVKNEGVLGLYKGLSASYLGSVEG 240

Query: 191 CGTYFLVYEALIANQMNKRRGLER------------KDIPAWKLCIFGALSGTALW---L 235
              + L YE +   ++ K R +E+              +  W  C     +G A +   +
Sbjct: 241 ILQWIL-YEQM--KRIIKERSIEKFGHIHEDAKSTSDKVKEW--CQRSGSAGLAKFVASI 295

Query: 236 MVYPLDVIKSVMQ---TDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPAN 292
           + YP +V+++ ++   T+N  K K+   + S  + +    G+ + + G  P +LR  P +
Sbjct: 296 VTYPHEVVRTRLRQAPTEN-GKLKYTGLVQSF-RVIIKEEGLVSMYSGLTPHLLRTVPNS 353

Query: 293 GATFATFELA 302
              F T+EL 
Sbjct: 354 IIMFGTWELV 363

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 73/313 (23%), Positives = 117/313 (37%), Gaps = 48/313 (15%)

Query: 21  DNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP--------TTAMEVVRKLLAN 72
            N    K LLAG   G+    +  P DT K+RLQ   TP        +  MEV R ++ N
Sbjct: 12  QNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQL--TPANGLKPFGSQVMEVARSMIKN 69

Query: 73  EGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFF--HHRNADMSSTLSLPQYYACGVTG 130
           EG R F+KG +   +      S QF       R+       A + S +        G   
Sbjct: 70  EGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLV-------VGAFA 122

Query: 131 GIVNSFLASPIEHVRIRL----QTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILR 186
           GI +S ++ P + +R RL    Q  + S T       +  I KL       +G   ++  
Sbjct: 123 GITSSIVSYPFDVLRTRLVANNQMHSMSITR-----EVRDIWKLEGLPGFFKGSIASMTT 177

Query: 187 EGHGCGTYFLVYEAL-IANQMNKRRGLERKDIPAWKLCIF----GALSGTALWLMVYPLD 241
                   F  YE + I    N++     K    W+L       G + G    ++ +PL+
Sbjct: 178 ITLTASIMFGTYETIRIYCDENEKTTAAHKK---WELATLNHSAGTIGGVIAKIITFPLE 234

Query: 242 VIKSVMQTDNLQK-PKF-----------GNSISSVAKTLYANGGIGAFFKGFGPTMLRAA 289
            I+  MQ  N +   KF           G   + +   +    G+ + ++G    + +  
Sbjct: 235 TIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTI 294

Query: 290 PANGATFATFELA 302
           P    +F  +E A
Sbjct: 295 PTTFVSFWGYETA 307

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 57.0 bits (136), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 76/321 (23%), Positives = 124/321 (38%), Gaps = 49/321 (15%)

Query: 25  VVKDLLAG----TAGGIAQVL---VGQPFDTTKV----RLQTSSTPTTAME--------- 64
           ++ D + G     AGGI+ V+      PFD  KV    R   SST   + E         
Sbjct: 193 LINDFIKGFGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHA 252

Query: 65  -----------VVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHH-RNA 112
                       +  L    G + FY G     + V    S++FG  E  K+      N 
Sbjct: 253 KPNKLRSPLVKAIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENC 312

Query: 113 DMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRH 172
             +  LS    +  G   G+   F   PI+ ++ R+Q    +  NAE KG    I+  + 
Sbjct: 313 KDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQC---APLNAELKGRKLMIQTAKE 369

Query: 173 N------KALLRGLTPTIL----REGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKL 222
                  K   RG+T  +L          GT+ ++ +  I+++  K    E +D+    L
Sbjct: 370 MYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKE-EDVELSNL 428

Query: 223 CIF--GALSGTALWLMVYPLDVIKSVMQTD-NLQKPKFGNSISSVAKTLYANGGIGAFFK 279
            +   GA SGT    +VYP++++++ +Q       P   +    V        G    FK
Sbjct: 429 VVLPMGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFK 488

Query: 280 GFGPTMLRAAPANGATFATFE 300
           G  PT+ +  PA   ++  +E
Sbjct: 489 GLVPTLAKVCPAVSISYLCYE 509

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 84/208 (40%), Gaps = 33/208 (15%)

Query: 21  DNARVVKDL------LAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLL---A 71
           +N +  KDL      +AG   G+       P DT K R+Q +  P  A    RKL+   A
Sbjct: 310 ENCKDTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCA--PLNAELKGRKLMIQTA 367

Query: 72  NE-----GPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFF----------HHRNADMSS 116
            E     G + FY+G    ++G+    +L  G    +K+++             + ++S+
Sbjct: 368 KEMYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSN 427

Query: 117 TLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK-- 174
            + LP     G   G   + +  PI  +R RLQ Q        + G  + + K    +  
Sbjct: 428 LVVLPM----GAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGY 483

Query: 175 -ALLRGLTPTILREGHGCGTYFLVYEAL 201
             L +GL PT+ +        +L YE L
Sbjct: 484 PGLFKGLVPTLAKVCPAVSISYLCYENL 511

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 38/90 (42%), Gaps = 1/90 (1%)

Query: 213 ERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSIS-SVAKTLYAN 271
           + KD+      I G L+G      VYP+D +K  MQ   L     G  +    AK +Y  
Sbjct: 314 DTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTE 373

Query: 272 GGIGAFFKGFGPTMLRAAPANGATFATFEL 301
           GG+  F++G    +L   P       TF +
Sbjct: 374 GGLKLFYRGVTVGVLGIFPYAALDLGTFSM 403

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%)

Query: 267 TLYANGGIGAFFKGFGPTMLRAAPANGATFATFEL 301
           +LY  GGI +F+ G G   L+  P +   F +FE+
Sbjct: 267 SLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEI 301

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 81/288 (28%), Positives = 114/288 (39%), Gaps = 35/288 (12%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEG---PRGFYKGTLTP 85
           LL   + GI ++ V  P DT   RL ++ T  T+ + + +++  +    P G    TL P
Sbjct: 14  LLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPLGKRLFTLFP 73

Query: 86  LIGVGACVSL-----QFGVNEAMKRFFH-HRNADMSS-----TLSLPQYYACGVTGGIVN 134
            +G  A   +     ++G       F + H   D  +     T    +  A G   GI  
Sbjct: 74  GLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAAGSLIGIGE 133

Query: 135 SFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK--ALLRGLTPTILREGHGCG 192
             L  P++ ++I+ QT   S     FKG    IK LR      L RG   T  R   G  
Sbjct: 134 IVLL-PLDVLKIKRQTNPES-----FKGR-GFIKILRDEGLFNLYRGWGWTAARNAPGSF 186

Query: 193 TYFLVYEALIANQMNKRRGLERKDIP--AWKLCIFGALSGTALWLMVY-PLDVIKSVMQT 249
             F        N   K   L  KD     W      ++ G    L+V  PLDVIK+ +Q 
Sbjct: 187 ALF------GGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQN 240

Query: 250 DNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFA 297
            N   P+ G  I    K    N G+ AFFKG  P +L   P    +FA
Sbjct: 241 RNFDNPESGLRI---VKNTLKNEGVTAFFKGLTPKLLTTGPKLVFSFA 285

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 19  QHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS--TPTTAMEVVRKLLANEGPR 76
            +  A   ++ ++   G  + ++V  P D  K R+Q  +   P + + +V+  L NEG  
Sbjct: 204 DYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTLKNEGVT 263

Query: 77  GFYKGTLTPLIGVGACVSLQFGVNEAM 103
            F+KG    L+  G  +   F + +++
Sbjct: 264 AFFKGLTPKLLTTGPKLVFSFALAQSL 290

>Kwal_23.3965
          Length = 307

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 87/183 (47%), Gaps = 16/183 (8%)

Query: 122 QYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLR 178
           Q    G   GI    + +P++ ++IRLQ Q  +   A++ G L   K+L      +AL +
Sbjct: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLAN--EAQYGGILVTFKRLVRQEGVRALWK 73

Query: 179 GLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAW-KLCIFGALSGTALWLMV 237
           G  P +        T F  Y  L  N++     L +  +PA     + GALSGT   +  
Sbjct: 74  GNVPAMAMYILYGSTQFTSYAIL--NKL-----LSKSQLPAQIHTGMVGALSGTCSAIAS 126

Query: 238 YPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFA 297
           YP DV+++    ++ ++    +++ S A+ ++ + G   FFKG   +++  A A  +  A
Sbjct: 127 YPCDVLRTRFIANHSREL---STMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSILA 183

Query: 298 TFE 300
           T+E
Sbjct: 184 TYE 186

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 11/127 (8%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRL------QTSSTPTTAMEVVRKLLANEGPRGFYKGTL 83
           + G   G    +   P D  + R       + S+  +TA E+ R    +EG RGF+KG  
Sbjct: 113 MVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWR----HEGFRGFFKGVS 168

Query: 84  TPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEH 143
           + ++ +    S      E++K F   R    SS + L +  A  V  GIV+  +  PI+ 
Sbjct: 169 SSIVSIAVATSSILATYESVKIFCEQRPDRDSSVIQLLESSA-SVIAGIVSKTIVFPIDT 227

Query: 144 VRIRLQT 150
           VR R Q 
Sbjct: 228 VRKRYQV 234

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/303 (19%), Positives = 115/303 (37%), Gaps = 43/303 (14%)

Query: 25  VVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----MEVVRKLLANEGPRGFYK 80
           V + L+AG   GI+  +V  P DT K+RLQ            +   ++L+  EG R  +K
Sbjct: 14  VFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWK 73

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTG---GIVNSFL 137
           G +  +       S QF     + +          S   LP     G+ G   G  ++  
Sbjct: 74  GNVPAMAMYILYGSTQFTSYAILNKLL--------SKSQLPAQIHTGMVGALSGTCSAIA 125

Query: 138 ASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKL-RHN--KALLRGLTPTILREGHGCGTY 194
           + P + +R R      +  + E    L   +++ RH   +   +G++ +I+       + 
Sbjct: 126 SYPCDVLRTRFI----ANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSI 181

Query: 195 FLVYEA--LIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNL 252
              YE+  +   Q   R     + + +    I G +S T    +V+P+D ++   Q  + 
Sbjct: 182 LATYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKT----IVFPIDTVRKRYQVIDW 237

Query: 253 QK---PKFGNSISSVAKT------------LYANGGIGAFFKGFGPTMLRAAPANGATFA 297
           Q+   P   N      K+            +    G+ A + G+   + ++ P+   +  
Sbjct: 238 QQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLG 297

Query: 298 TFE 300
            +E
Sbjct: 298 VYE 300

 Score = 34.3 bits (77), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 215 KDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGI 274
           +++P ++  + G LSG +  ++  PLD +K  +Q     + ++G  + +  K L    G+
Sbjct: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTF-KRLVRQEGV 68

Query: 275 GAFFKGFGPTM 285
            A +KG  P M
Sbjct: 69  RALWKGNVPAM 79

>Scas_489.4
          Length = 297

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/283 (20%), Positives = 115/283 (40%), Gaps = 17/283 (6%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQ----TSSTPTTAMEVVRKLLANEGPRGFYKGTLT 84
            +AG   G  +  +  PF+  K RLQ    TS+     + ++      +G    Y G   
Sbjct: 14  FIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNTAKTQGTGAIYVGCPA 73

Query: 85  PLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLA-SPIEH 143
            ++G  A   ++F   + +K         ++  LS P+    G+  G++ S +A +P E 
Sbjct: 74  FIVGNTAKAGIRFLGFDTIKNMLRD---PVTGELSGPRGVVAGLGAGLLESVVAVTPFEA 130

Query: 144 VRIRL---QTQTGSGTNAEFKGPLECIKKLRHNKALL---RGLTPTILREGHGCGTYFLV 197
           ++  L   +           +G L     L  ++ ++   RG+ P  +R+          
Sbjct: 131 IKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAANQAVRLGC 190

Query: 198 YEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKF 257
           Y  +     +     + + + +    I GA SG        P+D +K+ MQ+  L   K+
Sbjct: 191 YNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQS--LDATKY 248

Query: 258 GNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
            ++++  AK ++   G+  F+KG  P + R   + G  F  +E
Sbjct: 249 TSTVNCFAK-IFKEEGLKTFWKGATPRLGRLILSGGIVFTIYE 290

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 59/138 (42%), Gaps = 8/138 (5%)

Query: 69  LLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFH-HRNADMSSTLSLPQYYACG 127
           L+ ++G  G Y+G L   +   A  +++ G    +K     + NA     LS    +  G
Sbjct: 160 LVRDQGIMGLYRGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVG 219

Query: 128 VTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTI 184
              G+V  +   PI+ V+ R+Q+   +    ++   + C  K+      K   +G TP +
Sbjct: 220 AFSGVVTVYTTMPIDTVKTRMQSLDAT----KYTSTVNCFAKIFKEEGLKTFWKGATPRL 275

Query: 185 LREGHGCGTYFLVYEALI 202
            R     G  F +YE ++
Sbjct: 276 GRLILSGGIVFTIYENVL 293

>Scas_562.12
          Length = 300

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 117/293 (39%), Gaps = 39/293 (13%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEG---PRGFYKGT 82
           V  LL   + GI ++ V  P DT   RL ++ T       + +++  E    P G    T
Sbjct: 11  VARLLGSASAGILEIGVFHPVDTISKRLMSNHTKIGNSHELNRVIFREHFSEPLGKRLFT 70

Query: 83  LTPLIGVGACVSL-----QFGVNEAMKRFFH-HRNADMSSTL------SLPQYYACGVTG 130
           L P +G  A   +     ++G       F + H   D  S        ++    A  + G
Sbjct: 71  LFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKAMRSATAGSLIG 130

Query: 131 GIVNSFLASPIEHVRIRLQTQTGSGTNAE-FKGPLECIKKLRHNKA--LLRGLTPTILRE 187
             +   +  P++ ++I+ QT      N E FKG    +K L+      L RG   T  R 
Sbjct: 131 --IGEIVLLPLDVLKIKRQT------NPEAFKGR-GFVKILKDEGIFNLYRGWGWTAARN 181

Query: 188 GHGCGTYFLVYEALIANQMNKRR--GLERKDIPAWKLCIFGALSGTALWLMVY-PLDVIK 244
             G       +     N   K    GLE     +W      ++ G +  L+V  PLDVIK
Sbjct: 182 APGS------FALFGGNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIK 235

Query: 245 SVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFA 297
           + +Q  +   P+ G +I    K  + N GI AFFKG  P +L   P    +FA
Sbjct: 236 TRIQNRSFDNPETGLTI---VKNTFKNEGITAFFKGLTPKLLTTGPKLVFSFA 285

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 46/99 (46%), Gaps = 5/99 (5%)

Query: 7   SPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS--TPTTAME 64
           + + I  LE++ Q   A   ++ ++   G    ++V  P D  K R+Q  S   P T + 
Sbjct: 195 AKEYILGLEDYSQ---ASWSQNFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNPETGLT 251

Query: 65  VVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAM 103
           +V+    NEG   F+KG    L+  G  +   F + +++
Sbjct: 252 IVKNTFKNEGITAFFKGLTPKLLTTGPKLVFSFALAQSL 290

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 88/215 (40%), Gaps = 19/215 (8%)

Query: 4   EFPSPQLIDDLEEHPQ--HDNARVVK--DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP 59
           +F S +L   L  H +  H  + + K    +AG  GG+       P DT K R+Q +   
Sbjct: 290 KFGSFELAKQLMAHLEGVHHTSELSKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLD 349

Query: 60  TTA------MEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNAD 113
           T        +   R++  + G + FY+G    ++G+    +L  G   A+K+++  R A 
Sbjct: 350 TALKGNELLISTARQMYRDGGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAK 409

Query: 114 MSS------TLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECI 167
           M+       T+S       G   G V + +  PI  +R RLQ Q        + G  + +
Sbjct: 410 MTGVPVDQVTISNFIVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVL 469

Query: 168 KKLRHN---KALLRGLTPTILREGHGCGTYFLVYE 199
            K       + L +GL P + +        +L YE
Sbjct: 470 WKTVQREGYQGLFKGLVPNLAKVCPAVSISYLCYE 504

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 74/310 (23%), Positives = 116/310 (37%), Gaps = 42/310 (13%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKV----RLQTSST------------PTTAMEVVRK---- 68
            +AG   G+       PFD  KV    R   SST            P   +  ++     
Sbjct: 199 FIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIK 258

Query: 69  ----LLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHH-RNADMSSTLSLPQY 123
               L    G R FY G    +I V    +++FG  E  K+   H      +S LS    
Sbjct: 259 AATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFST 318

Query: 124 YACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN------KALL 177
           Y  G  GG+V  F   PI+ ++ R+Q    +  +   KG    I   R        K   
Sbjct: 319 YIAGGMGGVVAQFSVYPIDTLKYRVQC---APLDTALKGNELLISTARQMYRDGGLKLFY 375

Query: 178 RGLTPTIL----REGHGCGTYFLVYEALIANQMNKRRGL--ERKDIPAWKLCIFGALSGT 231
           RG+T  ++          GT+  + +  IA Q  K  G+  ++  I  + +   GA SGT
Sbjct: 376 RGVTVGVMGIFPYAALDLGTFSALKKWYIARQA-KMTGVPVDQVTISNFIVLPMGAFSGT 434

Query: 232 ALWLMVYPLDVIKSVMQTD-NLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAP 290
               +VYP++++++ +Q       P        V        G    FKG  P + +  P
Sbjct: 435 VGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNLAKVCP 494

Query: 291 ANGATFATFE 300
           A   ++  +E
Sbjct: 495 AVSISYLCYE 504

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%)

Query: 244 KSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELA 302
           K +M+  N    K  + +   A TLY  GGI AF+ G G  +++  P +   F +FELA
Sbjct: 239 KVLMKNPNADISKIKSPLIKAATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELA 297

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 34/80 (42%), Gaps = 6/80 (7%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSST---PTTAM---EVVRKLLANEGPRGFYKGTLTP 85
           G   G     V  P +  + RLQ   T   P T     +V+ K +  EG +G +KG +  
Sbjct: 429 GAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPN 488

Query: 86  LIGVGACVSLQFGVNEAMKR 105
           L  V   VS+ +   E  KR
Sbjct: 489 LAKVCPAVSISYLCYENFKR 508

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 121/297 (40%), Gaps = 29/297 (9%)

Query: 21  DNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYK 80
           +  R    L+ G +GG+   ++ QPFD  K RLQ   T T    + + L + E P   ++
Sbjct: 3   EQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQQDKTST----LWKTLKSIETPSQLWR 58

Query: 81  GTLTPLI--GVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQ--YYACGVTGGIVNS- 135
           G L   I   VG+ + L   +N   +     +N   + +  LPQ   Y    +G +  + 
Sbjct: 59  GALPSCIRTSVGSAMYLTM-LNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRAL 117

Query: 136 --FLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGT 193
              +  PI  +++R ++     T+  +      I +    +   RG   T LR+    G 
Sbjct: 118 TGLITMPITVIKVRYESTLYQYTSLRY--ATSHIFRTEGLRGFFRGFGATALRDAPYAGL 175

Query: 194 YFLVYE-------ALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWL---MVYPLDVI 243
           Y L Y+        L+ + + K     R    A  L I G+ + +A  +   +  P D +
Sbjct: 176 YMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTL-INGSSAFSAAVIATSITAPFDTV 234

Query: 244 KSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           K+ MQ   L+  KF +S +S    +     +   F G    + R A + G  +  +E
Sbjct: 235 KTRMQ---LEPAKF-HSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGIAWGIYE 287

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/293 (19%), Positives = 113/293 (38%), Gaps = 32/293 (10%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAME----VVRKLLANEGPRGFYKGTL 83
            ++AG+  G+   +   P DT K+R Q         +     VR ++  EG R  +KG +
Sbjct: 21  SVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTIMKEEGLRALWKGNI 80

Query: 84  TPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEH 143
                     ++QFG        +  +    S      Q    G   G+ +S ++ P++ 
Sbjct: 81  PATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQ---GQTLTVGALAGMTSSVVSYPLDL 137

Query: 144 VRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTILREGHGCGTYFLVYEA 200
           +R RL     + T+       EC +++  N   +    G++  +          FL YE 
Sbjct: 138 LRTRL---IANRTSHRTSVAEEC-RQMWLNEGVRGFFTGISTAMTTVTLSTAIMFLTYET 193

Query: 201 LIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKP----- 255
           +     N  +    + + A    I G +S T    MV+P+D ++  MQ  N ++      
Sbjct: 194 VNIVCENHEKEFWSRPVSASSGIIAGFVSKT----MVFPIDTLRRRMQVMNSKRTVHFTK 249

Query: 256 --------KFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
                   ++ +S + + K L    G+ A ++G    + ++ P    +   +E
Sbjct: 250 FPAVYHEYRYKSSTAIIYKIL-RQEGVSALYRGLTMGLCKSVPTTAISLFVYE 301

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 73/189 (38%), Gaps = 19/189 (10%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP--TTAMEVVRKLLANEGPRGFYKGTLT 84
           + L  G   G+   +V  P D  + RL  + T   T+  E  R++  NEG RGF+ G  T
Sbjct: 116 QTLTVGALAGMTSSVVSYPLDLLRTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGIST 175

Query: 85  PLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHV 144
            +  V    ++ F   E +     +   +     S P   + G+  G V+  +  PI+ +
Sbjct: 176 AMTTVTLSTAIMFLTYETVNIVCENHEKEF---WSRPVSASSGIIAGFVSKTMVFPIDTL 232

Query: 145 RIRLQTQTGSGT-----------NAEFKGPLECIKKLRHNK---ALLRGLTPTILREGHG 190
           R R+Q      T              +K     I K+   +   AL RGLT  + +    
Sbjct: 233 RRRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPT 292

Query: 191 CGTYFLVYE 199
                 VYE
Sbjct: 293 TAISLFVYE 301

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/191 (19%), Positives = 76/191 (39%), Gaps = 20/191 (10%)

Query: 117 TLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN--- 173
           T+S       G   G+      +P++ V+IR Q Q       ++KG    ++ +      
Sbjct: 15  TVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQ--EDKYKGIASTVRTIMKEEGL 72

Query: 174 KALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAW----KLCIFGALS 229
           +AL +G  P            ++VY A+     +    +     P +    +    GAL+
Sbjct: 73  RALWKGNIP--------ATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQGQTLTVGALA 124

Query: 230 GTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAA 289
           G    ++ YPLD++++ +  +   +     S++   + ++ N G+  FF G    M    
Sbjct: 125 GMTSSVVSYPLDLLRTRLIAN---RTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVT 181

Query: 290 PANGATFATFE 300
            +    F T+E
Sbjct: 182 LSTAIMFLTYE 192

>Scas_702.10
          Length = 302

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/274 (21%), Positives = 107/274 (39%), Gaps = 13/274 (4%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM-EVVRKLLANEGPRGFYKGTLTPLIGVG 90
           G A GI   ++  P D  KVRLQ +  P   +  ++  +L NE   G Y G    ++   
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRMLTTILRNENVMGLYSGLSAAVLRQC 75

Query: 91  ACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQT 150
              +++FG  + MK     +         LP     G  GG+V +F  + + ++R++  +
Sbjct: 76  TYTTVRFGAYDLMKENLIPQGHINDMVYLLPCSMFSGAIGGLVGNF--ADVVNIRMQNDS 133

Query: 151 QTGSGTNAEFKGPLECIKKLRHN----KALLRGLTPTILREGHGCGTYFLVYEALIANQM 206
                    ++  ++ + K+  +    K LL G  P ++R      +  + Y+      +
Sbjct: 134 ALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVTYDVFKNYLV 193

Query: 207 NKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAK 266
            K     +K+       +   L  T +     P DVIK+ +   N  K +  ++I  +  
Sbjct: 194 TKLSFDPKKNSTHLSASLLAGLVATTI---CSPADVIKTRIM--NAHKTESESAIKILTS 248

Query: 267 TLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
            +   G     F+G+ P   R  P     F   E
Sbjct: 249 AIKKEGP-SFMFRGWLPIFTRLGPFTMLIFFAIE 281

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 78/197 (39%), Gaps = 25/197 (12%)

Query: 115 SSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGP-----LECIKK 169
           +  +  P +Y  G   GI    +  P++  ++RLQ        A    P     L  I +
Sbjct: 6   TKQIKYPWWY--GGAAGIFACVMTHPLDLAKVRLQA-------APLPKPTLGRMLTTILR 56

Query: 170 LRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIF-GAL 228
             +   L  GL+  +LR+       F  Y+ +  N + +  G     +      +F GA+
Sbjct: 57  NENVMGLYSGLSAAVLRQCTYTTVRFGAYDLMKENLIPQ--GHINDMVYLLPCSMFSGAI 114

Query: 229 SGTALWLMVYPLDVIKSVMQTDNLQKPK----FGNSISSVAKTLYANGGIGAFFKGFGPT 284
            G    L+    DV+   MQ D+  KP+    + N+I  V K     GGI     G+ P 
Sbjct: 115 GG----LVGNFADVVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPN 170

Query: 285 MLRAAPANGATFATFEL 301
           M+R      +   T+++
Sbjct: 171 MVRGVLMTASQVVTYDV 187

 Score = 32.3 bits (72), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 45/103 (43%), Gaps = 9/103 (8%)

Query: 10  LIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS--STPTTAMEVVR 67
           L+  L   P+ ++  +   LLAG    +    +  P D  K R+  +  +   +A++++ 
Sbjct: 192 LVTKLSFDPKKNSTHLSASLLAG----LVATTICSPADVIKTRIMNAHKTESESAIKILT 247

Query: 68  KLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHR 110
             +  EGP   ++G L     +G    L F   E +K+   HR
Sbjct: 248 SAIKKEGPSFMFRGWLPIFTRLGPFTMLIFFAIEQLKK---HR 287

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 79/209 (37%), Gaps = 52/209 (24%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKV---------------------------RLQTSSTPTT 61
           L+AGT  GI + L   PF+  K                            ++ T STP  
Sbjct: 79  LIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVA 138

Query: 62  AME----VVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSST 117
            +E     V+ +    GP  F +GT   +    A  S+QF    A KR    RN   SS 
Sbjct: 139 RIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARNDKASSV 198

Query: 118 LSLPQYYACGVTGGIVNSF----LASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN 173
           ++           G+  SF    +  PI+ V+ R+ +Q       E+K  L C+ ++   
Sbjct: 199 IT-----------GLATSFTLVAMTQPIDVVKTRMMSQNA---KTEYKNTLNCMYRIFVQ 244

Query: 174 KAL---LRGLTPTILREGHGCGTYFLVYE 199
           + +    +G     ++ G   G  F VYE
Sbjct: 245 EGMATFWKGSIFRFMKVGISGGLTFTVYE 273

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 81/203 (39%), Gaps = 38/203 (18%)

Query: 126 CGVTGGIVNSFLASPIEHVRIRL-------------------------QTQTGSGTNAEF 160
            G   GIV S    P E+++  L                         +  T S   A  
Sbjct: 81  AGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVARI 140

Query: 161 KGPLECIKKLRHNK---ALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDI 217
           +  L  +K +   +   A ++G T TI R+       F  Y A        +R L+ ++ 
Sbjct: 141 EKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAF-------KRLLQARND 193

Query: 218 PAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAF 277
            A  + I G  +   L  M  P+DV+K+ M + N  K ++ N+++ + + ++   G+  F
Sbjct: 194 KASSV-ITGLATSFTLVAMTQPIDVVKTRMMSQN-AKTEYKNTLNCMYR-IFVQEGMATF 250

Query: 278 FKGFGPTMLRAAPANGATFATFE 300
           +KG     ++   + G TF  +E
Sbjct: 251 WKGSIFRFMKVGISGGLTFTVYE 273

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 80/187 (42%), Gaps = 15/187 (8%)

Query: 120 LPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRG 179
           +P +   G  GG+ +     P++ ++ RLQ    S   +        ++++R  + L RG
Sbjct: 8   VPAHLVSGFFGGLASVCALQPLDLLKTRLQQAQASSLRS-------VLREVRTTRELWRG 60

Query: 180 LTPTILREGHGCGTYF--LVYE--ALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWL 235
             P+ LR   G   Y   L Y   AL      + R      + +++  + GALS  A+ L
Sbjct: 61  TLPSALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGL 120

Query: 236 MVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGAT 295
           +  P+ VIK   ++         N ++   + ++ + G   FFKG   T LR AP  G  
Sbjct: 121 VTMPITVIKVRYESTLYAY----NGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLY 176

Query: 296 FATFELA 302
              +E A
Sbjct: 177 VLLYEQA 183

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 76/183 (41%), Gaps = 17/183 (9%)

Query: 25  VVKDLLAGTAGGIAQVLVGQPFDTTKVRLQ--TSSTPTTAMEVVRKLLANEGPRGFYKGT 82
           V   L++G  GG+A V   QP D  K RLQ   +S+  + +  VR     E  RG     
Sbjct: 8   VPAHLVSGFFGGLASVCALQPLDLLKTRLQQAQASSLRSVLREVRT--TRELWRGTLPSA 65

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNS---FLAS 139
           L   IG    +SL      A+ R    R    SS L   Q Y   +TG +  +    +  
Sbjct: 66  LRTSIGSALYLSLLNYSRSALARGSEART--RSSLLPRLQSYQNLLTGALSRAAVGLVTM 123

Query: 140 PIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTILREGHGCGTYFL 196
           PI  +++R ++     T   + G  E  + +  +   +   +G   T LR+    G Y L
Sbjct: 124 PITVIKVRYES-----TLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVL 178

Query: 197 VYE 199
           +YE
Sbjct: 179 LYE 181

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 29/64 (45%)

Query: 45  PFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMK 104
           PFDT K R+Q  S P   ++ +R ++  E  R  + G    L        + +G+ E + 
Sbjct: 230 PFDTIKTRMQLQSHPVGFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEELL 289

Query: 105 RFFH 108
           +  H
Sbjct: 290 KLLH 293

>Kwal_23.3042
          Length = 542

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 76/187 (40%), Gaps = 15/187 (8%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA------MEVVRKLLANEGPRGFYKGTL 83
           LAG  GG+   L   P DT K R+Q +   T +      +   + +    G R FY+G  
Sbjct: 349 LAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIFYRGIT 408

Query: 84  TPLIGVGACVSLQFGVNEAMKRFFHHRNADMSS------TLSLPQYYACGVTGGIVNSFL 137
             ++G+    ++  G   A+K+++  R A ++       T+S       G   G V +  
Sbjct: 409 VGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTVGATA 468

Query: 138 ASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTILREGHGCGTY 194
             P+  +R RLQ Q        + G  + + K       + L +GL P + +        
Sbjct: 469 VYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCPAVSIS 528

Query: 195 FLVYEAL 201
           +L YE L
Sbjct: 529 YLCYENL 535

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 70/310 (22%), Positives = 113/310 (36%), Gaps = 42/310 (13%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKV----RLQTSSTPTTAMEVVRK---------------- 68
            +AG   G+       PFD  KV    R   SST   + +++ +                
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVK 287

Query: 69  ----LLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHH-RNADMSSTLSLPQY 123
               L    G R FY G     + V    +++FG  E  KR          ++ LS    
Sbjct: 288 AATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFST 347

Query: 124 YACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN------KALL 177
           Y  G  GG++      PI+ ++ R+Q    +  N E KG    I   +        +   
Sbjct: 348 YLAGGLGGVMAQLSVYPIDTLKYRVQC---APLNTESKGRQLLISTAKDMYKEGGLRIFY 404

Query: 178 RGLTPTIL----REGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIF--GALSGT 231
           RG+T  I+          GT+  + +  IA Q  +  GL    +    + +   GA SGT
Sbjct: 405 RGITVGIMGIFPYAAMDLGTFSALKKWYIARQA-RLTGLPEDQVTMSNMFVLLMGAFSGT 463

Query: 232 ALWLMVYPLDVIKSVMQTD-NLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAP 290
                VYP++++++ +Q       P   N    V        G    FKG  P + +  P
Sbjct: 464 VGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCP 523

Query: 291 ANGATFATFE 300
           A   ++  +E
Sbjct: 524 AVSISYLCYE 533

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 49/133 (36%), Gaps = 19/133 (14%)

Query: 189 HGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKS--V 246
           H   +YF ++   +         L    I  +   I G +SG        P D IK   +
Sbjct: 194 HTAFSYFYLFNEDVDLSSEGDVTLINDFIRGFGFFIAGGVSGVVSRTCTAPFDRIKVFLI 253

Query: 247 MQTD-----------------NLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAA 289
            +TD                 N    K  + +   A TLY  GGI AF+ G G   ++  
Sbjct: 254 ARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVKAATTLYRQGGIRAFYVGNGLNAMKVF 313

Query: 290 PANGATFATFELA 302
           P +   F +FELA
Sbjct: 314 PESAIKFGSFELA 326

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 34/83 (40%), Gaps = 6/83 (7%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA------MEVVRKLLANEGPRGFYKGT 82
           LL G   G        P +  + RLQ   T           +V+ K +  EG +G +KG 
Sbjct: 455 LLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGL 514

Query: 83  LTPLIGVGACVSLQFGVNEAMKR 105
           +  L  V   VS+ +   E +KR
Sbjct: 515 VPNLAKVCPAVSISYLCYENLKR 537

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 68/311 (21%), Positives = 120/311 (38%), Gaps = 74/311 (23%)

Query: 45  PFDTTKVRLQTS------STPTTA---------------MEVVRKLLANEGPRGFYKGTL 83
           PFD  K RLQ+        T  TA               + +++ +   EG R  +KG  
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 84  TPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTL-----SLPQ-YYACGVTGGIVNSFL 137
             L+GV    S+ F        F +    D +S L       P  ++  G T G   S  
Sbjct: 129 PNLVGVIPARSINF--------FTYGVTKDTASRLLNDGQEAPWIHFLAGATAGWATSTA 180

Query: 138 ASPIEHVRIRLQ-TQTGSGTNAEFKGPLECIKKLRHNKALL---RGLTPTILREGHGCGT 193
            +PI  V+ RLQ  +   G +  +K   +C+K +  N+ +L   +GL+ + L      G+
Sbjct: 181 TNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYL------GS 234

Query: 194 YFLVYEALIANQMN---KRRGLER------------KDIPAWKLCIFGALSGTALW---L 235
              + + ++  QM    ++R +E               +  W  C     +G A     +
Sbjct: 235 VESILQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEW--CQRSGSAGAAKLFASI 292

Query: 236 MVYPLDVIKSVMQTDNLQKPKFGNSISSVA-----KTLYANGGIGAFFKGFGPTMLRAAP 290
           + YP +V+++ ++    Q PK    +           +    G  + + G  P ++R  P
Sbjct: 293 LTYPHEVVRTRLR----QAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVP 348

Query: 291 ANGATFATFEL 301
            +   F T+EL
Sbjct: 349 NSIIMFGTWEL 359

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 106/257 (41%), Gaps = 25/257 (9%)

Query: 53  LQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLI-GVGACVSLQFGVNEAMKRFFHHRN 111
           LQ +ST     + + K+   EG RG Y+G  T ++ G     S  F  +   K +F  + 
Sbjct: 73  LQYNST----FDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVKL 128

Query: 112 ADMSST-LSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTG-SGTNAEFKGPLECIKK 169
            +  +T  +  +    G+     +    +PI  +  R QT+ G  G N       E  K+
Sbjct: 129 INRKNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDFLTVAKEIYKE 188

Query: 170 LRHNKALLRGLTPTILREGHGCGTYFLVYEAL-----IANQMNKRRGL--ERKDIPAWKL 222
            R  K   +GL  +++   +   TY   YE L       + MN ++ L      +  ++ 
Sbjct: 189 QRSIKGFWKGLKVSLMLTINPSITY-TSYEKLKDALFTTDTMNLKKELVDSSSQLSPYQN 247

Query: 223 CIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISS---VAKTLYANGGIGAFFK 279
              G LS     ++  PL + K+ +Q +       G++ SS   V   LY N G+ +++K
Sbjct: 248 FTLGVLSKMISAIITMPLIISKAWLQRN-------GSNFSSFQQVLYYLYKNEGLRSWWK 300

Query: 280 GFGPTMLRAAPANGATF 296
           G  P + +     G  F
Sbjct: 301 GLSPQLAKGVLVQGLLF 317

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 117/292 (40%), Gaps = 44/292 (15%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANE---GPRGFYKGTLTP 85
           +L   + GI ++ V  P DT   RL ++ T   +   +  ++  E    P      TL P
Sbjct: 13  VLGSASAGILEIGVFHPVDTISKRLMSNHTKIGSSSQLNSVIFREHAAEPLSKRVFTLFP 72

Query: 86  LIGVGACVSL-----QFG----VNEAMKRFFHHRNADMSSTL------SLPQYYACGVTG 130
            +G  A   +     ++G     NE + R F    AD  +T       +L    A  + G
Sbjct: 73  GLGYAATYKILQRVYKYGGQPFANEFLNRNFK---ADFDNTFGEKTGKALRSATAGSMIG 129

Query: 131 GIVNSFLASPIEHVRIRLQTQTGSGTNAE-FKGPLECIKKLRHNK-ALLRGLTPTILREG 188
             +   +  P++ ++I+ QT      N E FKG    +K L+     L RG   T  R  
Sbjct: 130 --IGEIVLLPLDVLKIKRQT------NPEAFKGR-GFVKILKDEGLGLYRGWGWTAARNA 180

Query: 189 HGCGTYFLVYEALIANQMNKRRGLERKDIP--AWKLCIFGALSGTALWLMVY-PLDVIKS 245
            G       +     N   K   L  KD     W      ++ G +  L++  PLDVIK+
Sbjct: 181 PGS------FALFGGNAFAKEYILGLKDYSQATWSQNFVSSIVGASASLIISAPLDVIKT 234

Query: 246 VMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFA 297
            +Q  N + P+ G +I    K    N G  AFFKG  P +L   P    +FA
Sbjct: 235 RIQNKNFENPESGFTI---VKNTLKNEGFSAFFKGLTPKLLTTGPKLVFSFA 283

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 41/93 (44%), Gaps = 2/93 (2%)

Query: 19  QHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS--TPTTAMEVVRKLLANEGPR 76
            +  A   ++ ++   G  A +++  P D  K R+Q  +   P +   +V+  L NEG  
Sbjct: 202 DYSQATWSQNFVSSIVGASASLIISAPLDVIKTRIQNKNFENPESGFTIVKNTLKNEGFS 261

Query: 77  GFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHH 109
            F+KG    L+  G  +   F + + +   F +
Sbjct: 262 AFFKGLTPKLLTTGPKLVFSFALAQTLIPVFDN 294

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 76/174 (43%), Gaps = 19/174 (10%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA---------MEVVRKLLANEGPRGFYKGT 82
           G AGG++ + V    D  + RL   S              ++V +K LA++G  G Y+G 
Sbjct: 122 GAAGGLSLLFV-YSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGF 180

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIE 142
           L  ++G+     L FG+ +++K      N + S   S    +A   TG    S+   P++
Sbjct: 181 LPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASFLLGWAV-TTGASTASY---PLD 236

Query: 143 HVRIRLQTQTGSGTNAEFKGPLECIKKL---RHNKALLRGLTPTILREGHGCGT 193
            VR R+     SG   ++ G  +  +K+      K+L +G    ILR   G G 
Sbjct: 237 TVRRRMMMT--SGQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGV 288

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/284 (21%), Positives = 114/284 (40%), Gaps = 17/284 (5%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----MEVVRKLLANEGPRGFYKGTL 83
             LAG+  G  +  +  PF+  K RLQ     + A    + ++     N G    Y G  
Sbjct: 93  SFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSIYVGCP 152

Query: 84  TPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLA-SPIE 142
             ++G  A   ++F   + +K     +    +  LS  +    G+  G++ S +A +P E
Sbjct: 153 AFIVGNTAKAGIRFLGFDTIKNLLRDKK---TGELSGFRGVVAGLGAGLLESVVAVTPFE 209

Query: 143 HVRIRLQTQTGSGT---NAEFKGPLECIKKLRHNK---ALLRGLTPTILREGHGCGTYFL 196
            ++  L     +         KG +    KL  ++    L RG+ P  +R+         
Sbjct: 210 AIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQAVRLG 269

Query: 197 VYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPK 256
            Y  +     +     + K + +    I GA SG        P+D +K+ MQ+  L   +
Sbjct: 270 CYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQS--LNAGQ 327

Query: 257 FGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           + ++I+  A T++   G+  F+KG  P + R   + G  F  +E
Sbjct: 328 YSSTINCFA-TIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYE 370

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 34/81 (41%), Gaps = 3/81 (3%)

Query: 10  LIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQT--SSTPTTAMEVVR 67
           L+ D    P+          + G   GI  V    P DT K R+Q+  +   ++ +    
Sbjct: 277 LVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQSLNAGQYSSTINCFA 336

Query: 68  KLLANEGPRGFYKGTLTPLIG 88
            +   EG + F+KG  TP +G
Sbjct: 337 TIFKEEGLKTFWKGA-TPRLG 356

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 115/296 (38%), Gaps = 45/296 (15%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANE------GPRGFY 79
           V  LL   + GI ++ V  P DT   RL ++ T  T+   +  ++  +      G R F 
Sbjct: 11  VARLLGSASAGILEIGVFHPVDTISKRLMSNHTKITSGAQLNSVIFRDHAAEAFGKRVF- 69

Query: 80  KGTLTPLIGVGACVSL-----QFGVNEAMKRFFH-HRNADMSSTL------SLPQYYACG 127
             TL P +G  A   +     ++G       F + H   D  S        +L    A  
Sbjct: 70  --TLFPGLGYAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFGDKTGKALRSATAGS 127

Query: 128 VTGGIVNSFLASPIEHVRIRLQTQTGSGTNAE-FKGPLECIKKLRHNKA--LLRGLTPTI 184
           + G  +   +  P++ ++I+ QT      N E FKG    +K L+      L RG   T 
Sbjct: 128 LIG--IGEIVLLPLDVLKIKRQT------NPEAFKGR-GFLKILKDEGIFNLYRGWGWTA 178

Query: 185 LREGHGCGTYFLVYEALIANQMNKRR--GLERKDIPAWKLCIFGALSGTALWLMVY-PLD 241
            R   G       +     N   K    GL+      W      ++ G +  L+V  PLD
Sbjct: 179 ARNAPGS------FALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGASASLIVSAPLD 232

Query: 242 VIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFA 297
           VIK+ +Q  N   P+ G  I    K    N G  AFFKG  P +L   P    +FA
Sbjct: 233 VIKTRIQNRNFDNPESGFKI---VKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFA 285

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 50/105 (47%), Gaps = 5/105 (4%)

Query: 7   SPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS--TPTTAME 64
           + + I  L+++ Q   A   ++ ++   G  A ++V  P D  K R+Q  +   P +  +
Sbjct: 195 AKEYILGLQDYSQ---ATWSQNFISSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFK 251

Query: 65  VVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHH 109
           +V+  L NEG   F+KG    L+  G  +   F + +++   F +
Sbjct: 252 IVKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFALAQSLIPMFDN 296

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 110/263 (41%), Gaps = 31/263 (11%)

Query: 63  MEVVRKLLANEGPRGFYKGT-LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLP 121
           +E +RK+   EG    ++G  +T ++ V A V + F   EA++      N+ ++S L + 
Sbjct: 84  LEGLRKIAQLEGLPTLWRGLGITLVMAVPANV-VYFSGYEALRD-----NSPLASRLPVA 137

Query: 122 QYYACGVTGGIVNSFLASPIEHVRIRLQT-QTGSGTNAEFKGPLECIKKLRHN------K 174
               CG    I+ +   +P+E +R RLQ+      T        + ++++RH       +
Sbjct: 138 NPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSVMGYR 197

Query: 175 ALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCI----FGALSG 230
           AL +GL  T+ R+      Y+  YE     Q   R      +   W   I     G++ G
Sbjct: 198 ALFKGLEITLWRDVPFSAIYWGTYE-FCKTQFWARHA-ATHNASNWDHFIGSFACGSMGG 255

Query: 231 TALWLMVYPLDVIKSVMQT-----------DNLQKPKFGNSISSVAKTLYANGGIGAFFK 279
               L+ +P DV K+ MQ                K      + S    +  + GI A + 
Sbjct: 256 AVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGIRALYT 315

Query: 280 GFGPTMLRAAPANGATFATFELA 302
           G  P +++ AP+     +T+EL+
Sbjct: 316 GLLPRVMKIAPSCAIMISTYELS 338

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/107 (20%), Positives = 38/107 (35%), Gaps = 16/107 (14%)

Query: 17  HPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEV----------- 65
           H   +    +     G+ GG    L+  PFD  K R+Q +      + V           
Sbjct: 236 HNASNWDHFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSR 295

Query: 66  -----VRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFF 107
                +  +  +EG R  Y G L  ++ +    ++     E  K+FF
Sbjct: 296 GMFSFLNAIRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKFF 342

>Kwal_23.3529
          Length = 395

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 107/266 (40%), Gaps = 26/266 (9%)

Query: 42  VGQPFDTTKVRLQTSSTPTTAMEVV---RKLLANEG-PRGFYKGTLTPLIGVGACVSLQF 97
           V    DT K R Q +        ++   +K+   EG  RG Y G    ++G     ++ F
Sbjct: 102 VMHSLDTVKTRQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAIFF 161

Query: 98  GVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTN 157
           G  E  KR     +  ++ TLS   +   G++G +V+S +  P E ++ RLQ Q G   N
Sbjct: 162 GTYELTKRKLID-DWGVNETLS---HLTAGLSGDLVSSVVYVPSEVLKTRLQLQ-GCYNN 216

Query: 158 AEF---------KGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNK 208
             F         +  +  I +L   + L  G   T+ R+       F  YE         
Sbjct: 217 PHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTL 276

Query: 209 RRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQT--------DNLQKPKFGNS 260
                 +D+      + GA +G    ++  P+DVIK+ +QT        D+ +  +  NS
Sbjct: 277 EGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDSTRLVRIENS 336

Query: 261 ISSVAKTLYANGGIGAFFKGFGPTML 286
           +      +Y + G   FF G GP  +
Sbjct: 337 LIKGLTAVYRSEGTLGFFSGVGPRFI 362

 Score = 31.6 bits (70), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 1/66 (1%)

Query: 236 MVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGAT 295
           +++ LD +K+  Q      PK+ N IS+  K     G     + G+   ML + P+    
Sbjct: 102 VMHSLDTVKT-RQQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAIF 160

Query: 296 FATFEL 301
           F T+EL
Sbjct: 161 FGTYEL 166

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 42/197 (21%), Positives = 75/197 (38%), Gaps = 24/197 (12%)

Query: 4   EFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQ--------- 54
           E    +LIDD   +        +  L AG +G +   +V  P +  K RLQ         
Sbjct: 165 ELTKRKLIDDWGVN------ETLSHLTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPH 218

Query: 55  --TSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRF-FHHRN 111
             +        + +  ++  EG +  + G    L       + QF   E  +++ F    
Sbjct: 219 FHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTLEG 278

Query: 112 ADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLR 171
              S  LSL      G   G +   + +P++ ++ R+QTQ  S   +      +  + +R
Sbjct: 279 KTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVAS------DSTRLVR 332

Query: 172 HNKALLRGLTPTILREG 188
              +L++GLT     EG
Sbjct: 333 IENSLIKGLTAVYRSEG 349

>Kwal_27.11626
          Length = 299

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 80/297 (26%), Positives = 121/297 (40%), Gaps = 48/297 (16%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANE------GPRGFY 79
           +  +L   + GI ++ V  P DT   RL ++ T  ++   +  ++  E      G R F 
Sbjct: 10  IARVLGSASAGILEIGVFHPVDTVSKRLMSNHTKISSSAQLNSVIFREHAGEALGKRLF- 68

Query: 80  KGTLTPLIGVGACVSL-----QFG----VNEAMKRFFHHRNADMSSTL------SLPQYY 124
             TL P +G  A   +     ++G     NE + + F    AD  +        +L    
Sbjct: 69  --TLFPGLGYAASYKILQRVYKYGGQPFANEFLNKNFK---ADFDNAFGEKTGKALRSAT 123

Query: 125 ACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK-ALLRGLTPT 183
           A  + G  +   +  P++ ++I+ QT   S     FKG    IK L+     L RG   T
Sbjct: 124 AGSLIG--IGEIVLLPLDVLKIKRQTNPES-----FKGR-GFIKILKDEGFGLYRGWGWT 175

Query: 184 ILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPA--WKLCIFGALSGTALWLMVY-PL 240
             R   G       +     N   K   L  KD  +  W      ++ G +  L+V  PL
Sbjct: 176 AARNAPGS------FALFGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPL 229

Query: 241 DVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFA 297
           DVIK+ +Q  +   P+ G  I  V  TL  N GI AFFKG  P +L   P    +FA
Sbjct: 230 DVIKTRIQNRHFDNPESGFRI--VQNTL-KNEGITAFFKGLTPKLLTTGPKLVFSFA 283

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 2/87 (2%)

Query: 19  QHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS--STPTTAMEVVRKLLANEGPR 76
            + +A   ++ ++   G  A ++V  P D  K R+Q      P +   +V+  L NEG  
Sbjct: 202 DYSSATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRHFDNPESGFRIVQNTLKNEGIT 261

Query: 77  GFYKGTLTPLIGVGACVSLQFGVNEAM 103
            F+KG    L+  G  +   F + +++
Sbjct: 262 AFFKGLTPKLLTTGPKLVFSFALAQSL 288

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 76/185 (41%), Gaps = 19/185 (10%)

Query: 16  EHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP---------TTAMEVV 66
           +   H    V  ++ AG A GI   ++G P    K RLQ+ S           T     +
Sbjct: 115 DQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGL 174

Query: 67  RKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYAC 126
           + +   EG +G ++G    ++  GA  S+Q  +    K F   RN  M    SL  +   
Sbjct: 175 KTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL-LRNDIMEDGPSL--HLTA 231

Query: 127 GVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECI---KKLRHNKALLRGLTPT 183
               G+  + + +P + +  R+  Q G      +KGP++C+    K+    AL +G    
Sbjct: 232 STISGLGVAVVMNPWDVILTRIYNQKGD----LYKGPIDCLVKTVKIEGITALYKGFEAQ 287

Query: 184 ILREG 188
           + R G
Sbjct: 288 VFRIG 292

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 74/179 (41%), Gaps = 15/179 (8%)

Query: 137 LASPIEHVRIRLQTQ--TGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTILREGHGC 191
           + +PIE V+IR+Q Q    +     +  P + +  +  N   + L +GL    + +    
Sbjct: 35  VTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALN 94

Query: 192 GTYFLVYEALIANQMNKRR--GLERKDIPAWKLCIF-GALSGTALWLMVYPLDVIKSVMQ 248
           G+    YE + A  MNK      E   + +  + +F GA SG    +M  PL ++K+ +Q
Sbjct: 95  GSRLGFYEPIRA-VMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQ 153

Query: 249 TDNLQKPKFGNSISSVA-----KTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELA 302
           + +    K G            KT+Y   G+   F+G    +LR    +      +  A
Sbjct: 154 SYS-NAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTA 211

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/308 (20%), Positives = 117/308 (37%), Gaps = 50/308 (16%)

Query: 15  EEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQT----------SSTPTTAME 64
            +  Q +    +  L+ G +  IA+     P +  K+ +Q               +  ++
Sbjct: 3   SDAKQQETNFAINFLMGGVSAAIAKT-AASPIERVKILIQNQDEMIKQGTLDKKYSGIVD 61

Query: 65  VVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYY 124
             ++    EG   F++G    +I      +L F   + +K  F  +  +           
Sbjct: 62  CFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNLA 121

Query: 125 ACGVTGGIVNSFLASPIEHVRIRLQTQTGS---GTNAEFKGPLECIKKLRHNKA---LLR 178
           + G  G +   F+ S ++  R RL     S   G   +F G  +  KK   +     L R
Sbjct: 122 SGGAAGALSLLFVYS-LDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYR 180

Query: 179 GLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTAL----- 233
           G  P+++      G YF ++++L                    L + G+L G+ L     
Sbjct: 181 GFMPSVVGIVVYRGLYFGMFDSLKP------------------LVLTGSLDGSFLASFLL 222

Query: 234 -WLMV-------YPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTM 285
            W++        YPLD ++  M   + Q  K+  +I  + K + A+ G+G+ FKG G  +
Sbjct: 223 GWVVTTGASTCSYPLDTVRRRMMMTSGQAVKYNGAIDCL-KKIVASEGVGSLFKGCGANI 281

Query: 286 LRAAPANG 293
           LR+    G
Sbjct: 282 LRSVAGAG 289

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/250 (22%), Positives = 100/250 (40%), Gaps = 39/250 (15%)

Query: 63  MEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQ 122
           ++  ++    EG   F++G    +I      +L F   + +K  F  +  +  +      
Sbjct: 71  LDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGN 130

Query: 123 YYACGVTGGIVNSFLASPIEHVRIRLQTQTGS---GTNAEFKGPLECIKKLRHNKA---L 176
             + G  G +   F+ S +++ R RL   + S   G   +F G ++  KK   +     L
Sbjct: 131 LASGGAAGALSLLFVYS-LDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGL 189

Query: 177 LRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTAL--- 233
            RG  P+++      G YF +Y++L                    L + G+L G+ L   
Sbjct: 190 YRGFLPSVVGIVVYRGLYFGMYDSLKP------------------LLLTGSLEGSFLASF 231

Query: 234 ---WLMV-------YPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGP 283
              W++        YPLD ++  M   + Q  K+  +   + K + A G +G+ FKG G 
Sbjct: 232 LLGWVVTTGASTCSYPLDTVRRRMMMTSGQAVKYDGAFDCLRKIVAAEG-VGSLFKGCGA 290

Query: 284 TMLRAAPANG 293
            +LR     G
Sbjct: 291 NILRGVAGAG 300

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 77/178 (43%), Gaps = 18/178 (10%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA---------MEVVRKLLANEGPRGF 78
           +L +G A G   +L     D  + RL   S  +           ++V +K L ++G  G 
Sbjct: 130 NLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGL 189

Query: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLA 138
           Y+G L  ++G+     L FG+ +++K      + + S   S    +    TG    S+  
Sbjct: 190 YRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVV-TTGASTCSY-- 246

Query: 139 SPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTILREGHGCGT 193
            P++ VR R+     SG   ++ G  +C++K+   +   +L +G    ILR   G G 
Sbjct: 247 -PLDTVRRRMMMT--SGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGV 301

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 66/280 (23%), Positives = 108/280 (38%), Gaps = 28/280 (10%)

Query: 46  FDTTKVRLQTSSTPTTAMEVV---RKLLANEGPR-GFYKGTLTPLIGVGACVSLQFGVNE 101
            DT K R Q + +      ++   R ++  EG R G Y G    ++G     ++ F   E
Sbjct: 76  LDTVKTRQQGAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAIFFATYE 135

Query: 102 AMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFK 161
             KR        ++ T S   +   G  G  ++SF+  P E ++ RLQ Q G   N  F+
Sbjct: 136 YTKRKMIGEWG-INETFS---HLTAGFLGDFISSFVYVPSEVLKTRLQLQ-GRYNNPFFR 190

Query: 162 G---------PLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGL 212
                      +  I +      L  G   T+ R+    G  F  YE             
Sbjct: 191 SGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVENKT 250

Query: 213 ERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTD----------NLQKPKFGNSIS 262
             +D+      I GA +G    ++  PLDV+K+ +QT           NL++    NSI+
Sbjct: 251 FDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSIT 310

Query: 263 SVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELA 302
               T+Y   G+   F G GP  +  +  +      +++A
Sbjct: 311 KGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLYQVA 350

>Kwal_47.19228
          Length = 281

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 66/142 (46%), Gaps = 8/142 (5%)

Query: 159 EFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIP 218
           +F   ++ I + R  +  L+G  PTI+R+       F  Y +L      K+     K + 
Sbjct: 130 QFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSL------KQMISPNKPLN 183

Query: 219 AWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFF 278
            +     G +S  A+  +  P+DVIK+ MQ+       + NS+ + A  ++   G   F+
Sbjct: 184 EYYAFALGFISSCAVVAVTQPIDVIKTRMQSKYTWS-NYKNSL-NCAYRIFVEEGFTKFW 241

Query: 279 KGFGPTMLRAAPANGATFATFE 300
           KG+ P +++   + G +F  ++
Sbjct: 242 KGWAPRLMKVGLSGGVSFGVYQ 263

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 69/147 (46%), Gaps = 23/147 (15%)

Query: 60  TTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLS 119
           TT  E+ R    + G RGF +GT+  +I   +  +++F    ++K+        +S    
Sbjct: 133 TTVQEIYR----SRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQM-------ISPNKP 181

Query: 120 LPQYYACGVTGGIVNSF----LASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKA 175
           L +YYA  +  G ++S     +  PI+ ++ R+Q++    T + +K  L C  ++   + 
Sbjct: 182 LNEYYAFAL--GFISSCAVVAVTQPIDVIKTRMQSKY---TWSNYKNSLNCAYRIFVEEG 236

Query: 176 ---LLRGLTPTILREGHGCGTYFLVYE 199
                +G  P +++ G   G  F VY+
Sbjct: 237 FTKFWKGWAPRLMKVGLSGGVSFGVYQ 263

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 32/73 (43%), Gaps = 3/73 (4%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQ---TSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIG 88
           G     A V V QP D  K R+Q   T S    ++    ++   EG   F+KG    L+ 
Sbjct: 191 GFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEGFTKFWKGWAPRLMK 250

Query: 89  VGACVSLQFGVNE 101
           VG    + FGV +
Sbjct: 251 VGLSGGVSFGVYQ 263

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 116/301 (38%), Gaps = 38/301 (12%)

Query: 15  EEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANE- 73
            +  Q   ARVV       + GI ++ V  P DT   RL ++ T  T  + +  ++  E 
Sbjct: 3   NDQKQSGLARVV----GSASAGILEIGVFHPVDTISKRLMSNHTKITNAQQLNDVVFREH 58

Query: 74  --GPRGFYKGTLTPLIGVGACVSL-----QFGVNEAMKRFFH-HRNADMSSTL------S 119
              P G    TL P +G  A   +     ++G       F + H  AD           +
Sbjct: 59  ASKPFGQRLFTLFPGLGYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGAFGEKTGKA 118

Query: 120 LPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRG 179
           L    A  + G  +   +  P++ ++I+ QT   S      +G L  ++       L RG
Sbjct: 119 LRSATAGSLIG--IGEIVLLPLDVLKIKRQTNPESFRG---RGFLRILRD--EGMGLYRG 171

Query: 180 LTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIP--AWKLCIFGALSGTALWLMV 237
              T  R   G       +     N   K   L  KD     W      ++ G +  L+V
Sbjct: 172 WGWTAARNAPGS------FALFGGNAFAKEYILGLKDYSQATWGQNFVSSIFGASASLIV 225

Query: 238 Y-PLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATF 296
             PLDVIK+ +Q+ N +  + G +I    K    N G  AFFKG  P +L   P    +F
Sbjct: 226 SAPLDVIKTRIQSRNFESAESGFTI---VKNTLKNEGATAFFKGLTPKLLTTGPKLVFSF 282

Query: 297 A 297
           A
Sbjct: 283 A 283

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 40/85 (47%), Gaps = 2/85 (2%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS--TPTTAMEVVRKLLANEGPRGFYKGTLT 84
           ++ ++   G  A ++V  P D  K R+Q+ +  +  +   +V+  L NEG   F+KG   
Sbjct: 210 QNFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAESGFTIVKNTLKNEGATAFFKGLTP 269

Query: 85  PLIGVGACVSLQFGVNEAMKRFFHH 109
            L+  G  +   F + + +   F +
Sbjct: 270 KLLTTGPKLVFSFAIAQTLIPMFDN 294

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 85/206 (41%), Gaps = 14/206 (6%)

Query: 1   MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60
            + EF +     D +        + ++   AG+  GI ++++  P D  K++ QT+    
Sbjct: 94  FANEFLNKHFKADFDGAFGEKTGKALRSATAGSLIGIGEIVL-LPLDVLKIKRQTNPESF 152

Query: 61  TAMEVVRKLLANEGPRGFYKGT-LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLS 119
                +R +L +EG  G Y+G   T         +L FG N   K +         +T  
Sbjct: 153 RGRGFLR-ILRDEG-MGLYRGWGWTAARNAPGSFAL-FGGNAFAKEYILGLKDYSQATWG 209

Query: 120 LPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---AL 176
             Q +   + G   +  +++P++ ++ R+Q++      + F      +K    N+   A 
Sbjct: 210 --QNFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAESGF----TIVKNTLKNEGATAF 263

Query: 177 LRGLTPTILREGHGCGTYFLVYEALI 202
            +GLTP +L  G      F + + LI
Sbjct: 264 FKGLTPKLLTTGPKLVFSFAIAQTLI 289

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 61/298 (20%), Positives = 119/298 (39%), Gaps = 25/298 (8%)

Query: 19  QHDNARV--VKDLLAGTAGGIAQVLVGQPFDTTKVRLQ----TSSTPTTAMEVVRKLLAN 72
             D+ +V   K  +AG   G  +  +  PF+  K RLQ    +S      + ++      
Sbjct: 2   SKDSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKT 61

Query: 73  EGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGI 132
           +G    Y G    ++G  A  + +F   + ++     +    +  LS P+    G+  G+
Sbjct: 62  QGVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKK---TGELSGPRGVLAGLGAGL 118

Query: 133 VNSFLA-SPIEHVR---------IRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTP 182
           + S +A +P E ++         +R + Q    + A  +  +  +K     + L  G+ P
Sbjct: 119 LESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMA--RNYISLVKD-EGFRGLYGGVLP 175

Query: 183 TILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDV 242
             +R+          Y  +     +     + K + +    I GA SG        P+D 
Sbjct: 176 VSMRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDT 235

Query: 243 IKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           +K+ MQ+  L   K+ ++++    T+Y   G+  F+KG  P + R   + G  F  +E
Sbjct: 236 VKTRMQS--LTASKYSSTLNCFT-TIYKEEGLKTFWKGATPRLGRLILSGGIVFTIYE 290

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 3/81 (3%)

Query: 10  LIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQ--TSSTPTTAMEVVR 67
           L+ D    P+          + G   G+  V    P DT K R+Q  T+S  ++ +    
Sbjct: 197 LVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRMQSLTASKYSSTLNCFT 256

Query: 68  KLLANEGPRGFYKGTLTPLIG 88
            +   EG + F+KG  TP +G
Sbjct: 257 TIYKEEGLKTFWKGA-TPRLG 276

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 79/303 (26%), Positives = 118/303 (38%), Gaps = 42/303 (13%)

Query: 15  EEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAME----VVRKLL 70
            +  Q   ARV    L   + GI ++ V  P DT   RL ++ T   +      V+ +  
Sbjct: 4   NDKKQSGLARV----LGSASAGILEIGVFHPVDTISKRLMSNHTKIASTSQLNSVIFRDF 59

Query: 71  ANEGPRGFYKGTLTPLIGVGACVSL-----QFG----VNEAMKRFFHHRNADMSSTLSLP 121
           A+E P G    +L P +G  A   +     ++G     NE + + F   + D +      
Sbjct: 60  ASE-PLGRRLLSLFPGLGYAAAYKILQRVYKYGGQPFANEFLNKNFKG-DFDQAFGEKTG 117

Query: 122 QYYACGVTGGIVN--SFLASPIEHVRIRLQTQTGSGTNAEFKGP--LECIKKLRHNKALL 177
           +       G ++     +  P++ ++I+ QT   S     FKG   L+ IK       L 
Sbjct: 118 KALRSATAGSLIGIGEIVLLPLDVLKIKRQTNPES-----FKGRGFLKIIKD--EGFGLY 170

Query: 178 RGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDI--PAWKLCIFGALSGTALWL 235
           RG   T  R   G       +     N   K   L  KD     W      ++ G +  L
Sbjct: 171 RGWGWTAARNAPGS------FALFGGNAFAKEYILGLKDYGQATWSQNFVSSIVGASASL 224

Query: 236 MVY-PLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGA 294
           +V  PLDVIK+ +Q  N   P+ G  I    K    N G  AFFKG  P +L   P    
Sbjct: 225 IVSAPLDVIKTRIQNRNFDNPESGFKI---IKNTLKNEGFTAFFKGLTPKLLTTGPKLVF 281

Query: 295 TFA 297
           +FA
Sbjct: 282 SFA 284

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 42/93 (45%), Gaps = 2/93 (2%)

Query: 19  QHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS--TPTTAMEVVRKLLANEGPR 76
            +  A   ++ ++   G  A ++V  P D  K R+Q  +   P +  ++++  L NEG  
Sbjct: 203 DYGQATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIIKNTLKNEGFT 262

Query: 77  GFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHH 109
            F+KG    L+  G  +   F + + +   F +
Sbjct: 263 AFFKGLTPKLLTTGPKLVFSFALAQTLIPIFDN 295

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 79/174 (45%), Gaps = 19/174 (10%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA---------MEVVRKLLANEGPRGFYKGT 82
           G AGG++ + V    D  + RL   +  +           ++V +K +A++G  G Y+G 
Sbjct: 123 GIAGGLSLMFV-YSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGF 181

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIE 142
           L  +IG+     L FG+ ++ K      + + S   S    +    TG    S+   P++
Sbjct: 182 LPSVIGIVVYRGLYFGLYDSCKPLLLTGSLEGSFIASFLLGWVV-TTGASTASY---PLD 237

Query: 143 HVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTILREGHGCGT 193
            VR R+     SG   ++KG ++C++K+   +   +L +G    ILR   G G 
Sbjct: 238 TVRRRMMMT--SGQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGV 289

>Kwal_23.4354
          Length = 343

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 66/324 (20%), Positives = 120/324 (37%), Gaps = 51/324 (15%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSST-PTTAMEVVRKLLANEGPRGFYK------- 80
           LL+   G +   L+  P D  ++RLQ     P    E    L +    +G +        
Sbjct: 15  LLSAVVGSLLTSLILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRASSKGVFWQDICFED 74

Query: 81  -----------------GTLTPLIGV-----GACVSLQFGVNEAMKRFFHHRNADMSSTL 118
                            G +  + GV     G  ++L       M  F  + +    S L
Sbjct: 75  VRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRDKSRL 134

Query: 119 SLPQY-----YACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPL-ECIKKLRH 172
              +Y       CG    ++ +   +P+E  R RLQ+   S   +     + + IK+ R+
Sbjct: 135 Q-DKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRY 193

Query: 173 N------KALLRGLTPTILREGHGCGTYFLVYEALIAN-QMNKRRGLERKDIPAWKLCIF 225
                  KAL RGL  T+ R+      Y+  YE   +N  ++  + +       W   + 
Sbjct: 194 EISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHFVN 253

Query: 226 ----GALSGTALWLMVYPLDVIKSVMQTDNLQ---KPKFGNSISSVAKTLYANGGIGAFF 278
               G+  G    ++ +P DV K+ MQ   L    + K   ++      +  + G+ A +
Sbjct: 254 SFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAALY 313

Query: 279 KGFGPTMLRAAPANGATFATFELA 302
            G  P +++ AP+     +T+E+ 
Sbjct: 314 TGLVPRVIKIAPSCAIMISTYEVC 337

 Score = 35.0 bits (79), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 8/90 (8%)

Query: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS-------STPTTAM-EVVRKLLANEGPRG 77
           V   + G+ GG    ++  PFD  K R+Q +         P+  M + + ++  +EG   
Sbjct: 252 VNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAA 311

Query: 78  FYKGTLTPLIGVGACVSLQFGVNEAMKRFF 107
            Y G +  +I +    ++     E  KR F
Sbjct: 312 LYTGLVPRVIKIAPSCAIMISTYEVCKRLF 341

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 73/165 (44%), Gaps = 12/165 (7%)

Query: 138 ASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLV 197
           A P++    R         ++ F G +  I + R  +  L+G  PTI R+       F  
Sbjct: 173 ARPVQTAHERWLLHYERQPSSHFAGTVLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTT 232

Query: 198 YEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKF 257
           Y A I   ++  + L+      ++    GALS  A+  +  P+DVIK+ MQ+    K  +
Sbjct: 233 Y-AWIVQSLSPHKALDE-----YQAFAAGALSSAAVVALTQPIDVIKTRMQS----KTAW 282

Query: 258 GNSISSV--AKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
               SS+  A  ++   G    +KG+ P + + + + G +F  ++
Sbjct: 283 FTYKSSLNCAYRIFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQ 327

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 42/98 (42%), Gaps = 6/98 (6%)

Query: 10  LIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSS---TPTTAMEVV 66
           ++  L  H   D     +   AG     A V + QP D  K R+Q+ +   T  +++   
Sbjct: 236 IVQSLSPHKALDE---YQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCA 292

Query: 67  RKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMK 104
            ++   EG R  +KG +  L  V     + FGV + ++
Sbjct: 293 YRIFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQYVE 330

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 60/153 (39%), Gaps = 19/153 (12%)

Query: 52  RLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRN 111
           R  +S    T +E+ R      G RGF +G +  +         Q G +      +    
Sbjct: 189 RQPSSHFAGTVLEIYR----TRGVRGFLQGAMPTIF-------RQLGNSVVRFTTYAWIV 237

Query: 112 ADMSSTLSLPQY--YACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKK 169
             +S   +L +Y  +A G         L  PI+ ++ R+Q++T   T   +K  L C  +
Sbjct: 238 QSLSPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFT---YKSSLNCAYR 294

Query: 170 L---RHNKALLRGLTPTILREGHGCGTYFLVYE 199
           +      + + +G  P + +     G  F VY+
Sbjct: 295 IFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQ 327

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 75/175 (42%), Gaps = 16/175 (9%)

Query: 124 YACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKA---LLRGL 180
           +  G   G V+  + SP E V+I LQ Q  S T+A   G +  + ++   +    L RG 
Sbjct: 15  FIAGGVAGAVSRTVVSPFERVKILLQVQ--SSTSAYNHGIINAVGQVYKEEGVAGLFRGN 72

Query: 181 TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPL 240
               +R        F+VYE    +  +    + ++ +  W+    GAL G    L  YPL
Sbjct: 73  GLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPL 132

Query: 241 DVIKS--VMQTDNLQK--PKFGNSISS-------VAKTLYANGGIGAFFKGFGPT 284
           D++++   +QT NL K        I+        + KT    GGI   ++G  PT
Sbjct: 133 DLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGIYPT 187

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 73/149 (48%), Gaps = 12/149 (8%)

Query: 13  DLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT----AMEVVRK 68
           DL++  + +++  +  +  G AG +++ +V  PF+  K+ LQ  S+ +      +  V +
Sbjct: 2   DLKQLAKQESS--IAFIAGGVAGAVSRTVV-SPFERVKILLQVQSSTSAYNHGIINAVGQ 58

Query: 69  LLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADM--SSTLSLPQYYAC 126
           +   EG  G ++G     + +    ++QF V E  K+   H +  +     L+  +  A 
Sbjct: 59  VYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAG 118

Query: 127 GVTGGIVNSFLAS-PIEHVRIRLQTQTGS 154
            + GG+  S LA+ P++ VR RL  QT +
Sbjct: 119 ALCGGM--SVLATYPLDLVRTRLSIQTAN 145

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 69/156 (44%), Gaps = 8/156 (5%)

Query: 145 RIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIAN 204
           R RL         + F   ++ I   R  +  ++G  PTI R+       F  Y +L   
Sbjct: 255 RERLFLHYEEHPTSRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSL--- 311

Query: 205 QMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSV 264
              K+     K +  +   + G +S  A+  +  P+DVIK+ MQ+       + NS+ + 
Sbjct: 312 ---KQLISPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSK-YAWANYKNSL-NC 366

Query: 265 AKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
           A  ++   GI  F+KG+ P +++   + G +F  ++
Sbjct: 367 AYRIFVEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQ 402

 Score = 34.7 bits (78), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 3/79 (3%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTS---STPTTAMEVVRKLLANEGPRGFYKGTLTP 85
            + G     A V V QP D  K R+Q+    +    ++    ++   EG   F+KG    
Sbjct: 327 FVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIPKFWKGWAPR 386

Query: 86  LIGVGACVSLQFGVNEAMK 104
           L+ VG    + FGV + ++
Sbjct: 387 LMKVGLSGGVSFGVYQYVE 405

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 70/314 (22%), Positives = 120/314 (38%), Gaps = 63/314 (20%)

Query: 41  LVGQPFDTTKVRLQT--------SSTPTTAMEVVRKLLAN-------------------- 72
           +V  PFD  K RLQ+        S      M   R  + N                    
Sbjct: 72  VVTCPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVY 131

Query: 73  --EGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHH--RNADMSSTLSLPQYYACGV 128
             EG R  +KG    L+GV    S+ F      K  +     N   +  + L        
Sbjct: 132 RQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQEAPWIHL----MAAA 187

Query: 129 TGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTIL 185
           T G   +   +PI  V+ R+Q    +G    +K   +C+K +  N+    L RGL+ + L
Sbjct: 188 TAGWATATATNPIWMVKTRVQLDK-AGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYL 246

Query: 186 REGHGCGTYFLVYEALIANQMNKRRGLER------------KDIPAWKLCIFGALSGTAL 233
               G    +L+YE L    + K+R +E+              I  W  C     +G A 
Sbjct: 247 GSVEGI-LQWLLYEQL--KHLIKKRSIEKFGAHDESTMTTTDKIKQW--CQRSGGAGLAK 301

Query: 234 WL---MVYPLDVIKSVMQTDNLQ--KPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRA 288
           ++   + YP +V+++ ++   L+  K K+   + S  + +    G+ + + G  P ++R 
Sbjct: 302 FMASIVTYPHEVVRTRLRQSPLENGKVKYTGLVQSF-RVIIKEEGLASMYSGLTPHLMRT 360

Query: 289 APANGATFATFELA 302
            P +   F T+E+ 
Sbjct: 361 VPNSIIMFGTWEVV 374

>Scas_718.24
          Length = 337

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 77/174 (44%), Gaps = 19/174 (10%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA---------MEVVRKLLANEGPRGFYKGT 82
           G AGG++ + V    D  + RL   S  +           ++V +K L ++G  G Y+G 
Sbjct: 154 GAAGGLSLLFV-YSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGF 212

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIE 142
           L  ++G+     L FG+ +++K      + + S   S    +    TG    S+   P++
Sbjct: 213 LPSVVGIIVYRGLYFGLYDSIKPVLLTGSLEGSFLASFLLGWVV-TTGASTCSY---PLD 268

Query: 143 HVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTILREGHGCGT 193
            VR ++     SG   ++KG  +C KK+   +   +L +G    ILR   G G 
Sbjct: 269 TVRRKMMMT--SGQAVKYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGAGV 320

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 80/172 (46%), Gaps = 20/172 (11%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTK-----VRLQTSSTPT----TAMEVVRKLLANEGPRGFY 79
           +L G +GG+AQ  +   F T        R + +S P     ++++V +++ A EG RG  
Sbjct: 111 ILGGVSGGVAQAYLTMGFCTCMKTVEITRSKAASAPGVPVPSSLQVFKQIFAAEGLRGIN 170

Query: 80  KGT----LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNS 135
           KG     +  +   G+   L   V + ++R  H R+ +  S  ++ +  A  + GG+  S
Sbjct: 171 KGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLS--AMEKIVASALGGGL--S 226

Query: 136 FLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTI 184
               PIE +R+ +Q++T      +     +  + +  N   + L RG+TP I
Sbjct: 227 AWNQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRYIYENNGLRGLYRGVTPRI 278

>Kwal_27.11419
          Length = 298

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 79/187 (42%), Gaps = 20/187 (10%)

Query: 123 YYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTP 182
           ++  G  GG+ ++ +  P + ++ RLQ    S         L+ ++ +     L +G  P
Sbjct: 10  HFIGGFVGGLTSAVILQPFDLLKTRLQQNKSSNL-------LDVVRSIETPGQLWKGTLP 62

Query: 183 TILREGHGCGTYFLVYEALIANQMNKR-RGLERKD--------IPAWKLCIFGALSGTAL 233
           + LR   G   +      + +   +KR +G+  K+        +  ++  I GA++  A+
Sbjct: 63  SALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAV 122

Query: 234 WLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANG 293
            +   P+ V+K   ++        G +    A  +Y + GI   F G G T++R AP  G
Sbjct: 123 GVATMPITVLKVRFESTMYNYKSLGEA----ATHIYRSEGIRGLFSGCGATVMRDAPYAG 178

Query: 294 ATFATFE 300
                +E
Sbjct: 179 LYVLFYE 185

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 119/303 (39%), Gaps = 53/303 (17%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLI- 87
            + G  GG+   ++ QPFD  K RLQ + + +  ++VVR +   E P   +KGTL   + 
Sbjct: 11  FIGGFVGGLTSAVILQPFDLLKTRLQQNKS-SNLLDVVRSI---ETPGQLWKGTLPSALR 66

Query: 88  -GVGACVSLQF--GVNEAM--KRFFHHRNADMSSTLSLPQ--YYACGVTGGIVNSFL--- 137
             VG+ + L     V  A+  KR       + SS+  LPQ   Y   ++G I  + +   
Sbjct: 67  TSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSF-LPQLSMYENLISGAITRAAVGVA 125

Query: 138 ASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTILREGHGCGTY 194
             PI  +++R ++     T   +K   E    +  +   + L  G   T++R+    G Y
Sbjct: 126 TMPITVLKVRFES-----TMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGLY 180

Query: 195 FLVYEALIANQMNKRRGLERKDIPAWK----------------LCIFGALSGTALWLMV- 237
            L YE         +  L R  +P W                 +    A S  +L   + 
Sbjct: 181 VLFYE-------QSKLQLPR-ILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLATTIT 232

Query: 238 YPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFA 297
            P D IK+ MQ +  Q   F  +  S+ +           F G    + R A + G  + 
Sbjct: 233 SPFDTIKTRMQLNPSQYYGFIQTFKSIIRYERPRN----LFDGLSLRLSRKALSAGIAWG 288

Query: 298 TFE 300
            +E
Sbjct: 289 IYE 291

 Score = 28.5 bits (62), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 17/84 (20%), Positives = 38/84 (45%), Gaps = 2/84 (2%)

Query: 25  VVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA-MEVVRKLLANEGPRGFYKGTL 83
           ++  + A ++  +A  +   PFDT K R+Q + +     ++  + ++  E PR  + G  
Sbjct: 215 IINSIAAFSSASLATTIT-SPFDTIKTRMQLNPSQYYGFIQTFKSIIRYERPRNLFDGLS 273

Query: 84  TPLIGVGACVSLQFGVNEAMKRFF 107
             L        + +G+ E + + F
Sbjct: 274 LRLSRKALSAGIAWGIYEELVKKF 297

>Kwal_27.12481
          Length = 304

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 75/174 (43%), Gaps = 19/174 (10%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA---------MEVVRKLLANEGPRGFYKGT 82
           G AGG++ + V    D  + RL   S              ++V +K LA++G  G Y+G 
Sbjct: 122 GAAGGLSLMFV-YSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGF 180

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIE 142
           L  ++G+     L FG  +++K      + + S   S    +A   TG    S+   P++
Sbjct: 181 LPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASFLLGWAV-TTGASTASY---PLD 236

Query: 143 HVRIRLQTQTGSGTNAEFKGPLECIKKL---RHNKALLRGLTPTILREGHGCGT 193
            VR R+     SG   ++ G  +  +K+      K+L +G    ILR   G G 
Sbjct: 237 TVRRRMMMT--SGQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGV 288

>Scas_715.45
          Length = 305

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 83/193 (43%), Gaps = 19/193 (9%)

Query: 118 LSLPQYYACGVTGGIV----NSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN 173
           L   +YYA    GGIV         +P++ ++ RLQ    +   +   G ++ +KK    
Sbjct: 10  LYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDP-TLYRSNTSGIIQILKKEGLG 68

Query: 174 KALLRGLTPTILREG-HGCGTY--FLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSG 230
           K L  G+  T +     G G Y  + +++ L +  + K      K    ++  I+   S 
Sbjct: 69  K-LFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYK----YRTSIYLLSSA 123

Query: 231 TALW---LMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLR 287
           TA +   +M+ P + IK   QT     P + N++    K +YA  G+  F+KG  P   R
Sbjct: 124 TAEFFADIMLCPFEAIKVKQQTT---MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCR 180

Query: 288 AAPANGATFATFE 300
             P     F +FE
Sbjct: 181 QIPYTMCKFTSFE 193

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 87/204 (42%), Gaps = 13/204 (6%)

Query: 7   SPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP--TTAME 64
           S  L+ D  E   +     +  L + TA   A +++  PF+  KV+ QT+  P     +E
Sbjct: 100 STHLVKD--EATAYKYRTSIYLLSSATAEFFADIMLC-PFEAIKVKQQTTMPPWCNNVIE 156

Query: 65  VVRKLLANEGPRGFYKGTLTPL----IGVGACVSLQFG-VNEAMKRFFHHRNADMSSTLS 119
             +K+ A EG  GFYKG +TPL    I    C    F  + EA+      + ++MS+   
Sbjct: 157 GWKKMYAKEGLNGFYKG-ITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQ 215

Query: 120 LPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRG 179
           +   +  G   GI+ + ++ P + +  ++  +     N      L+ I        L  G
Sbjct: 216 ISVSFVGGYMAGILCAIVSHPADVMVSKINNE--RKVNESMNVALKRIYSRIGFVGLWNG 273

Query: 180 LTPTILREGHGCGTYFLVYEALIA 203
           L   IL  G      +L+Y++  A
Sbjct: 274 LPVRILMIGTLTSFQWLIYDSFKA 297

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 61/271 (22%), Positives = 109/271 (40%), Gaps = 33/271 (12%)

Query: 30  LAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT-AMEVVRKLLANEGPRGFYKGTLTPLIG 88
           +AG+ GG A + V  P  T    LQT        +E ++++    G  G++ G  + + G
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQTKENEARPKLETIKEIYNKNGIIGYFLGLESAVYG 75

Query: 89  VGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYA------CGVTGGIVNSFLASPIE 142
           +     + +        +F+   A  + TL+  QY +           G + +  ++PI 
Sbjct: 76  MATTNFVYY--------YFYEWCAKTARTLTTKQYLSTWESILASTIAGSMTAVASNPIW 127

Query: 143 HVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALI 202
               R+   T + +N      +  I K      LL GL P ++   +    Y  VYE L 
Sbjct: 128 VANTRM---TVAKSNHSTLRTVIDIVKTDGPLTLLNGLKPALVLVSNPIIQY-TVYEQL- 182

Query: 203 ANQMNKRRGLERKDI--PAWKLCIFGALSGTALWLMVYPLDVIKS---VMQTDNLQKPKF 257
               N    L+RK +  P+W   + GA+   A     YP   +K+   +MQ D    PK 
Sbjct: 183 ---KNLVLRLQRKKVLSPSWAF-LLGAIGKLAATGTTYPYITLKTRMHLMQND----PKH 234

Query: 258 GNSISSVAKTLYANGGIGAFFKGFGPTMLRA 288
             S+ S+   +    G+   + G    ++++
Sbjct: 235 QKSMWSLIVEIVKKDGVSGLYNGVAVKLVQS 265

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 36/86 (41%), Gaps = 6/86 (6%)

Query: 216 DIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQT-DNLQKPKFGNSISSVAKTLYANGGI 274
           D+      I G+L G A   + YPL  I + +QT +N  +PK         K +Y   GI
Sbjct: 8   DVDELAHAIAGSLGGAASIAVTYPLVTITTNLQTKENEARPKL-----ETIKEIYNKNGI 62

Query: 275 GAFFKGFGPTMLRAAPANGATFATFE 300
             +F G    +   A  N   +  +E
Sbjct: 63  IGYFLGLESAVYGMATTNFVYYYFYE 88

>Scas_667.4
          Length = 308

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 80/177 (45%), Gaps = 25/177 (14%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA---------MEVVRKLLANEGPRGFYKGT 82
           G AGG++ + V    D  + RL   +  +           ++V ++ LA +G  G Y+G 
Sbjct: 125 GAAGGLSLLFV-YSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGF 183

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVN---SFLAS 139
           L  ++G+     L FG+ +++K       A ++ +L    + A  + G IV    S  + 
Sbjct: 184 LPSVVGIIVYRGLYFGLYDSLK------PAVLTGSLE-GSFLASFLLGWIVTTGASTASY 236

Query: 140 PIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTILREGHGCGT 193
           P++ VR R+     SG   ++ G  +C +K+   +   +L +G    ILR   G G 
Sbjct: 237 PLDTVRRRMMMT--SGQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAGV 291

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/247 (21%), Positives = 97/247 (39%), Gaps = 25/247 (10%)

Query: 45  PFDTTKVRLQTS-STPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAM 103
           P D  K RLQ +    T+ ++  RK++ANEG +  Y G     +G     + ++G  E  
Sbjct: 38  PLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYF 97

Query: 104 KRFFHHRNADMSSTLS--LPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFK 161
           K  +       SS LS  +  Y     T   +   +  P E ++++ QT      N    
Sbjct: 98  KHLY-------SSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVD 150

Query: 162 GPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIA-------NQMNKRRGLER 214
           G  +   +    KA  +G+ P   R+       F  +E ++         +  +   L++
Sbjct: 151 GWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQ 210

Query: 215 KDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGI 274
             +      + G L+G     + +P DV+ S + ++     K   S+S  +K +Y   G 
Sbjct: 211 ISVSF----VGGYLAGILCAAVSHPADVMVSKINSER----KANESMSVASKRIYQKIGF 262

Query: 275 GAFFKGF 281
              + G 
Sbjct: 263 TGLWNGL 269

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 235 LMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYA-NGGIGAFFKGFGPTMLRAAPANG 293
           +M+ P + IK   QT     P F N++    K +YA +GG+ AF+KG  P   R  P   
Sbjct: 125 IMLCPFEAIKVKQQTT---MPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTM 181

Query: 294 ATFATFE 300
             F +FE
Sbjct: 182 CKFTSFE 188

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 63/150 (42%), Gaps = 41/150 (27%)

Query: 63  MEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQ 122
           ++V +K LA++G  G Y+G L  ++G+     L FG+ +++K                  
Sbjct: 161 VDVYKKTLASDGVAGLYRGFLPSVVGIVVYRGLYFGLYDSLKPLL--------------- 205

Query: 123 YYACGVTGGIVNSFLAS----------------PIEHVRIRLQTQTGSGTNAEFKGPLEC 166
                +TG + NSFLAS                P++ VR R+     SG   ++ G  + 
Sbjct: 206 -----LTGSLENSFLASFLLGWAVTTGASTASYPLDTVRRRMMMT--SGQAVKYDGAFDA 258

Query: 167 IKKL---RHNKALLRGLTPTILREGHGCGT 193
            +K+      K+L +G    ILR   G G 
Sbjct: 259 FRKIVAAEGIKSLFKGCGANILRGVAGAGV 288

 Score = 34.7 bits (78), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 77/194 (39%), Gaps = 53/194 (27%)

Query: 138 ASPIEHVRIRLQTQT-----GSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTILREGH 189
           A+PIE V++ +Q Q      GS  +  + G +EC K+   ++   +  RG T  ++R   
Sbjct: 28  AAPIERVKLLIQNQDEMIKQGS-LDRRYTGIVECFKRTAADEGVASFWRGNTANVIR--- 83

Query: 190 GCGTYFLVYEAL---IANQMNKRRGLERKDIPAWKLCIFGALSGTALWL----------- 235
               YF   +AL     +++    G ++++             G A W            
Sbjct: 84  ----YFPT-QALNFAFKDKIKAMFGFKKEE-------------GYAKWFAGNLASGGLAG 125

Query: 236 -----MVYPLDVIKSVMQTDNLQKPKFG----NSISSVAKTLYANGGIGAFFKGFGPTML 286
                 VY LD  ++ +  D+    K G    N +  V K   A+ G+   ++GF P+++
Sbjct: 126 GLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVV 185

Query: 287 RAAPANGATFATFE 300
                 G  F  ++
Sbjct: 186 GIVVYRGLYFGLYD 199

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 100/274 (36%), Gaps = 41/274 (14%)

Query: 42  VGQPFDTTKVRLQTSSTPTTAMEVV---RKLLANEG-PRGFYKGTLTPLIGVGACVSLQF 97
           V    DT K R Q +        ++   R L   EG  RG Y G    ++G     ++ F
Sbjct: 70  VMHSLDTVKTRQQGAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAVFF 129

Query: 98  GVNEAMKRFFHHRNADMSSTLSLPQYY---ACGVTGGIVNSFLASPIEHVRIRLQTQTGS 154
           G  E +KR        M +   + + Y   A G  G + +S +  P E ++ RLQ Q G 
Sbjct: 130 GTYEWVKR-------QMINEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQ-GC 181

Query: 155 GTNAEFKG---------PLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQ 205
             N  F+           +  I +     AL  G   T+ R+       F  YE      
Sbjct: 182 YNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWA 241

Query: 206 MNKRRGLERKDIPAW----KLCIFGALSGTALWLMVYPLDVIKSVMQT---------DNL 252
                 LERK +          + GA +G    ++  PLDV+K+ +QT         D  
Sbjct: 242 FL----LERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDAS 297

Query: 253 QKPKFGNSISSVAKTLYANGGIGAFFKGFGPTML 286
              +   SI      +    G+G  F G GP  +
Sbjct: 298 APARLNGSIFRSLLVVLRYEGLGGAFSGVGPRFI 331

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 73/319 (22%), Positives = 113/319 (35%), Gaps = 37/319 (11%)

Query: 1   MSEEFPSPQLIDDLEEHPQHDNARV-VKDLLAGTAGGIAQVLVGQPFDTTKVR--LQTSS 57
           M+    SPQL    E+H +   A   +  ++AG+  G+    V  P DT K+R  LQ +S
Sbjct: 1   MAASSGSPQLAT--EDHLRKGEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLAS 58

Query: 58  TPTT--AMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMS 115
                  +   R +   EG R  +KG +          SLQFG    +       N   +
Sbjct: 59  EHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWL-------NTAAA 111

Query: 116 STLSLPQYY--ACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN 173
           S    PQ +  A G   G+V+S L  P++ +R RL     S      +     I      
Sbjct: 112 SAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANR-SAHFFSLRRQARVIWDTEGP 170

Query: 174 KALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTAL 233
               RG    I       G  F +YE             +   +P W        +G   
Sbjct: 171 AGFFRGGAWAIAATTLTTGLIFGIYETCTIAA-------DTYGLP-WLAAAASPTAGLVS 222

Query: 234 WLMVYPLDVIKSVMQ-TDNLQKPKF-----------GNSISSVAKTLYANGGIGAFFKGF 281
              V+PLD ++  +Q  D    P F           G     +A  +    GI + +KG 
Sbjct: 223 KAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGL 282

Query: 282 GPTMLRAAPANGATFATFE 300
              + ++ P    T   ++
Sbjct: 283 TMALCKSTPTTVITLWVYQ 301

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 73/179 (40%), Gaps = 43/179 (24%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA---------MEVVRKLLANEGPRGFYKGT 82
           G AGG++ + V    D  + RL   +  + +         ++V +K L  +G  G Y+G 
Sbjct: 126 GAAGGLSLLFV-YSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGF 184

Query: 83  LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFL----- 137
           +  ++G+     L FG+ ++ K                P      + G  V SFL     
Sbjct: 185 VPSVLGIIVYRGLYFGLYDSFK----------------PVLLTGALEGSFVASFLLGWVI 228

Query: 138 -------ASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTILR 186
                  + P++ VR R+     SG   ++ G L+C++K+   +   +L +G    I R
Sbjct: 229 TMGASTASYPLDTVRRRMMMT--SGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFR 285

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 87/236 (36%), Gaps = 9/236 (3%)

Query: 16  EHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEV--VRKLLANE 73
           + PQ+  +   K  LAG  G  +      P D  K R+Q   T      V   RK++A E
Sbjct: 4   QLPQYSYSDYAKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFRKIIAEE 63

Query: 74  GPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFF-HHRNADMSSTLSLPQYYACGVTGGI 132
           G      G    L+G     + +FG  E  K+FF      D ++      Y         
Sbjct: 64  GAGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEF 123

Query: 133 VNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCG 192
           +      P+E  RIRL +Q          G    I K     +   G TP + ++     
Sbjct: 124 LADIALCPLEATRIRLVSQPTFANG--LVGGFSRILKEEGVGSFYSGFTPILFKQIPYNI 181

Query: 193 TYFLVYE---ALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKS 245
             FLV+E    L  +    +  L +  + A  L + G  +G A  ++  P D + S
Sbjct: 182 AKFLVFERASELYFSLAPPKDTLSQTSLTAINL-LSGLTAGLAAAIVSQPADTLLS 236

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 28  DLLAGTAGGIAQVLVGQPFDT--TKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTP 85
           +LL+G   G+A  +V QP DT  +KV   + +   + + ++ +L    G  G + G  T 
Sbjct: 213 NLLSGLTAGLAAAIVSQPADTLLSKVNKTSKAPGQSTVGLLFQLAKQLGFVGSFAGLPTR 272

Query: 86  LIGVGACVSLQFGVNEAMKR 105
           L+ VG   SLQFG+   +K+
Sbjct: 273 LVMVGTLTSLQFGIYGQLKK 292

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 66/166 (39%), Gaps = 11/166 (6%)

Query: 140 PIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYE 199
           PI+ V+ R+Q +  +  N    G    I       ALL G  PT+L         F  YE
Sbjct: 33  PIDVVKTRIQLEP-TVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGYE 91

Query: 200 ALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLM---VYPLDVIKSVMQTDNLQKPK 256
                 ++    L       +K  ++   +  A +L    + PL+  +  +    + +P 
Sbjct: 92  VFKKFFIDT---LGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRL----VSQPT 144

Query: 257 FGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELA 302
           F N +      +    G+G+F+ GF P + +  P N A F  FE A
Sbjct: 145 FANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERA 190

 Score = 32.0 bits (71), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 3/81 (3%)

Query: 221 KLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKG 280
           K  + GA+   +    + P+DV+K+ +Q   L+   +   +    + + A  G GA   G
Sbjct: 15  KFALAGAIGCGSTHSSMVPIDVVKTRIQ---LEPTVYNKGMVGSFRKIIAEEGAGALLTG 71

Query: 281 FGPTMLRAAPANGATFATFEL 301
           FGPT+L  +      F  +E+
Sbjct: 72  FGPTLLGYSIQGAFKFGGYEV 92

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 66/324 (20%), Positives = 110/324 (33%), Gaps = 60/324 (18%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGP--------RGFYK 80
           L  G AG  A+ L+  P D  K+  QTS+          + L N G         RG ++
Sbjct: 58  LAGGVAGSCAKTLIA-PLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQ 116

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQY--YACGVTGGIVNSFLA 138
           G    L+ +    +++F   E +      RN  + S      +     G   G+ + F  
Sbjct: 117 GHSATLLRIFPYAAVKFIAYEQI------RNVIIPSKEYETHFRRLCSGSLAGLCSVFCT 170

Query: 139 SPIEHVRIRLQTQT---------------GSGTNAEFKGPLECIKKLRHNKALLRGLTPT 183
            P++ +R+RL   T                   +          K         RG  PT
Sbjct: 171 YPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYIPT 230

Query: 184 ILREGHGCGTYFLV---------------YEALIANQMNKR---------RGLERKDIPA 219
           ++      G  F                 Y  L  + ++           R  +R  +  
Sbjct: 231 VIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTRTGKRIPLNT 290

Query: 220 WKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKP---KFGNSISSVAKTLYANGGIGA 276
           W   + G L+G A     YP ++I+  +Q   +  P   KF  S+S +AK ++   G   
Sbjct: 291 WAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKF-TSMSEMAKIIFHERGWRG 349

Query: 277 FFKGFGPTMLRAAPANGATFATFE 300
           FF G     ++  P    +F  +E
Sbjct: 350 FFVGLSIGYIKVTPMVACSFFVYE 373

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 38/86 (44%), Gaps = 7/86 (8%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP-------TTAMEVVRKLLANEGPRGFYK 80
           +LLAG   G+A      PF+  + RLQ  +         T+  E+ + +    G RGF+ 
Sbjct: 293 ELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERGWRGFFV 352

Query: 81  GTLTPLIGVGACVSLQFGVNEAMKRF 106
           G     I V   V+  F V E MK +
Sbjct: 353 GLSIGYIKVTPMVACSFFVYERMKWY 378

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 76/196 (38%), Gaps = 26/196 (13%)

Query: 127 GVTGGIVNSF---LASPIEHVRIRLQTQTGSGTN--AEFKGPLEC---IKKLRHNKALLR 178
           G+ GG+  S    L +P++ ++I  QT           F+G L     I      + + +
Sbjct: 57  GLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQ 116

Query: 179 GLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVY 238
           G + T+LR        F+ YE  I N +   +  E       +LC  G+L+G       Y
Sbjct: 117 GHSATLLRIFPYAAVKFIAYEQ-IRNVIIPSKEYETHFR---RLCS-GSLAGLCSVFCTY 171

Query: 239 PLDVIKSVMQ-------------TDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTM 285
           PLD+I+  +                 +       ++SS A           F++G+ PT+
Sbjct: 172 PLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYIPTV 231

Query: 286 LRAAPANGATFATFEL 301
           +   P  G +F   +L
Sbjct: 232 IGMIPYAGVSFFAHDL 247

>Scas_645.9
          Length = 391

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 82/200 (41%), Gaps = 28/200 (14%)

Query: 126 CGVTGGIVNSFLASPIEHVRIRLQT-QTGSGTNAEFKGPLECIKKLRH-------NKALL 177
           CG    I+ +   +P+E ++ +LQ+    S +   +    E +K+ R        + AL 
Sbjct: 191 CGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRISGASNALF 250

Query: 178 RGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMV 237
           +GL  T+ R+      Y+  YE    +                   I G++SGT   L+ 
Sbjct: 251 KGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGSISGTIAALVT 310

Query: 238 YPLDVIKSVMQTDNLQKPKFGNSISSVAKT---------------LYANGGIGAFFKGFG 282
           +P DV K+  Q   +     GN+  SV K+               ++   G GA + G  
Sbjct: 311 HPFDVGKTRWQISFM-----GNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGALYTGLV 365

Query: 283 PTMLRAAPANGATFATFELA 302
           P M++ AP+     +++EL+
Sbjct: 366 PRMVKIAPSCAIMISSYELS 385

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 71/187 (37%), Gaps = 9/187 (4%)

Query: 18  PQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEV--VRKLLANEGP 75
           PQ+  +  +K  LAG  G  +      P D  K R+Q   T      V   ++++A EG 
Sbjct: 10  PQYSVSDYMKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGA 69

Query: 76  RGFYKGTLTPLIGVGACVSLQFGVNEAMKRFF-HHRNADMSSTLSLPQYYACGVTGGIVN 134
                G    L+G     + +FG  E  K+FF  +   D +S      Y         + 
Sbjct: 70  GALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLA 129

Query: 135 SFLASPIEHVRIRL--QTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCG 192
                P+E  RIRL  Q Q  +G      G    I K     +   G TP + ++     
Sbjct: 130 DIALCPLEATRIRLVSQPQFANG----LVGGFSRILKEEGIGSFYSGFTPILFKQIPYNI 185

Query: 193 TYFLVYE 199
             FLV+E
Sbjct: 186 AKFLVFE 192

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 2/79 (2%)

Query: 28  DLLAGTAGGIAQVLVGQPFDT--TKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTP 85
           +LL+G   G+A  +V QP DT  +KV     +   + + ++ +L    G  G + G  T 
Sbjct: 217 NLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQSTVGLLAQLAKQLGFFGSFAGLPTR 276

Query: 86  LIGVGACVSLQFGVNEAMK 104
           L+ VG   SLQFG+  ++K
Sbjct: 277 LVMVGTLTSLQFGIYGSLK 295

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 67/167 (40%), Gaps = 13/167 (7%)

Query: 140 PIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTIL----REGHGCGTYF 195
           PI+ V+ R+Q +  +  N    G  + I       ALL G  PT+L    +     G Y 
Sbjct: 37  PIDVVKTRIQLEP-TVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGYE 95

Query: 196 LVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKP 255
           +  +  I N         +  +      +   L+  AL     PL+  +  +    + +P
Sbjct: 96  VFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALC----PLEATRIRL----VSQP 147

Query: 256 KFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELA 302
           +F N +      +    GIG+F+ GF P + +  P N A F  FE A
Sbjct: 148 QFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFERA 194

 Score = 32.7 bits (73), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 3/82 (3%)

Query: 220 WKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFK 279
            K  + GA+   +    + P+DV+K+ +Q   L+   +   +    K + A  G GA   
Sbjct: 18  MKFALAGAIGCGSTHSSMVPIDVVKTRIQ---LEPTVYNKGMVGSFKQIIAGEGAGALLT 74

Query: 280 GFGPTMLRAAPANGATFATFEL 301
           GFGPT+L  +      F  +E+
Sbjct: 75  GFGPTLLGYSIQGAFKFGGYEV 96

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/276 (22%), Positives = 105/276 (38%), Gaps = 30/276 (10%)

Query: 42  VGQPFDTTKVRLQT----SSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQF 97
           V  PF+  K RLQ     S      + ++ +    +G    Y G    ++G      ++F
Sbjct: 27  VTYPFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQGAGALYVGCPAFVVGNTCKAGVRF 86

Query: 98  GVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLA-SPIEHVRIRL-------- 148
              +A++R       D    LS P+    G+  G++ S LA +P E V+  L        
Sbjct: 87  LGFDALRRALQ----DERGALSGPRGMLAGLGAGLLESVLAVTPFEAVKTALIDDRQAAR 142

Query: 149 --QTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQM 206
                 G G    +   L  +        L+    P  LR+       F  Y  L   Q 
Sbjct: 143 PRYQHNGRGAARNYALLLRELGLRGLYGGLV----PVALRQASNQAVRFGCYTQL--KQA 196

Query: 207 NKRRGLERKDIP--AWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSV 264
            +R      D P  + +  + GALSG        P+D +K+ MQ   L   ++G+++   
Sbjct: 197 VQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQA--LDAARYGSTVGCF 254

Query: 265 AKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFE 300
            + +    G+ A ++G  P + R   + G  F  +E
Sbjct: 255 -RAVVREEGVRALWRGATPRLGRLVLSGGIVFTAYE 289

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 7/84 (8%)

Query: 122 QYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLR 178
           Q +  G   GIV  +   P++ V+ R+Q        A +   + C + +      +AL R
Sbjct: 213 QTFLVGALSGIVTVYATMPVDTVKTRMQALDA----ARYGSTVGCFRAVVREEGVRALWR 268

Query: 179 GLTPTILREGHGCGTYFLVYEALI 202
           G TP + R     G  F  YE L+
Sbjct: 269 GATPRLGRLVLSGGIVFTAYEKLL 292

>Scas_687.15*
          Length = 328

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/318 (18%), Positives = 115/318 (36%), Gaps = 61/318 (19%)

Query: 28  DLLAGTAGGIAQVLVGQPFDTTKV--RLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTP 85
            +LAG+A  + +  +  PF+  K   +L   +      E +R +      + ++ G    
Sbjct: 11  QILAGSAAAVFETTLTYPFEFLKTGFQLHRRTVGAKPFEALRPI------KVYFAGCTAL 64

Query: 86  LIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVR 145
            +      S++F   +   +     N    S L  P+    G+  G V S    P E+V+
Sbjct: 65  NLSAIVKTSVRFATFDKACQILRDPNLPKDSLLKGPRLLLAGILTGAVESLCIIPFENVK 124

Query: 146 I-----RLQTQTGSGTNAEFKGPLE---------------------------------CI 167
           +      LQ      T  E  G L+                                  +
Sbjct: 125 VTMIENSLQLSESKPTEKEIAGTLKKKVTFHVAKPKQLSPQEQWRQVYSKYPSSNIFSVV 184

Query: 168 KKL---RHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCI 224
           K++   R  +   +G  PT+ R+       F  Y  L        + L     P  ++  
Sbjct: 185 KEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTL--------KQLISPTQPLNEVYA 236

Query: 225 FGA--LSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFG 282
           FG    S  A+  +  P+DV+K+ MQ+       + NS++  A  ++   G+ + +KG+ 
Sbjct: 237 FGIGLFSSCAVVALTQPIDVVKTRMQSKTAHY-FYKNSLNC-AYRVFVEEGMVSLWKGWL 294

Query: 283 PTMLRAAPANGATFATFE 300
           P + +   + G +F  ++
Sbjct: 295 PRLFKVGLSGGISFGVYQ 312

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 34/80 (42%), Gaps = 3/80 (3%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTP---TTAMEVVRKLLANEGPRGFYKGTLTPLIG 88
           G     A V + QP D  K R+Q+ +       ++    ++   EG    +KG L  L  
Sbjct: 240 GLFSSCAVVALTQPIDVVKTRMQSKTAHYFYKNSLNCAYRVFVEEGMVSLWKGWLPRLFK 299

Query: 89  VGACVSLQFGVNEAMKRFFH 108
           VG    + FGV + ++   H
Sbjct: 300 VGLSGGISFGVYQYVENLSH 319

>Scas_705.9
          Length = 323

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 62/292 (21%), Positives = 113/292 (38%), Gaps = 32/292 (10%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAME-------------VVR---KLLANEGP 75
             A  +A V+V  P D  K  +Q+ +      E             V+R   ++    G 
Sbjct: 11  AIASTMANVIV-YPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKRGL 69

Query: 76  RGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHH----RNADMS--STLSLPQYYACGVT 129
           RG Y+G  T +          F     ++R +      RN      +++S  +    GV 
Sbjct: 70  RGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSISTVEELIVGVG 129

Query: 130 GGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK--ALLRGLTPTILRE 187
              +   + +PIE +  + QT T    N +F   L+ I    + K  +  +G   +++  
Sbjct: 130 AAALTQVVNNPIEVILTKQQT-TDDKDNVDFYSVLKQIYVESNGKLSSYWKGFKVSLILT 188

Query: 188 GHGCGTY--FLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKS 245
            +   T+  +  ++ ++  Q++         +   +  I GAL+     ++  PL V K 
Sbjct: 189 VNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKIISTIITQPLIVAKV 248

Query: 246 VMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFA 297
            +Q  N    KF +    V + LY   G+ A +KG GP + +     G  FA
Sbjct: 249 SLQRSN---SKFKH-FEEVLRYLYKEEGVLALWKGVGPQLTKGVLVQGLVFA 296

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 21/28 (75%)

Query: 223 CIFGALSGTALWLMVYPLDVIKSVMQTD 250
            I GA++ T   ++VYPLDV K+V+Q++
Sbjct: 7   AITGAIASTMANVIVYPLDVAKTVIQSE 34

>Scas_328.1
          Length = 227

 Score = 40.8 bits (94), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 60/130 (46%), Gaps = 15/130 (11%)

Query: 63  MEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFF---HHRNADMSSTLS 119
           ++V +K L  +G  G Y+G L  ++G+     L FG+ +++K         NA + S L 
Sbjct: 83  LDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVLLTGSFENAFLPSFL- 141

Query: 120 LPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---AL 176
                  G    I  S  + P++ VR R+     SG   ++KG ++C +++   +   +L
Sbjct: 142 ------LGWAVTISASTTSYPLDTVRRRMMMT--SGQAVKYKGAIDCFQQIVSQEGVYSL 193

Query: 177 LRGLTPTILR 186
            +G    I R
Sbjct: 194 FKGCGANIFR 203

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 64/313 (20%), Positives = 124/313 (39%), Gaps = 59/313 (18%)

Query: 41  LVGQPFDTTKVRLQT-----------------SSTPTTAMEVVR-------------KLL 70
           +V  PFD  K RLQ+                 S+ P +   V++              + 
Sbjct: 68  VVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVY 127

Query: 71  ANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTG 130
             EG R  +KG    L+GV    S+ F      K  +     +   T  +  +     T 
Sbjct: 128 KQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQETPMI--HLMAAATA 185

Query: 131 GIVNSFLASPIEHVRIRLQ-TQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTILR 186
           G   +   +PI  ++ R+Q  + G  +  ++K   +C+K +  N+    L +GL+ + L 
Sbjct: 186 GWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLG 245

Query: 187 EGHGCGTYFLVYEALIANQMNKRRGLER------------KDIPAWKLCIFGALSGTALW 234
              G    +L+YE +   ++ K R +E+            + +  W  C     +G A +
Sbjct: 246 SVEGI-LQWLLYEQM--KRLIKERSIEKFGYQAEGTKSTSEKVKEW--CQRSGSAGLAKF 300

Query: 235 ---LMVYPLDVIKSVMQTDNLQ--KPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAA 289
              +  YP +V+++ ++    +  K K+   + S  K +    G+ + + G  P ++R  
Sbjct: 301 VASIATYPHEVVRTRLRQTPKENGKRKYTGLVQSF-KVIIKEEGLFSMYSGLTPHLMRTV 359

Query: 290 PANGATFATFELA 302
           P +   F T+E+ 
Sbjct: 360 PNSIIMFGTWEIV 372

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 71/180 (39%), Gaps = 23/180 (12%)

Query: 45  PFDTTKVRLQTSSTPTTAM-------EVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQF 97
           P    K R+Q      T++       + ++ ++ NEG  G YKG     +G    + LQ+
Sbjct: 195 PIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLGSVEGI-LQW 253

Query: 98  GVNEAMKRFFHHRN-------ADMSSTLSLPQYYACGVTGG-----IVNSFLASPIEHVR 145
            + E MKR    R+       A+ + + S      C  +G       V S    P E VR
Sbjct: 254 LLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAKFVASIATYPHEVVR 313

Query: 146 IRLQTQTGSGTNAEFKGPLECIKKLRHNKALL---RGLTPTILREGHGCGTYFLVYEALI 202
            RL+         ++ G ++  K +   + L     GLTP ++R        F  +E +I
Sbjct: 314 TRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTWEIVI 373

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 55/125 (44%), Gaps = 8/125 (6%)

Query: 176 LLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWL 235
             +G  PTI R+       F  Y  L      K+     K +  +     G  S  A+  
Sbjct: 209 FFQGSMPTIFRQVGNSAVRFTTYTTL------KQMISPNKPLSEYYAFGIGVFSSCAVVA 262

Query: 236 MVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGAT 295
           +  P+DV+K+ MQ+       + NS++ V +T +   G+ + +KG+ P + +   + G +
Sbjct: 263 LTQPIDVVKTRMQSK-YTWSLYRNSLNCVYRT-FIEEGLTSLWKGWVPRLFKVGLSGGVS 320

Query: 296 FATFE 300
           F  ++
Sbjct: 321 FGVYQ 325

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 3/71 (4%)

Query: 32  GTAGGIAQVLVGQPFDTTKVRLQTSSTPT---TAMEVVRKLLANEGPRGFYKGTLTPLIG 88
           G     A V + QP D  K R+Q+  T +    ++  V +    EG    +KG +  L  
Sbjct: 253 GVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFK 312

Query: 89  VGACVSLQFGV 99
           VG    + FGV
Sbjct: 313 VGLSGGVSFGV 323

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 121/308 (39%), Gaps = 41/308 (13%)

Query: 14  LEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANE 73
           + E P+  +      L+ G  GG+   +V QPFD  K RLQ  +  TT    ++++    
Sbjct: 1   MAERPKTSS-----HLIGGFVGGLTSAIVLQPFDLLKTRLQ-QNKDTTLWGTLKEI---R 51

Query: 74  GPRGFYKG----TLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSS---TLSLPQYYAC 126
            P+  ++G    +L   IG    +S       AM +         SS    L++ +  A 
Sbjct: 52  SPKQLWRGALPSSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLAS 111

Query: 127 GV-TGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTP 182
           G  T G+V  F+  PI  +++R ++     T   +K   E  + +      +    G   
Sbjct: 112 GAFTRGVVG-FITMPITIIKVRYES-----TMYSYKSLGEATRHIYSTEGIRGFFNGCGA 165

Query: 183 TILREGHGCGTYFLVYE--ALIANQMNKRRGLERKDIPAWKL-------CIFGALSGTAL 233
           T++R+    G Y L+YE   L+   M     +   +   +          I   +S +  
Sbjct: 166 TVMRDAPYAGLYVLLYEKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLA 225

Query: 234 WLMVYPLDVIKSVMQTDNLQKPKFGNS-ISSVAKTLYANGGIGAFFKGFGPTMLRAAPAN 292
             +  P D IK+ MQ D  +   F  + +  V+K  + N      F G    + R A + 
Sbjct: 226 TTITSPFDTIKTRMQLDPTKFSGFYKTLVLIVSKEKFKN-----LFDGLTLRLTRKAFSA 280

Query: 293 GATFATFE 300
           G  +  +E
Sbjct: 281 GIAWGIYE 288

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 69/182 (37%), Gaps = 23/182 (12%)

Query: 41  LVGQPFDTTKVRLQTSSTPTTAM-EVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGV 99
            +  P    KVR +++     ++ E  R + + EG RGF+ G    ++       L   +
Sbjct: 121 FITMPITIIKVRYESTMYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGLYVLL 180

Query: 100 NEAMKRFFHHRNADMSSTLSLPQYYACGV----TGGIVNSF-----------LASPIEHV 144
            E  K          SST+S   Y   G+    T  +VNS            + SP + +
Sbjct: 181 YEKAKLLVPMMLP--SSTIS---YDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTI 235

Query: 145 RIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIAN 204
           + R+Q      +   F   L  I      K L  GLT  + R+    G  + +YE LI  
Sbjct: 236 KTRMQLDPTKFSG--FYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSAGIAWGIYEELIKR 293

Query: 205 QM 206
            M
Sbjct: 294 FM 295

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 28  DLLAGTAGGIAQVLVGQPFDT--TKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTP 85
           +LL+G   G+A  +V QP DT  +KV     +   + + ++ +L    G  G + G  T 
Sbjct: 213 NLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFAGLPTR 272

Query: 86  LIGVGACVSLQFGVNEAMKR 105
           L+ VG   SLQFG+  ++K+
Sbjct: 273 LVMVGTLTSLQFGIYGSLKK 292

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 72/194 (37%), Gaps = 23/194 (11%)

Query: 18  PQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA--MEVVRKLLANEGP 75
           P +  +   K  LAG  G         P D  K R+Q   T      +   ++++++EG 
Sbjct: 6   PDYSLSDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGA 65

Query: 76  RGFYKGTLTPLIGVGACVSLQFGVNEAMKRFF----------HHRNADMSSTLSLPQYYA 125
                G    L+G     S +FG  E  K+ F          +++N+    + ++ +++A
Sbjct: 66  GALLTGFGPTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFA 125

Query: 126 CGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTIL 185
                         P+E  RIRL +Q          G    I K     +   G TP + 
Sbjct: 126 ---------DIALCPLEATRIRLVSQPTFANG--LVGGFSRILKEEGAGSFYNGFTPILF 174

Query: 186 REGHGCGTYFLVYE 199
           ++       FLV+E
Sbjct: 175 KQIPYNIAKFLVFE 188

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 75/172 (43%), Gaps = 23/172 (13%)

Query: 140 PIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTILREGHGC-GTY- 194
           PI+ V+ R+Q +         KG +   K++  ++   ALL G  PT+L  G+   G++ 
Sbjct: 33  PIDVVKTRIQLEP----TVYNKGMISSFKQIISSEGAGALLTGFGPTLL--GYSLQGSFK 86

Query: 195 ---FLVYEALIANQMNKRRGLERKD-IPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTD 250
              + V++ L  + +   + +  K+ I      I    +  AL     PL+  +  +   
Sbjct: 87  FGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALC----PLEATRIRL--- 139

Query: 251 NLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELA 302
            + +P F N +      +    G G+F+ GF P + +  P N A F  FE A
Sbjct: 140 -VSQPTFANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAKFLVFERA 190

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 5/82 (6%)

Query: 221 KLCIFGALS-GTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFK 279
           K  + GA+  GT    MV P+DV+K+ +Q   L+   +   + S  K + ++ G GA   
Sbjct: 15  KFALAGAIGCGTTHSAMV-PIDVVKTRIQ---LEPTVYNKGMISSFKQIISSEGAGALLT 70

Query: 280 GFGPTMLRAAPANGATFATFEL 301
           GFGPT+L  +      F  +E+
Sbjct: 71  GFGPTLLGYSLQGSFKFGGYEV 92

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 112/261 (42%), Gaps = 37/261 (14%)

Query: 42  VGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVS---LQFG 98
           +GQP +  K  +  + +  +    ++ + +  G  GFY+G L P   + A      L F 
Sbjct: 35  LGQPLEVIKTTMAANRS-FSFFNAIKHVWSRGGVFGFYQG-LIPWAWIEASTKGAVLLFV 92

Query: 99  VNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLA----SPIEHVRIRLQTQTGS 154
             E+  +F     ++  S +        GVTGG+  ++L     + ++ V I  +   G+
Sbjct: 93  SAESEYQFKRMGLSNFGSGI------MGGVTGGVAQAYLTMGFCTCMKTVEITKKKSAGA 146

Query: 155 GTNAEFK-GPLECIKKLRHNKALLRGLTPTILREGHGCGTYF----LVYEAL-----IAN 204
           G   +   G  + I K    K + +G+    +R+    G+ F    LV E +       N
Sbjct: 147 GAIPQSSWGAFKEIYKKDGIKGINKGVNAVAIRQMTNWGSRFGFSRLVEEGIRNATGKTN 206

Query: 205 QMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQT--DNLQKPKFGNSIS 262
             +K   LE+    A    I G LS    W    P++VI+  MQ+  ++  +PK   ++S
Sbjct: 207 PDDKLTALEKIAASA----IGGGLSA---WNQ--PIEVIRVEMQSKKEDPNRPK-NLTVS 256

Query: 263 SVAKTLYANGGIGAFFKGFGP 283
           S  K +Y + GI   ++G  P
Sbjct: 257 SAFKYIYQSSGIKGLYRGVAP 277

>Kwal_33.15597
          Length = 305

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 28  DLLAGTAGGIAQVLVGQPFDT--TKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTP 85
           +LL+G   G+A  +V QP DT  +KV     +   + + ++ +L    G  G + G  T 
Sbjct: 213 NLLSGLTAGLAAAIVSQPADTLLSKVNKAKKAPGQSTIGLLGQLAKELGFVGSFAGLPTR 272

Query: 86  LIGVGACVSLQFGVNEAMKR 105
           L+ VG   SLQFG+  ++K+
Sbjct: 273 LVMVGTLTSLQFGIYGSLKK 292

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 73/194 (37%), Gaps = 23/194 (11%)

Query: 18  PQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA--MEVVRKLLANEGP 75
           PQ+  +   K  LAG  G         P D  K R+Q   T      +   ++++++EG 
Sbjct: 6   PQYTISDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGA 65

Query: 76  RGFYKGTLTPLIGVGACVSLQFGVNEAMKRFF----------HHRNADMSSTLSLPQYYA 125
                G    L+G     S +FG  E  K+ F          +++N+    + ++ +++A
Sbjct: 66  GALLTGFGPTLLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFA 125

Query: 126 CGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTIL 185
                         P+E  RIRL +Q          G    I K     +   G TP + 
Sbjct: 126 ---------DIALCPLEATRIRLVSQPTFANG--LVGGFSRILKEEGLSSFYNGFTPILF 174

Query: 186 REGHGCGTYFLVYE 199
           ++       FLV+E
Sbjct: 175 KQIPYNIAKFLVFE 188

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 75/172 (43%), Gaps = 23/172 (13%)

Query: 140 PIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTILREGHGC-GTY- 194
           PI+ V+ R+Q +         KG +   K++  ++   ALL G  PT+L  G+   G++ 
Sbjct: 33  PIDVVKTRIQLEP----TVYNKGMISSFKQIISSEGAGALLTGFGPTLL--GYSLQGSFK 86

Query: 195 ---FLVYEALIANQMNKRRGLERKD-IPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTD 250
              + V++ L  + +   + +  K+ I      I    +  AL     PL+  +  +   
Sbjct: 87  FGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALC----PLEATRIRL--- 139

Query: 251 NLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELA 302
            + +P F N +      +    G+ +F+ GF P + +  P N A F  FE A
Sbjct: 140 -VSQPTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKFLVFERA 190

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 5/82 (6%)

Query: 221 KLCIFGALS-GTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFK 279
           K  + GA+  GT    MV P+DV+K+ +Q   L+   +   + S  K + ++ G GA   
Sbjct: 15  KFALAGAIGCGTTHSAMV-PIDVVKTRIQ---LEPTVYNKGMISSFKQIISSEGAGALLT 70

Query: 280 GFGPTMLRAAPANGATFATFEL 301
           GFGPT+L  +      F  +E+
Sbjct: 71  GFGPTLLGYSLQGSFKFGGYEV 92

>Scas_613.24
          Length = 177

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/167 (20%), Positives = 67/167 (40%), Gaps = 17/167 (10%)

Query: 125 ACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTI 184
             G  GG+ ++    P++ ++ R+Q   G+            IK ++      RG  P+ 
Sbjct: 13  VSGFIGGLSSAVTLQPLDLLKTRIQQHKGATL-------WSAIKDIKDPIQFWRGTLPSA 65

Query: 185 LREGHGCGTYFL---VYEALIANQMNKRRGLERKDIP---AWKLCIFGALSGTALWLMVY 238
           LR   G   Y     +    + +        +   +P    ++  + GA++   +  +  
Sbjct: 66  LRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGLVGYITM 125

Query: 239 PLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTM 285
           P+ ++K   ++          S++   K +Y   GI  FFKGFGPT+
Sbjct: 126 PITILKVRYESTYYSY----KSMNEAIKDIYKMEGISGFFKGFGPTV 168

 Score = 32.7 bits (73), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 73/168 (43%), Gaps = 23/168 (13%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQ--TSSTPTTAMEVVRKLLANEGPRGFYKGTLTPL 86
           L++G  GG++  +  QP D  K R+Q    +T  +A++ ++       P  F++GTL   
Sbjct: 12  LVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATLWSAIKDIKD------PIQFWRGTLPSA 65

Query: 87  IGVGACVSLQFGVNEAMKRFFHH--RNADMSSTLSLPQ--YYACGVTGGIVN---SFLAS 139
           +      +L       M+    H  + +  S + SLPQ   Y   +TG +      ++  
Sbjct: 66  LRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGLVGYITM 125

Query: 140 PIEHVRIRLQTQTGSGTNAEFKGPLECIK---KLRHNKALLRGLTPTI 184
           PI  +++R ++     T   +K   E IK   K+       +G  PT+
Sbjct: 126 PITILKVRYES-----TYYSYKSMNEAIKDIYKMEGISGFFKGFGPTV 168

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/308 (22%), Positives = 113/308 (36%), Gaps = 37/308 (12%)

Query: 19  QHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGF 78
           Q    R    L+ G  GG+   +  QP D  K R+Q     T    + + L   + P   
Sbjct: 4   QATKPRNSSHLIGGFFGGLTSAVALQPLDLLKTRIQQDKKAT----LWKNLKEIDSPLQL 59

Query: 79  YKGTLTPLI--GVGACVSLQFGVNEAMKRFFHHRNA------------DMSSTLSLPQYY 124
           ++GTL   +   +G+ + L   +N         RNA            + SS+L     Y
Sbjct: 60  WRGTLPSALRTSIGSALYLS-CLNLMRSSLAKRRNAVPSLTNDSNIVYNKSSSLPRLTMY 118

Query: 125 ACGVTGGIVN---SFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLT 181
              +TG        ++  PI  +++R ++   + ++   K  +  I          RG  
Sbjct: 119 ENLLTGAFARGLVGYITMPITVIKVRYESTLYNYSS--LKEAITHIYTKEGLFGFFRGFG 176

Query: 182 PTILREGHGCGTYFLVYEA---LIANQMNKR------RGLERKDIPAWKLCIFGALSGTA 232
            T LR+    G Y L+YE    L+   +  R       G                LS + 
Sbjct: 177 ATCLRDAPYAGLYVLLYEKSKQLLPMVLPSRFIHYNPEGGFTTYTSTTVNTTSAVLSASL 236

Query: 233 LWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPAN 292
              +  P D IK+ MQ   L+  KF NS ++   ++  N  +   F G    + R A + 
Sbjct: 237 ATTVTAPFDTIKTRMQ---LEPSKFTNSFNTFT-SIVKNENVLKLFSGLSMRLARKAFSA 292

Query: 293 GATFATFE 300
           G  +  +E
Sbjct: 293 GIAWGIYE 300

>Scas_696.9
          Length = 312

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 64/159 (40%), Gaps = 14/159 (8%)

Query: 47  DTTKVRLQTSSTPT-TAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKR 105
           + T+++  ++  P  ++  V R + A EG RG YKG     I        +FG +  ++ 
Sbjct: 137 EITRLKSASAGAPVQSSWNVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSRLVED 196

Query: 106 FFHHRNADMSSTLSLPQYYACGVT---GGIVNSFLASPIEHVRIRLQTQT---GSGTNAE 159
           +             L  +   G T   GG+  S    PIE +R+ +Q++        N  
Sbjct: 197 WVRKATGKTKPEDRLNAWEKIGATAVGGGL--SAWNQPIEVIRVEMQSKKEDPNRPKNLT 254

Query: 160 FKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVY 198
                + I K    K L RG+TP I     G G +  V+
Sbjct: 255 VAKTFKYIMKTNGVKGLYRGVTPRI-----GLGIWQTVF 288

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 68/323 (21%), Positives = 117/323 (36%), Gaps = 46/323 (14%)

Query: 14  LEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA--MEVVRKLLA 71
           + ++  +DN  ++    AG+  G+    +  PF+  K  LQ       A   EV+     
Sbjct: 1   MTQNKVNDNVTLIT---AGSVSGLFSATITYPFEFLKTGLQLHRNVVAAKPFEVL----- 52

Query: 72  NEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGG 131
               R ++ G     IGV    SL+F   +    +         + LS  Q    G   G
Sbjct: 53  GYQVRTYFAGCSAVNIGVVMKTSLRFLAFDKASEWLRPPALAKDAPLSGVQLLMAGALTG 112

Query: 132 IVNSFLASPIEHVRIR------LQTQTGSGTNAEFKGPLEC-IKKLRHNKALLRG----- 179
            + S    P E+V++       L  +  + T +  +G +   +KK  H K  LR      
Sbjct: 113 TMESLCIIPFENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEAL 172

Query: 180 ----------LTPTILREGHGCGTYFLVYEALIANQ------------MNKRRGLERKDI 217
                      T   L   HG   YF      +  Q            M K+   +    
Sbjct: 173 FPEKLPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKEYQN 232

Query: 218 PAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAF 277
             +   + G +S  A+     PLDVIK+ MQ  +     + NSI+  A  ++   G    
Sbjct: 233 NEYFATLLGLISSCAVVGATQPLDVIKTRMQAKD-SVLLYRNSINC-AYRIFVEEGFAML 290

Query: 278 FKGFGPTMLRAAPANGATFATFE 300
           +KG+ P +++   +   +F  ++
Sbjct: 291 WKGWLPRLMKVGLSGSVSFGIYQ 313

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 49/127 (38%), Gaps = 40/127 (31%)

Query: 215 KDIP--AWKLCIFGALSGTALWLMVYPLDVIKSVM-------------QTDNLQ------ 253
           KD P    +L + GAL+GT   L + P + +K  M              T N+Q      
Sbjct: 95  KDAPLSGVQLLMAGALTGTMESLCIIPFENVKVAMIQNSLLSHERLNTTTSNVQGQVANE 154

Query: 254 -------KP------------KFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGA 294
                  KP            K   ++ + A  LY   G+ A+FKG  PT++R    +  
Sbjct: 155 VKKTFHKKPTLRSSYEALFPEKLPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVV 214

Query: 295 TFATFEL 301
            F TF +
Sbjct: 215 RFTTFTM 221

>Scas_673.17
          Length = 314

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 84/200 (42%), Gaps = 18/200 (9%)

Query: 109 HRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIK 168
           H+  D +++       A  +  G  +S L  P++ V+ R+Q +         KG +   K
Sbjct: 10  HKIPDYAASDYFKFALAGAIGCGTTHSSLV-PVDVVKTRIQLEP----TVYNKGMVGSFK 64

Query: 169 KLRHNK---ALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIF 225
           K+  ++   ALL G  PT+L         F  YE      ++    +  ++   +K  ++
Sbjct: 65  KIIADEGAGALLTGFGPTLLGYSVQGAFKFGGYEVFKKLSIDT---IGYENAVHYKNSVY 121

Query: 226 GALSGTALWLM---VYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFG 282
              +  A +L    + PL+  +  +    + +P F N +      +    G+G+F+ GF 
Sbjct: 122 MGSAAVAEFLADIALCPLEATRIRL----VSQPTFANGLVGGFSRILKEEGVGSFYSGFT 177

Query: 283 PTMLRAAPANGATFATFELA 302
           P + +  P N A F  FE A
Sbjct: 178 PILFKQIPYNIAKFLVFERA 197

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 28  DLLAGTAGGIAQVLVGQPFDT--TKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTP 85
           +LL+G   G A   V QP DT  +KV     +   + + ++ +L    G  G + G  T 
Sbjct: 220 NLLSGLTAGFAAAFVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGVIGSFAGLPTR 279

Query: 86  LIGVGACVSLQFGVNEAMKR 105
           LI VG   SLQF +  ++K 
Sbjct: 280 LIMVGTLTSLQFAIYGSLKN 299

 Score = 35.8 bits (81), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 72/199 (36%), Gaps = 23/199 (11%)

Query: 13  DLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEV--VRKLL 70
           D  + P +  +   K  LAG  G         P D  K R+Q   T      V   +K++
Sbjct: 8   DAHKIPDYAASDYFKFALAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNKGMVGSFKKII 67

Query: 71  ANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRF----------FHHRNADMSSTLSL 120
           A+EG      G    L+G     + +FG  E  K+            H++N+    + ++
Sbjct: 68  ADEGAGALLTGFGPTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAV 127

Query: 121 PQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGL 180
            ++ A              P+E  RIRL +Q          G    I K     +   G 
Sbjct: 128 AEFLA---------DIALCPLEATRIRLVSQPTFANG--LVGGFSRILKEEGVGSFYSGF 176

Query: 181 TPTILREGHGCGTYFLVYE 199
           TP + ++       FLV+E
Sbjct: 177 TPILFKQIPYNIAKFLVFE 195

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 77/180 (42%), Gaps = 22/180 (12%)

Query: 131 GIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTIL-- 185
           GI +S +  PI+ V+ R+Q +         KG +   K++  ++   ALL G  PT+L  
Sbjct: 25  GITHSSMV-PIDVVKTRIQLEP----TVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGY 79

Query: 186 --REGHGCGTYFLVYEALIANQMNKRRGLERKD-IPAWKLCIFGALSGTALWLMVYPLDV 242
             +     G Y L ++ L  + M     +  K+ I      I    +  AL     PL+ 
Sbjct: 80  SLQGSFKFGGYEL-FKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALC----PLEA 134

Query: 243 IKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELA 302
            +  +    + +P F N +      +    G+G+F+ GF P + +  P N A F  FE A
Sbjct: 135 TRIRL----VSQPTFANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYNIAKFFVFEHA 190

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 69/186 (37%), Gaps = 7/186 (3%)

Query: 18  PQHDNARVVKDLLAGTAG-GIAQVLVGQPFDTTKVRLQTSSTPTTAMEV--VRKLLANEG 74
           P++  +   K  LAG  G GI    +  P D  K R+Q   T      V   ++++++EG
Sbjct: 6   PEYTVSDYAKFALAGAIGCGITHSSM-VPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEG 64

Query: 75  PRGFYKGTLTPLIGVGACVSLQFGVNEAMKRF-FHHRNADMSSTLSLPQYYACGVTGGIV 133
                 G    L+G     S +FG  E  K+    +   D +       Y          
Sbjct: 65  AGALLTGFGPTLLGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFF 124

Query: 134 NSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGT 193
                 P+E  RIRL +Q  +  N  F G    I K     +   G TP + ++      
Sbjct: 125 ADIALCPLEATRIRLVSQP-TFANGLFGG-FSRILKEEGVGSFYNGFTPILFKQIPYNIA 182

Query: 194 YFLVYE 199
            F V+E
Sbjct: 183 KFFVFE 188

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 41  LVGQPFDT--TKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFG 98
           +V QP DT  +KV     +   + + ++ +L    G  G + G  T L+ VG   SLQFG
Sbjct: 226 VVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFTGLPTRLVMVGTLTSLQFG 285

Query: 99  VNEAMKR 105
           +   +K+
Sbjct: 286 IYGTLKK 292

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 35.4 bits (80), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 9/91 (9%)

Query: 23  ARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLAN--------EG 74
           A + K  +   +GG+AQ LV  PFD  + R Q  +     +    K +++        EG
Sbjct: 9   ANLYKLAMGAISGGVAQTLV-YPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEG 67

Query: 75  PRGFYKGTLTPLIGVGACVSLQFGVNEAMKR 105
           P+G+YKG    L  V    ++ + V E ++ 
Sbjct: 68  PKGYYKGLTANLFKVIPSTAVSWLVYEVIRE 98

 Score = 33.9 bits (76), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 4/85 (4%)

Query: 220 WKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANG---GIGA 276
           +KL + GA+SG     +VYP D+++   Q   +   + G    SV+  L   G   G   
Sbjct: 12  YKLAM-GAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKG 70

Query: 277 FFKGFGPTMLRAAPANGATFATFEL 301
           ++KG    + +  P+   ++  +E+
Sbjct: 71  YYKGLTANLFKVIPSTAVSWLVYEV 95

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 66/303 (21%), Positives = 113/303 (37%), Gaps = 48/303 (15%)

Query: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA-----------------MEVVRKLLA 71
           L    A  +A + V  P D +K  +Q+  +P+++                 ++ +  +  
Sbjct: 8   LTGAVASAMANIAV-YPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFK 66

Query: 72  NEGPRGFYKG-TLTPLIGVGACVSLQFGVNEAMKRFFHHR--------NADMSSTLSLPQ 122
            +G  G Y+G T+T +          F      K +  H+        N D   T S  +
Sbjct: 67  EKGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPSTIE 126

Query: 123 YYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN--------K 174
               GV    ++    SP+  V  R QT   S  +A+F   ++ I   R N        K
Sbjct: 127 ELVLGVAAASISQLFTSPMAVVATRQQT-VHSAESAKFTNVIKDI--YRENNGDITAFWK 183

Query: 175 ALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALW 234
            L  GL  TI        ++  + E    +  N     +   + A +  I G LS     
Sbjct: 184 GLRTGLALTI-NPSITYASFQRLKEVFFHDHSN-----DAGSLSAVQNFILGVLSKMIST 237

Query: 235 LMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGA 294
           L+  PL V K+++Q+   +   F  ++      LY N G+ + +KG  P + +     G 
Sbjct: 238 LVTQPLIVAKAMLQSAGSKFTTFQEAL----LYLYKNEGLKSLWKGVLPQLTKGVIVQGL 293

Query: 295 TFA 297
            FA
Sbjct: 294 LFA 296

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 71/172 (41%), Gaps = 19/172 (11%)

Query: 29  LLAGTAGGIAQVLVGQPF----DTTKVRLQTSST-----PTTAMEVVRKLLANEGPRGFY 79
           ++ G  GG+ Q  +   F     T ++  Q ++      P ++ +V + +   EG RG  
Sbjct: 106 IMGGITGGVTQAYLTMGFCTCMKTVEITRQKAANVPGVIPQSSWQVFKSIYKKEGIRGIN 165

Query: 80  KGT----LTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNS 135
           KG     +  +   G+   L   V + +++       D   T +L +  A  + GG+  S
Sbjct: 166 KGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLT-ALEKIMASAIGGGL--S 222

Query: 136 FLASPIEHVRIRLQTQT---GSGTNAEFKGPLECIKKLRHNKALLRGLTPTI 184
               PIE +R+ +Q++        N       + I +    K L RG+TP +
Sbjct: 223 AWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVTPRV 274

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 59/173 (34%), Gaps = 5/173 (2%)

Query: 18  PQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEV--VRKLLANEGP 75
           P +  +   K  LAG  G  A      P D  K R+Q      ++  V   RK++  EG 
Sbjct: 8   PNYSLSDYAKFALAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGA 67

Query: 76  RGFYKGTLTPLIGVGACVSLQFGVNEAMKR-FFHHRNADMSSTLSLPQYYACGVTGGIVN 134
                G    L+G     + +FG  E  K+ F      + +     P Y           
Sbjct: 68  AALLTGFGPTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFA 127

Query: 135 SFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILRE 187
                P+E  RIRL +Q          G    I K     +   G TP + ++
Sbjct: 128 DIALCPLEATRIRLVSQPTFANG--LVGGFARILKEEGIGSFYNGFTPILFKQ 178

 Score = 35.8 bits (81), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 77/204 (37%), Gaps = 27/204 (13%)

Query: 114 MSSTLSLPQY----YA----CGVTGGIVNSFLASPIEHVRIRLQTQ---TGSGTNAEFKG 162
           MS++  +P Y    YA     G  G         PI+ V+ R+Q +     SG    F+ 
Sbjct: 1   MSTSYQVPNYSLSDYAKFALAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFRK 60

Query: 163 PLECIKKLRHNKALLRGLTPTIL----REGHGCGTYFLVYEALIANQMNKRRGLERKDIP 218
               I       ALL G  PT+L    +     G Y +  +A +     +     R  I 
Sbjct: 61  ----IVGEEGAAALLTGFGPTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIY 116

Query: 219 AWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFF 278
                I    +  AL     PL+  +  +    + +P F N +      +    GIG+F+
Sbjct: 117 IGSAAIAEFFADIALC----PLEATRIRL----VSQPTFANGLVGGFARILKEEGIGSFY 168

Query: 279 KGFGPTMLRAAPANGATFATFELA 302
            GF P + +  P N A F  FE A
Sbjct: 169 NGFTPILFKQIPYNIAKFVVFEHA 192

 Score = 28.9 bits (63), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 2/67 (2%)

Query: 41  LVGQPFDT--TKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFG 98
           ++ QP DT  +KV     +   +   ++ +L    G  G + G  T L+ VG   SLQFG
Sbjct: 228 VISQPADTLLSKVNKTKKAPGQSTFGLLMQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFG 287

Query: 99  VNEAMKR 105
           +   +K+
Sbjct: 288 IYGKLKQ 294

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 35.4 bits (80), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 79/201 (39%), Gaps = 29/201 (14%)

Query: 126 CGVTGGIVNSFLASPIEHVRIRLQTQTGS----GTNAEFKGPLECIKK---LRH-NKALL 177
           CG     + +   +P+E ++ +LQ+   S    G+   ++     IK    +R   + + 
Sbjct: 172 CGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQTMF 231

Query: 178 RGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAW----KLCIFGALSGTAL 233
           +GL  T+ R+      Y+  YE               K+   W       + G +SG+  
Sbjct: 232 KGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGGFISGSLA 291

Query: 234 WLMVYPLDVIKSVMQTDNLQKPKFGNS-------------ISSVAKTLYANGGIGAFFKG 280
            +  +P DV K+  Q   +   K  NS             ++ + KT     GIGA + G
Sbjct: 292 AICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKT----EGIGALYTG 347

Query: 281 FGPTMLRAAPANGATFATFEL 301
             P + + AP+     +++EL
Sbjct: 348 LAPRVAKIAPSCAIMISSYEL 368

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 22/36 (61%)

Query: 116 STLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQ 151
           +TL++ +       G ++ S + +P++ VRIRLQ Q
Sbjct: 7   ATLTIQERMMSATVGSLLTSVILTPMDVVRIRLQQQ 42

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 48/242 (19%), Positives = 89/242 (36%), Gaps = 12/242 (4%)

Query: 62  AMEVVRKLLANEGPRGFYKGTLTPLI-GVGACVSLQFGVNEAMKRFFHHRNADM-SSTLS 119
           A++ ++++   EG  G Y+G  +  + G     S  F      K +F  + A    +  S
Sbjct: 75  ALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQARGGDARFS 134

Query: 120 LPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRG 179
            P+    G+     +    +PI  V  R QT+  +   A+ +     +      +    G
Sbjct: 135 TPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGAADMRTVAREVHAENGWRGFWAG 194

Query: 180 LTPTILREGHGC---GTYFLVYEALIANQMNKRRGLERKDI--PAWKLCIFGALSGTALW 234
           L  +++   +      TY  + EAL          ++   +  P     + G LS     
Sbjct: 195 LKVSLVLTVNPSITYATYERLREALFPTPAAASHLVDSAALLSPGQNF-VMGVLSKIVST 253

Query: 235 LMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGA 294
           ++  PL + K+ +Q        F      V   LY+  G  + +KG GP + +     G 
Sbjct: 254 VLTQPLIIAKASLQRSGSCFQDF----HQVLHHLYSTEGPLSLWKGLGPQITKGVLVQGL 309

Query: 295 TF 296
            F
Sbjct: 310 LF 311

>Kwal_23.5757
          Length = 307

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 75/193 (38%), Gaps = 14/193 (7%)

Query: 115 SSTLSLPQYYACGVTGGIV----NSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKL 170
           S TL  P+YYA    GG+V         +P++ V+ R Q    S   +   G  + ++  
Sbjct: 10  SPTLYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVD-ASLYKSNLDGWRQIVRSE 68

Query: 171 RHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSG 230
              K +  G+  T +         +  YE    +Q ++    E     +++  IF A S 
Sbjct: 69  GATK-VFTGVGATAIGYSLQGAFKYGGYE-FFKHQYSQLVSPETAH--SYRTGIFLAASA 124

Query: 231 TALWL---MVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLR 287
           +A ++    + P + IK   QT     P F  ++      +    G  + +KG  P   R
Sbjct: 125 SAEFIADIFLCPWEAIKVRQQTA--VPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFR 182

Query: 288 AAPANGATFATFE 300
             P     F +FE
Sbjct: 183 QIPYTMCKFTSFE 195

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 71/173 (41%), Gaps = 23/173 (13%)

Query: 45  PFDTTKVRLQTSSTPTTAMEVV---RKLLANEGPRGFYKGTLTPL----IGVGACVSLQF 97
           P++  KVR QT+  P  A  V     K++  EG    YKG +TPL    I    C   +F
Sbjct: 136 PWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKG-ITPLWFRQIPYTMC---KF 191

Query: 98  GVNEAMKRFFHHR----NADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTG 153
              E +    + R      +MS    +   +A G   GI+ + ++ P + +  ++  +  
Sbjct: 192 TSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNERK 251

Query: 154 SGTNAEFKGPLECIKKLRHN---KALLRGLTPTILREGHGCGTYFLVYEALIA 203
           SG +      L+   ++        L  GL   IL  G      +L+Y++  A
Sbjct: 252 SGEST-----LQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKA 299

>Kwal_55.21338
          Length = 323

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 63/292 (21%), Positives = 111/292 (38%), Gaps = 30/292 (10%)

Query: 15  EEHPQHDNARVVKD---------LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM-- 63
           + HP+   + V  D          LAG AGG   + +  P      +LQT       +  
Sbjct: 3   QRHPKSTGSMVAIDPSQADAFAHALAGGAGGAISMTLTYPLIVVTTKLQTQDAKGEKLSL 62

Query: 64  -EVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQ 122
            + ++ +   +G  GF+ G  + L G      + +   EA  R      A  +  L+  +
Sbjct: 63  ADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYYCYEASSRCVLR--ARHTQRLTTAE 120

Query: 123 YYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRG 179
               G   G +N+  A+P+     R+  Q         +G L  I  +  ++    L +G
Sbjct: 121 SMLVGSIAGSLNATAANPLWVANTRMTVQKSD------RGTLSTIFDIVKDEGISGLFKG 174

Query: 180 LTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYP 239
           L P ++   +    Y  VYE L    ++ R+   R   P+W   I GA+   A     YP
Sbjct: 175 LNPALILVINPIIQY-TVYEQLKNWILSSRQ--TRTLSPSWAF-ILGAVGKLAATGSTYP 230

Query: 240 LDVIKSVMQTDNLQKPKFG---NSISSVAKTLYANGGIGAFFKGFGPTMLRA 288
              +K+ M      K        S+ S+   +    GI   ++G G  ++++
Sbjct: 231 YVTMKARMHLLGEHKSSTAAPPRSLLSLMAEIIKKDGILGLYRGIGIKLVQS 282

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 29/65 (44%), Gaps = 2/65 (3%)

Query: 236 MVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGAT 295
           + YPL V+ + +QT + +  K   S++   K +Y   G   FF G    +     +N   
Sbjct: 39  LTYPLIVVTTKLQTQDAKGEKL--SLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVY 96

Query: 296 FATFE 300
           +  +E
Sbjct: 97  YYCYE 101

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 61/142 (42%), Gaps = 8/142 (5%)

Query: 150 TQTGSGTNAEFKGPLECIKKLRHNKA---LLRGLTPTILREGHGCGTYFLVYEALIAN-- 204
           T T       +K  L+ I K+  N+    L  GL+ ++L       +YF  Y  +  +  
Sbjct: 77  TATKESLEQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYF 136

Query: 205 QMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSV 264
           ++ K +G E       +  +   L+     L   P++++ +  QT   +  +  NS  ++
Sbjct: 137 RVKKVKG-EAARFSTIEELLLSMLAAATSQLFTNPINIVSTKQQTR--RGLEGDNSFKAI 193

Query: 265 AKTLYANGGIGAFFKGFGPTML 286
           AK +Y   GI  F+K    +++
Sbjct: 194 AKEVYDEDGITGFWKSLKVSLV 215

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 2/68 (2%)

Query: 27  KDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAM-EVVRKLLANEGPRGFYKGTLTP 85
           ++ L G    I    +  P    K  LQ SS+  T+  EV+  L  +EG    +KG L P
Sbjct: 255 QNFLIGVLSKIISTCLTHPLIVAKASLQRSSSKFTSFQEVLTYLYRHEGAHALWKG-LLP 313

Query: 86  LIGVGACV 93
            +  G  V
Sbjct: 314 QLTKGVIV 321

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 32.0 bits (71), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 60/263 (22%), Positives = 102/263 (38%), Gaps = 41/263 (15%)

Query: 45  PFDTTKVRLQT-----SSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGV 99
           P  T   +LQT     ++   + +E ++++   +G  GFY G  + + G+     + +  
Sbjct: 33  PLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYYYF 92

Query: 100 NEAMKRFF-----HHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGS 154
            E   R       H +   + S L+       G   G V +  ++PI     R+ T T S
Sbjct: 93  YELTSRNVLKVRKHKKLNTLESMLT-------GCVAGSVTAIASNPIWVANTRM-TVTKS 144

Query: 155 GTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEAL--IANQMNKRRGL 212
              A     +E +KK    K L  GL P ++   +    Y  V+E L  +    NK+  L
Sbjct: 145 EKTA-LATIIEIVKK-DSAKTLFNGLKPALVLVMNPIVQY-TVFEQLKNLVLAWNKQGIL 201

Query: 213 ERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQ---------TDNLQKPK----FGN 259
                P+W   + GAL   A     YP   +K+ M           D+ +K K       
Sbjct: 202 S----PSWAF-LLGALGKLAATGSTYPYITLKTRMHLSESGKHTDDDSGKKAKGHKASSK 256

Query: 260 SISSVAKTLYANGGIGAFFKGFG 282
           S+ S+   +    G+   ++G G
Sbjct: 257 SMLSLITEIVKKDGVSGLYRGVG 279

>Kwal_55.21106
          Length = 328

 Score = 32.0 bits (71), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 27/37 (72%), Gaps = 1/37 (2%)

Query: 223 CIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGN 259
            I GA++ +   ++VYPLD++K+++QT N ++P  G+
Sbjct: 7   AITGAVASSLANVVVYPLDLVKTLIQTQN-KEPNIGS 42

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 55/252 (21%), Positives = 94/252 (37%), Gaps = 29/252 (11%)

Query: 45  PFDTTKVRLQTS-------STPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQF 97
           P  T   R+Q S       +   + +E VR++   EG  GFY G  + + G+ A      
Sbjct: 36  PLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAA------ 89

Query: 98  GVNEAMKRFFHHRNADM------SSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQ 151
             N     +F+   A        S  L+  +        G + +  ++PI  V  R+   
Sbjct: 90  --NSLNYYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRM--T 145

Query: 152 TGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRG 211
                 +     L+ ++K     AL  GL P ++   +    Y  V+E L  N + K  G
Sbjct: 146 VAKSEQSTLAVLLDIVRK-DGVTALFNGLRPALMLVSNPIIQY-TVFEQL-KNVVLKWSG 202

Query: 212 LERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQ-TDNLQKPKFGNSISSVAKTLYA 270
            +   +P+W   + GA+   A     YP   +K+ M      +      S+ S+   +  
Sbjct: 203 SDVL-LPSWAF-LLGAVGKLAATGSTYPYITLKTRMHLAKGKEDADTQQSMWSLMVDIVK 260

Query: 271 NGGIGAFFKGFG 282
             GI   + G G
Sbjct: 261 KEGIQGLYHGIG 272

>CAGL0M04367g 479260..481074 similar to sp|P20485 Saccharomyces
           cerevisiae YLR133w CKI1 Choline kinase or sp|Q03764
           Saccharomyces cerevisiae YDR147w EKI1, hypothetical
           start
          Length = 604

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 8/58 (13%)

Query: 104 KRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFK 161
           + +F    A+M  +L +P++YA G+        + SP++   +RL    G+ TNA FK
Sbjct: 141 QDYFKKDVANMIQSLKVPRWYARGL--------VESPLKMESLRLTKIAGAMTNAIFK 190

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 55/151 (36%), Gaps = 18/151 (11%)

Query: 45  PFDTTKVRLQT---SSTPTTAMEVVRKLLA---NEGPRGFYKGTLTPLIGVGACVSLQFG 98
           P    K R+Q       P     + R+L+A   + G RG Y+G    L+  G   ++Q  
Sbjct: 137 PLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLA 196

Query: 99  VNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNA 158
           V    K        D      +  Y        +      +P +    R+    G     
Sbjct: 197 VYSHAKEALSRHVPD-----GMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRG----G 247

Query: 159 EFKGPLECI-KKLRHN--KALLRGLTPTILR 186
            ++GPL+C+ K +R     AL +G    +LR
Sbjct: 248 LYRGPLDCLCKTVRQEGFSALYKGHLAQLLR 278

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 8/60 (13%)

Query: 226 GALSGTALWLMVYPLDVIKSVMQT--------DNLQKPKFGNSISSVAKTLYANGGIGAF 277
           GA++ +     VYPLD+ K+++QT        D+ ++ K+ N I  + K     G +G +
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLY 69

>AFR669W [3862] [Homologous to ScYNL271C (BNI1) - SH]
           complement(1661761..1667517) [5757 bp, 1918 aa]
          Length = 1918

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 158 AEFKGPLECIKKLRHNKALLRGLT-PTILREGHGCGTYFLVYEALIANQMNKRRGLERKD 216
           AE++ P E IK+L+   AL+  +T  +I  E    G    +Y+A+  +++ +R  LE ++
Sbjct: 632 AEYRDPAESIKQLKLLDALVTNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRE 691

Query: 217 I 217
           +
Sbjct: 692 L 692

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 25/41 (60%)

Query: 111 NADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQ 151
           + + S++L+L +       G ++ S + +P++ VRIRLQ Q
Sbjct: 3   DRNTSNSLTLKERMLSAGAGSVLTSLILTPMDVVRIRLQQQ 43

>CAGL0G02563g complement(235498..237393) weakly similar to sp|P36026
           Saccharomyces cerevisiae YKR098c UBP11 ubiquitin
           C-terminal hydrolase, hypothetical start
          Length = 631

 Score = 29.6 bits (65), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 4/68 (5%)

Query: 223 CIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFG 282
           C+FG+     L+L     ++ K+   +++L      N +S + K +Y NGG     K F 
Sbjct: 230 CLFGSTQFRDLFL-TDKFEMFKAETNSESLS---IANDLSLLFKKMYQNGGCAIIPKSFM 285

Query: 283 PTMLRAAP 290
            T  R  P
Sbjct: 286 ETCKRLRP 293

>YIL156W (UBP7) [2521] chr9 (48091..51306) Putative
           ubiquitin-specific protease (ubiquitin C-terminal
           hydrolase) [3216 bp, 1071 aa]
          Length = 1071

 Score = 29.3 bits (64), Expect = 4.3,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 26/59 (44%)

Query: 223 CIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGF 281
           C+F A +   L++       ++ +    +   PK  NS+S +   +Y NGG      GF
Sbjct: 626 CLFAAKTFRTLFISSKYKSYLQPIRSNGSHYSPKLSNSLSMLFNKMYLNGGCSVVPTGF 684

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,584,376
Number of extensions: 382058
Number of successful extensions: 2138
Number of sequences better than 10.0: 207
Number of HSP's gapped: 1302
Number of HSP's successfully gapped: 467
Length of query: 302
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 201
Effective length of database: 13,099,691
Effective search space: 2633037891
Effective search space used: 2633037891
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)