Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPR057W (BRR1)34133616810.0
Scas_667.213593465622e-69
CAGL0D01628g3603474272e-49
Sklu_1926.33553533364e-36
Kwal_27.125963493393145e-33
ADL325C3223343021e-31
KLLA0B08525g3261751702e-13
KLLA0E08635g52227672.3
KLLA0E09328g21257625.8
KLLA0D19877g99083637.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR057W
         (336 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR057W (BRR1) [5487] chr16 (672466..673491) Protein involved in...   652   0.0  
Scas_667.21                                                           221   2e-69
CAGL0D01628g complement(170546..171628) weakly similar to tr|Q99...   169   2e-49
Sklu_1926.3 YPR057W, Contig c1926 1476-2543 reverse complement        134   4e-36
Kwal_27.12596                                                         125   5e-33
ADL325C [1416] [Homologous to ScYPR057W (BRR1) - SH] (126156..12...   120   1e-31
KLLA0B08525g complement(754935..755915) weakly similar to sgd|S0...    70   2e-13
KLLA0E08635g complement(773082..774650) similar to sp|P53966 Sac...    30   2.3  
KLLA0E09328g complement(831306..831944) highly similar to sgd|S0...    28   5.8  
KLLA0D19877g complement(1680043..1683015) similar to sp|P35688 S...    29   7.8  

>YPR057W (BRR1) [5487] chr16 (672466..673491) Protein involved in
           snRNP biogenesis [1026 bp, 341 aa]
          Length = 341

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/336 (94%), Positives = 318/336 (94%)

Query: 1   MKRGESQAPDAIFGQSRAFALSDSSVNPDVIEYLKSVRQEALRTNAISIKNHMNLQKRTR 60
           MKRGESQAPDAIFGQSRAFALSDSSVNPDVIEYLKSVRQEALRTNAISIKNHMNLQKRTR
Sbjct: 1   MKRGESQAPDAIFGQSRAFALSDSSVNPDVIEYLKSVRQEALRTNAISIKNHMNLQKRTR 60

Query: 61  HKSSMYDDEDEGALKRHAISPSLIRLQRNVEIWVRWFNSVKATVLTNAYEFTGYXXXXXX 120
           HKSSMYDDEDEGALKRHAISPSLIRLQRNVEIWVRWFNSVKATVLTNAYEFTGY      
Sbjct: 61  HKSSMYDDEDEGALKRHAISPSLIRLQRNVEIWVRWFNSVKATVLTNAYEFTGYEDETLD 120

Query: 121 XXXXXXXXXXXXMPSKCTTVEKIISVLNQHSFPEKAEEKEENLQIDEEWAKNILVRLEKT 180
                       MPSKCTTVEKIISVLNQHSFPEKAEEKEENLQIDEEWAKNILVRLEKT
Sbjct: 121 LLLLFLKNYLEDMPSKCTTVEKIISVLNQHSFPEKAEEKEENLQIDEEWAKNILVRLEKT 180

Query: 181 KIDSVEDVKKVITEGDKHELVGYNQWFQYLINNEPQHTTFHEKITSKQLWVLIKYMSNTW 240
           KIDSVEDVKKVITEGDKHELVGYNQWFQYLINNEPQHTTFHEKITSKQLWVLIKYMSNTW
Sbjct: 181 KIDSVEDVKKVITEGDKHELVGYNQWFQYLINNEPQHTTFHEKITSKQLWVLIKYMSNTW 240

Query: 241 IKEIHKKGRHYRRLQDWLFYILVHTPERVTAEYTSILRDLGKKCLELIQKKPVEAHENKI 300
           IKEIHKKGRHYRRLQDWLFYILVHTPERVTAEYTSILRDLGKKCLELIQKKPVEAHENKI
Sbjct: 241 IKEIHKKGRHYRRLQDWLFYILVHTPERVTAEYTSILRDLGKKCLELIQKKPVEAHENKI 300

Query: 301 TLPKEMAELNVEIPAAVENMTITELTVSVIAVNYGQ 336
           TLPKEMAELNVEIPAAVENMTITELTVSVIAVNYGQ
Sbjct: 301 TLPKEMAELNVEIPAAVENMTITELTVSVIAVNYGQ 336

>Scas_667.21
          Length = 359

 Score =  221 bits (562), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 126/346 (36%), Positives = 193/346 (55%), Gaps = 23/346 (6%)

Query: 5   ESQAPDAIFGQSRAFALSDSSVNPDVIEYLKSVRQEALRTNAISIKNHMNLQKRTRH--K 62
           E QA + +FGQ+ AFA+ +S V+P V+ YL+ VR+EALRT  +SIK     QKR R    
Sbjct: 12  ERQAVNPLFGQAPAFAVQNSLVDPAVVRYLQDVRKEALRTTVVSIKP----QKRARPVVT 67

Query: 63  SSMYDDEDE----------GALKRHAISPSLIRLQRNVEIWVRWFNSVKATVLTNAYEFT 112
           +SMYDD+D+          G    +     LI   RN+  W++WF   K  V   AYEFT
Sbjct: 68  ASMYDDDDDELPTLTARKKGRNSAYEFPDQLIYFDRNMNDWIKWFECTKNIVQEKAYEFT 127

Query: 113 GYXXXXXXXXXXXXXXXXXXMPSKCTTVEKIISVLNQHSFPEKAEEKEENLQIDEEWAKN 172
           GY                         +  +I +++     E  +  + +L+IDE WA+ 
Sbjct: 128 GYDDNTLNILLCQLKQYMETKSKDEDKLSSLIGIISDECI-ETTDSSDHSLEIDETWAET 186

Query: 173 ILVRLEKTKIDSVEDVKKVITEGDKHELVGYNQWFQYLINNEPQHTTFHEKITSKQLWVL 232
           +  +L+   I ++ ++K  + E    E  G+  W++YLI+N P HT F   I  + +W+L
Sbjct: 187 MCEKLQSRAIKNISEIKDCVLET-PMEPYGFKAWYKYLISNVPVHTCFVTMINDRNVWIL 245

Query: 233 IKYMSNTWIKEIHKKGRHYRRLQDWLFYILVHTPERVTAEYTSILRDLGKKCLELIQKKP 292
           I+Y     ++EI+K+G++   L++WL  I++H P  +TAEYTS LRDLGKKC  LI K+ 
Sbjct: 246 IQYFQQGLLEEIYKRGKNASVLEEWLLEIMIHLPVNITAEYTSTLRDLGKKCQVLI-KRQ 304

Query: 293 VEAHENK--ITLPKEMAELNVEIPAAVENMTITELTVSVIAVNYGQ 336
           +E+   K  + LPKE+ EL+++ P   +N++I EL +S+IA  YGQ
Sbjct: 305 IESSSAKTLLRLPKELEELDIKAPQ--QNVSIFELVLSIIAKIYGQ 348

>CAGL0D01628g complement(170546..171628) weakly similar to tr|Q99177
           Saccharomyces cerevisiae YPR057w BRR1 involved in snRNP
           biogenesis, hypothetical start
          Length = 360

 Score =  169 bits (427), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 106/347 (30%), Positives = 169/347 (48%), Gaps = 17/347 (4%)

Query: 2   KRGESQAPDAIFGQSRAFALSDSSVNPDVIEYLKSVRQEALRTNAISIKNHMNLQKRTRH 61
           K   S A D +FGQ++AF ++D  VNP V  YL  VR EAL TNAIS  + +    +   
Sbjct: 13  KEALSSAIDPVFGQAKAFNINDPEVNPLVKSYLSEVRNEALHTNAIS--HQIGQVSKNTF 70

Query: 62  KSSMYDDEDEGAL---KRHAISPSLIRLQRNVEIWVRWFNSVKATVLTNAYEFTGYXXXX 118
            +++YDDED+           S  +     ++E W +WF ++   +    Y F GY    
Sbjct: 71  DANIYDDEDDSTSIPSDTKVKSDQITEYLYSIENWYKWFENISDIIWHGCYVFEGYDDES 130

Query: 119 XXXXXXXXXXXXXXM--PSKCTTVEK-IISVLNQHSFPEKAEEKEENLQIDEEWAKNILV 175
                             ++ ++ ++ ++++          +     L+IDE+WA+N+L 
Sbjct: 131 ISHLTQLLRFYLQKKIDENRASSFDRHLVNIFRDQLKCSDPDPVNGTLEIDEDWAENLLK 190

Query: 176 RLEKTKIDSVEDVKKVITEGDKHELVGYNQWFQYLINNEPQHTTFHEKITSKQLWVLIKY 235
            +  +KI  +  VK  I    K    G   W +Y+ +N+P HT F   I S  LW L+ Y
Sbjct: 191 TMRNSKIKDLNTVKYCIRTDYKRAPHGLKPWAKYVTSNQPTHTAFINMIDSSNLWTLVMY 250

Query: 236 MSNTWIKEIHKKGRHYRR---LQDWLFYILVHTPERVTAEYTSILRDLGKKCLELIQKKP 292
           M+  W+KEI+  G++  R   L  WL YIL+H P R+TAE  S +R L K+  E++ ++ 
Sbjct: 251 MTQIWLKEIYTFGKNLERKKMLSQWLLYILLHIPTRLTAEQMSNIRSLAKQAREILNRR- 309

Query: 293 VEAH---ENKITLPKEMAELNVEIPAAVENMTITELTVSVIAVNYGQ 336
           V ++      I +P E+ E N   P    N+ I  L ++V+   YGQ
Sbjct: 310 VNSNIFGTTNIVIPDELHEHNC--PPCPPNLDIASLILAVVTRKYGQ 354

>Sklu_1926.3 YPR057W, Contig c1926 1476-2543 reverse complement
          Length = 355

 Score =  134 bits (336), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 108/353 (30%), Positives = 171/353 (48%), Gaps = 33/353 (9%)

Query: 3   RGESQAPDAIFGQSRAFALSDSSVNPDVIEYLKSVRQEALRTNAISIKNHMNLQKRTRHK 62
           R E+Q+ D +FGQSRAFAL+ + VNPD + YL SVR+EALRT+ I +   +++ K+TR +
Sbjct: 11  RIETQSTDPVFGQSRAFALNGTLVNPDAVSYLNSVRKEALRTSGIDVTRSVDV-KKTRAQ 69

Query: 63  SSMYDDEDEGALKRHAISPSLIRLQRNVEIWVRWFNSVKATVL-----------TNAYEF 111
           S   D   E  +    ++  LI+  R     ++WF  ++  ++            NA EF
Sbjct: 70  SHNTDFCGEEPI----LNRELIKCNRKSNQLLQWFLELREHLVEQRLEDSREQQENAQEF 125

Query: 112 TGYXXXXXXXXXXXXXXXXXXMPSK-CTTVEKIISVLNQHSFPEKAEEKEENLQIDEEWA 170
           +GY                    +K  T VE ++ +L    FP   E  +++L IDE WA
Sbjct: 126 SGYDIETLNLLVHYFKNYLRGRDNKDDTVVELLLEILK--DFPSIKE--DQSLAIDEAWA 181

Query: 171 KNILVRLEKTKIDSVEDVKKVITEGDKHEL---VGYNQWFQYLINNEPQHTTFHEKITSK 227
           + +L +L    +++VE++K+ I +  K  +        W  ++  NEP    F  ++T  
Sbjct: 182 EKLLDQLRSKTVNNVEELKEAINKPAKASVEFPKNAKGWHSHINKNEPSSKVF-TRLTLD 240

Query: 228 QLWVLIKYMSNTWIKEIHKKGRHYRRLQDWLFYILVHTPERVTAEYTSILRDLGKKCLEL 287
           Q   LI YM+  W+        + R++  W  Y L+  PE + A + SILR+LGKK  +L
Sbjct: 241 QKLKLIGYMTQ-WLNHTVGDQSNARQISQWCLYTLLSIPEYLPAPHISILRELGKKAKQL 299

Query: 288 IQKKPVEAHENKITLP----KEMAELNVEIPAAVENMTITELTVSVIAVNYGQ 336
              K     EN   LP     EM           +  +IT+L + V++  YGQ
Sbjct: 300 ---KLRSCQENIALLPLTVSSEMIGKYTTDSTVPQESSITDLVLVVVSKIYGQ 349

>Kwal_27.12596
          Length = 349

 Score =  125 bits (314), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 96/339 (28%), Positives = 164/339 (48%), Gaps = 26/339 (7%)

Query: 5   ESQAPDAIFGQSRAFALSDSSVNPDVIEYLKSVRQEALRTNAISIKNHMNLQKRTRHKSS 64
           E+Q  D +FGQ RAFAL    VNP+V +YLK+VR +AL T A    N      +    S 
Sbjct: 19  ETQNIDPVFGQGRAFALEGDLVNPEVQQYLKTVRTQALTTLAARPSNRGRHDTKVNRTSD 78

Query: 65  MYDDEDEGALKRHAISPSLIRLQRNVEIWVRWFNSVKATVLTNAYEFTGYXXXXXXXXXX 124
           +YD+E         I P L R  R    W++WFN +K +   +     GY          
Sbjct: 79  LYDEE-------PLIPPELSRFNRYKSSWLKWFNELKRSKDAHTAPAPGYDSAMLNLLVF 131

Query: 125 XXXXXXXXMPSKCT----TVEKIISVLNQHSFPEKAEEKEENLQIDEEWAKNILVRL--E 178
                   + +  +     +++I+++L  H+     E+++  L+IDEEWAK IL +L   
Sbjct: 132 YFKQYLQELKAAASESDADLDRILTILQDHN----VEKQDSTLEIDEEWAKGILQQLKSS 187

Query: 179 KTKIDSVEDVKKVITEGDKHELVGYNQWFQYLINNEPQHTTFHEKITSKQLWVLIKYMSN 238
           K+++ SV D+K  I++        +N W+  +   EP    F E+++ +  + L  Y+ N
Sbjct: 188 KSQVSSVSDLKDFISKPAPLP-KNFNGWYYCVTKTEPTCALF-ERMSPELTFKLASYL-N 244

Query: 239 TWIKEIHKKGRHYRRLQDWLFYILVHTPERVTAEYTSILRDLGKKCLELIQKKPVEAHE- 297
            W+ ++  K +   R+  W+ Y  +   +++ A+  S+LRDLGKK  ++       A   
Sbjct: 245 QWLGDVS-KDKKASRITAWILYTFLFLGDQLPAQEVSVLRDLGKKARQMKLNCSDSADAL 303

Query: 298 NKITLPKEMAELNVEIPAAVENMTITELTVSVIAVNYGQ 336
            KI  P +M+    + P   + ++  +L + ++A  YGQ
Sbjct: 304 PKIVQPSDMS-FYKDPP---QPLSAIDLILVLVAFKYGQ 338

>ADL325C [1416] [Homologous to ScYPR057W (BRR1) - SH]
           (126156..127124) [969 bp, 322 aa]
          Length = 322

 Score =  120 bits (302), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 97/334 (29%), Positives = 162/334 (48%), Gaps = 20/334 (5%)

Query: 4   GESQAP-DAIFGQSRAFALSDSSVNPDVIEYLKSVRQEALRTNAISIKNHMNLQKRTRHK 62
           G +  P D +FGQ + F  S + VNP+V++YL  VR EAL T  + + +  NL+KR    
Sbjct: 2   GHTSGPVDPVFGQCQVFDCSAAEVNPEVVKYLAHVRDEALHTVGV-VPSASNLRKRKIEI 60

Query: 63  SSMYDDEDEGALKRHAISPSLIRLQRNVEIWVRWFNSVKATVLTNAYEFTGYXXXXXXXX 122
           S  YDDE+   +KR +     I L  +++  + WF+ VK   L+    F GY        
Sbjct: 61  S--YDDEE--VVKRPSEGEKAIELPFDMDEVISWFDQVKEDALSEREAFEGYDEETLNTL 116

Query: 123 XXXXXXXXXXMPSKCTTVEKIISVLNQHSFPEKAEEKEENLQIDEEWAKNILVRLEKTKI 182
                     M S+  +   +I +L       +     E L++DE+WA  ++ RL + K 
Sbjct: 117 LVGIRDYISRMSSRDESTNNLIKLLEG----VQPVVTNEALELDEKWAAKLVARLGRRKF 172

Query: 183 DSVEDVKKVITEGDKHELVGYNQWFQYLINNEPQHTTFHEKITSKQLWVLIKYMSNTWIK 242
            +++++K  +             W  ++  NEP H  FH ++ S QL+ L++Y+++  ++
Sbjct: 173 TTLDNLKLRLNTQLPIPTRA-KAWKIHIPINEPSHEFFH-RMNSTQLFDLLRYLTDNIVE 230

Query: 243 EIHKKGRHYRRLQDWLFYILVHTPERVTAEYTSILRDLGKKCLELIQKKPVEAHENKITL 302
             H +         WL Y+L+H P ++TA   S +R L KK   LI     E  +  + L
Sbjct: 231 --HYQTDSATDYGQWLVYLLLHLPRQLTANEISEVRGLSKKVRALIIDH--EILKLPMLL 286

Query: 303 PKEMAELNVEIPAAVENMTITELTVSVIAVNYGQ 336
           P E+ +++  IP  V  +    L ++V+AV YGQ
Sbjct: 287 PSEIEDVS-PIPRGVNPL---HLALAVVAVIYGQ 316

>KLLA0B08525g complement(754935..755915) weakly similar to
           sgd|S0006261 Saccharomyces cerevisiae YPR057w BRR1
           involved in snRNP biogenesis, start by similarity
          Length = 326

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 84/175 (48%), Gaps = 12/175 (6%)

Query: 165 IDEEWAKNILVRLEKTKIDSVEDVKKVITEGDKHELVGYNQWFQYLINNEPQHTTFHEKI 224
           I  E  ++++ +L   +   V  +K+ I          + QWF ++ +NEP    F  ++
Sbjct: 154 ISTETVQSMVAKLRNKRFSDVSFLKRYINRPMPIP-TNFRQWFGHIKHNEPTRQ-FMLRL 211

Query: 225 TSKQLWVLIKYMSNTWIKEIHKKGRHYRRLQDWLFYILVHTPERVTAEYTSILRDLGKKC 284
               L  ++ +M   WI  I K     ++LQ WL YI +  P  + +   S LRDLG+KC
Sbjct: 212 EFDDLMKILGFMIQ-WINSITKNKPDSKQLQQWLLYIWIFMPNELLSPQISQLRDLGRKC 270

Query: 285 LELIQKKPVEAHENKI---TLPKEMAELNVEIPAAVENMTITELTVSVIAVNYGQ 336
               Q   + A  +KI   T+P E+ +  +  P   + +   E+T++VIA  +GQ
Sbjct: 271 ----QLSLIAASNSKITSLTMPTEIRD--IPFPNQRDQLNAIEITLAVIAHRFGQ 319

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 6  SQAP-DAIFGQSRAFALSDSSVNPDVIEYLKSVRQEALRTNAI 47
          +Q P D +FGQ  AFAL+D  V+P+VI YL  VR EAL  + +
Sbjct: 7  NQGPLDPVFGQHSAFALNDEGVSPNVIRYLLDVRNEALSNSPL 49

>KLLA0E08635g complement(773082..774650) similar to sp|P53966
           Saccharomyces cerevisiae YNL029c KTR5 putative
           mannosyltransferase, hypothetical start
          Length = 522

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 3/27 (11%)

Query: 203 YNQWFQY---LINNEPQHTTFHEKITS 226
           +NQWFQY    +NNEP    F E++ S
Sbjct: 99  FNQWFQYPYVFMNNEPFTDEFQERVRS 125

>KLLA0E09328g complement(831306..831944) highly similar to
           sgd|S0005547 Saccharomyces cerevisiae YOR021c, start by
           similarity
          Length = 212

 Score = 28.5 bits (62), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 7/57 (12%)

Query: 260 YILVHT----PERVTAEYTSILRDLGKKCLELIQKKPVEAHENKITLPKEMAELNVE 312
           YI+ H      E VT EY  I+RD+GK  L ++   P +  E+ I  PK++ E+ ++
Sbjct: 3   YIIEHMEQGFSEWVTLEYAQIIRDIGKDNL-ILSSLPEDTVESDI--PKKLREMGLQ 56

>KLLA0D19877g complement(1680043..1683015) similar to sp|P35688
           Saccharomyces cerevisiae YDL240w LRG1 GTPase-activating
           protein of the rho/rac family singleton, hypothetical
           start
          Length = 990

 Score = 28.9 bits (63), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 6/83 (7%)

Query: 156 AEEKEENLQIDEEWAKNILVRLEKTKIDSVEDVKKVITEGDKHELV-GYNQWFQYLINNE 214
           A EK+  +Q D+   K      E TK  +++D+ +++      EL+ G N+ F    +N 
Sbjct: 594 AGEKDLVIQTDQRNIKKQSTIFEGTKSLTLDDISRIVATEKSRELIPGTNKDFTASGDNV 653

Query: 215 P-----QHTTFHEKITSKQLWVL 232
           P         ++ ++TS+Q ++L
Sbjct: 654 PTKKATNSNIYYSELTSEQYYIL 676

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.130    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,441,298
Number of extensions: 429220
Number of successful extensions: 1815
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1840
Number of HSP's successfully gapped: 24
Length of query: 336
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 234
Effective length of database: 13,065,073
Effective search space: 3057227082
Effective search space used: 3057227082
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)