Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPR056W (TFB4)33833317720.0
Scas_667.2033833314070.0
Kwal_27.1259033833513210.0
Sklu_1926.434533712931e-180
CAGL0D01650g33531812311e-171
ADL323C34132912301e-171
KLLA0B08569g33734210951e-150
ADL267W457119760.19
Scas_680.1354950663.1
CAGL0J01045g76556663.5
Scas_609.642837654.0
CAGL0G02101g36458636.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR056W
         (333 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR056W (TFB4) [5486] chr16 (671121..672137) RNA polymerase II t...   687   0.0  
Scas_667.20                                                           546   0.0  
Kwal_27.12590                                                         513   0.0  
Sklu_1926.4 YPR056W, Contig c1926 2998-4035 reverse complement        502   e-180
CAGL0D01650g complement(172035..173042) highly similar to tr|Q12...   478   e-171
ADL323C [1418] [Homologous to ScYPR056W (TFB4) - SH] (127631..12...   478   e-171
KLLA0B08569g complement(756558..757571) similar to sgd|S0006260 ...   426   e-150
ADL267W [1474] [Homologous to ScYOR198C (BFR1) - SH] complement(...    34   0.19 
Scas_680.13                                                            30   3.1  
CAGL0J01045g 101282..103579 highly similar to sp|P20448 Saccharo...    30   3.5  
Scas_609.6                                                             30   4.0  
CAGL0G02101g 184862..185956 highly similar to sp|P36156 Saccharo...    29   6.0  

>YPR056W (TFB4) [5486] chr16 (671121..672137) RNA polymerase II
           transcription initiation factor TFIIH (factor b), 37 kDa
           subunit [1017 bp, 338 aa]
          Length = 338

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/333 (100%), Positives = 333/333 (100%)

Query: 1   MDAISDPTFKHARSRKQVTEESPSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVF 60
           MDAISDPTFKHARSRKQVTEESPSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVF
Sbjct: 1   MDAISDPTFKHARSRKQVTEESPSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVF 60

Query: 61  LNAHLAFNSANKVAVIAAYSQGIKYLYPESTSALKASESENKTRSDLKIINSDMYRRFRN 120
           LNAHLAFNSANKVAVIAAYSQGIKYLYPESTSALKASESENKTRSDLKIINSDMYRRFRN
Sbjct: 61  LNAHLAFNSANKVAVIAAYSQGIKYLYPESTSALKASESENKTRSDLKIINSDMYRRFRN 120

Query: 121 VDETLVEEIYKLFELEKKQIEQNSQRSTLAGAMSAGLTYVNRISKESVTTSLKSRLLVLT 180
           VDETLVEEIYKLFELEKKQIEQNSQRSTLAGAMSAGLTYVNRISKESVTTSLKSRLLVLT
Sbjct: 121 VDETLVEEIYKLFELEKKQIEQNSQRSTLAGAMSAGLTYVNRISKESVTTSLKSRLLVLT 180

Query: 181 CGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLHVES 240
           CGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLHVES
Sbjct: 181 CGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLHVES 240

Query: 241 TEGLIQYLATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSVCLCVLSIIP 300
           TEGLIQYLATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSVCLCVLSIIP
Sbjct: 241 TEGLIQYLATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSVCLCVLSIIP 300

Query: 301 PGNKCPACDSQFDEHVIAKLKRKPVVPRLKAKK 333
           PGNKCPACDSQFDEHVIAKLKRKPVVPRLKAKK
Sbjct: 301 PGNKCPACDSQFDEHVIAKLKRKPVVPRLKAKK 333

>Scas_667.20
          Length = 338

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/333 (77%), Positives = 295/333 (88%), Gaps = 4/333 (1%)

Query: 1   MDAISDPTFKHARSRKQVTEESPSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVF 60
           MDAI+DPTF+H + R  +TEE+PSLLTVI++I PKLW   DEE NEKG++I VL++L+VF
Sbjct: 1   MDAIADPTFQHTKVRSSITEETPSLLTVIVDITPKLWAELDEEINEKGNLINVLKSLLVF 60

Query: 61  LNAHLAFNSANKVAVIAAYSQGIKYLYPESTSALKASESENKTRSDLKIINSDMYRRFRN 120
           LNAHLAFNS+N+VAVIAA+SQGIKYL+P+++ ++K     N  + DL IIN DMYRRFRN
Sbjct: 61  LNAHLAFNSSNQVAVIAAHSQGIKYLFPKNSISVKGV---NSGKKDLSIINKDMYRRFRN 117

Query: 121 VDETLVEEIYKLFELEKKQIEQNSQRSTLAGAMSAGLTYVNRISKESVTTSLKSRLLVLT 180
           VDETLV+E+Y LFE E KQ+   +Q+STL+GAMSAGLTY+NR++KE    SLKSRL+VLT
Sbjct: 118 VDETLVDELYALFEEELKQVNTVTQKSTLSGAMSAGLTYINRVTKELEAISLKSRLMVLT 177

Query: 181 CGS-GSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLHVE 239
           CG  G SKDEIFQYIPIMNCIFSATK+KCPIDVVKIGGSKESTFLQQTTDATNG YLHVE
Sbjct: 178 CGGKGESKDEIFQYIPIMNCIFSATKIKCPIDVVKIGGSKESTFLQQTTDATNGAYLHVE 237

Query: 240 STEGLIQYLATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSVCLCVLSII 299
           ST+GLIQYLATAMFIDPSLR IIVKPNHGSVDFRTSCYLTG+VVAVGFICSVCLCVLSII
Sbjct: 238 STKGLIQYLATAMFIDPSLRQIIVKPNHGSVDFRTSCYLTGKVVAVGFICSVCLCVLSII 297

Query: 300 PPGNKCPACDSQFDEHVIAKLKRKPVVPRLKAK 332
           PPGNKCPACDS+FDEHVIAKLK+KPVVPR+  K
Sbjct: 298 PPGNKCPACDSEFDEHVIAKLKKKPVVPRVAKK 330

>Kwal_27.12590
          Length = 338

 Score =  513 bits (1321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/335 (72%), Positives = 286/335 (85%), Gaps = 6/335 (1%)

Query: 1   MDAISDPTFKHARSRKQVTEESPSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVF 60
           MDAISDP+F++ +S+  V EE PSLLTVI++  PK+W   D+EG+++GS+I  L++LIVF
Sbjct: 1   MDAISDPSFQNTKSKIAVAEELPSLLTVIVDTMPKVWAELDKEGSQEGSLISALQSLIVF 60

Query: 61  LNAHLAFNSANKVAVIAAYSQGIKYLYPESTSALKASESENKTRS-DLKIINSDMYRRFR 119
           LNAHL+FNSAN+VAVIAA+S GIKYL+P   S    S+ E   +S DL IINS+MYR+FR
Sbjct: 61  LNAHLSFNSANQVAVIAAHSTGIKYLFPTPPS----SQEEPAAKSPDLSIINSNMYRQFR 116

Query: 120 NVDETLVEEIYKLFELEKK-QIEQNSQRSTLAGAMSAGLTYVNRISKESVTTSLKSRLLV 178
           NVDET++EE+YKL + EKK +I    Q+STL+GAMSAG TY+NR+ KE  T SLK+RL+V
Sbjct: 117 NVDETVLEELYKLLQDEKKRKIPSGFQKSTLSGAMSAGFTYINRVIKEQSTASLKARLMV 176

Query: 179 LTCGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLHV 238
           +TCGS   KDEIFQYIPIMNCIFSATK+KCPIDVVKIGGS+ESTFLQQ TDATNGVYLHV
Sbjct: 177 MTCGSSGGKDEIFQYIPIMNCIFSATKLKCPIDVVKIGGSQESTFLQQATDATNGVYLHV 236

Query: 239 ESTEGLIQYLATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSVCLCVLSI 298
            STEGLIQYL TAMFIDPSLRPI+VKPN GSVDFRTSCYLTG+VVAVGF+CSVCLCVLSI
Sbjct: 237 PSTEGLIQYLTTAMFIDPSLRPIVVKPNQGSVDFRTSCYLTGKVVAVGFVCSVCLCVLSI 296

Query: 299 IPPGNKCPACDSQFDEHVIAKLKRKPVVPRLKAKK 333
           IPPGNKCPACDS+FDEHV  KLKR+PVVP + AKK
Sbjct: 297 IPPGNKCPACDSEFDEHVTTKLKRRPVVPGIAAKK 331

>Sklu_1926.4 YPR056W, Contig c1926 2998-4035 reverse complement
          Length = 345

 Score =  502 bits (1293), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 238/337 (70%), Positives = 282/337 (83%), Gaps = 10/337 (2%)

Query: 1   MDAISDPTFKHARSRKQVTEESPSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVF 60
           MDAISD TF++ +S+  +TEE+PSLLTV+++  PKLW   D+E N KG++I  L++LIVF
Sbjct: 1   MDAISDSTFQNTKSKTSITEENPSLLTVVVDTTPKLWAELDKESNSKGNLISALQSLIVF 60

Query: 61  LNAHLAFNSANKVAVIAAYSQGIKYLYP-----ESTSALKASESENKTRSDLKIINSDMY 115
           LNAHLAFN++N+VAVIAA+S G+KYLYP     E T A  +S      R DL IIN+DMY
Sbjct: 61  LNAHLAFNNSNQVAVIAAHSTGLKYLYPKTATTEGTGASSSSVVSG--RKDLSIINNDMY 118

Query: 116 RRFRNVDETLVEEIYKLFELEKKQIEQNSQ---RSTLAGAMSAGLTYVNRISKESVTTSL 172
           R+FRNVDET+VEE+YKLF+ EK++    S    RSTL+GA+SAGLTY+NR++KE+   +L
Sbjct: 119 RQFRNVDETVVEELYKLFQQEKEENNSTSNGVGRSTLSGAISAGLTYINRVNKENENITL 178

Query: 173 KSRLLVLTCGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATN 232
           KSRLLV TCGS   +DEIFQYIPIMNCIF+ATKMKCPIDVVKIGG +ESTFLQQ TDATN
Sbjct: 179 KSRLLVTTCGSSGGRDEIFQYIPIMNCIFTATKMKCPIDVVKIGGVQESTFLQQATDATN 238

Query: 233 GVYLHVESTEGLIQYLATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSVC 292
           GVYLHV+STEGLIQYL TAMFIDPSLR +IVKPN GSVDFRTSC+LTGRVVAVGF+CSVC
Sbjct: 239 GVYLHVDSTEGLIQYLCTAMFIDPSLRHVIVKPNQGSVDFRTSCFLTGRVVAVGFVCSVC 298

Query: 293 LCVLSIIPPGNKCPACDSQFDEHVIAKLKRKPVVPRL 329
           LCVLSIIPPGNKCPACD++FDE VI KLKRKPVVP +
Sbjct: 299 LCVLSIIPPGNKCPACDAEFDERVITKLKRKPVVPGM 335

>CAGL0D01650g complement(172035..173042) highly similar to tr|Q12004
           Saccharomyces cerevisiae YPR056w TFB4, start by
           similarity
          Length = 335

 Score =  478 bits (1231), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 222/318 (69%), Positives = 266/318 (83%), Gaps = 3/318 (0%)

Query: 1   MDAISDPTFKHARSRKQVTEESPSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVF 60
           MDAI+DP F+  + R   TE+ PSLLTV+++I+P+LW  FD    EK S+  VL++LIVF
Sbjct: 1   MDAIADPNFQQTKLRSTATEDIPSLLTVVLDISPRLWAEFDHRSGEKQSVTTVLKSLIVF 60

Query: 61  LNAHLAFNSANKVAVIAAYSQGIKYLYPESTSALKASESENKTRSDLKIINSDMYRRFRN 120
           LN+HLAFNSAN+VAVIAA+SQGI+YLYP S+     SE       DL II+S MYRRFRN
Sbjct: 61  LNSHLAFNSANQVAVIAAFSQGIQYLYPRSS---DTSEQNAGNSKDLSIISSHMYRRFRN 117

Query: 121 VDETLVEEIYKLFELEKKQIEQNSQRSTLAGAMSAGLTYVNRISKESVTTSLKSRLLVLT 180
           VDETL+EE YKL++ E+  I++  Q+STL+GAM+A LTY NR++KE  + SL+SRLLV+T
Sbjct: 118 VDETLIEEFYKLYQREESLIDKPVQKSTLSGAMAAALTYTNRLTKEFESISLRSRLLVIT 177

Query: 181 CGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLHVES 240
           CGS   KDEIFQYIPIMNCIFSATK+KCPIDV+KIGG+K+STFLQQTTDATNGVY+H+ES
Sbjct: 178 CGSSREKDEIFQYIPIMNCIFSATKLKCPIDVIKIGGNKQSTFLQQTTDATNGVYIHLES 237

Query: 241 TEGLIQYLATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSVCLCVLSIIP 300
           T G+IQYL+TAM IDPSLR IIV+P  GSVDFRTSCYLTG+VVA+G+ICSVCLCVLSIIP
Sbjct: 238 TNGIIQYLSTAMSIDPSLRQIIVRPTQGSVDFRTSCYLTGKVVAIGYICSVCLCVLSIIP 297

Query: 301 PGNKCPACDSQFDEHVIA 318
           PGNKCPACDSQFDE VIA
Sbjct: 298 PGNKCPACDSQFDERVIA 315

>ADL323C [1418] [Homologous to ScYPR056W (TFB4) - SH]
           (127631..128656) [1026 bp, 341 aa]
          Length = 341

 Score =  478 bits (1230), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 224/329 (68%), Positives = 274/329 (83%), Gaps = 5/329 (1%)

Query: 1   MDAISDPTFKHARSRKQVTEESPSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVF 60
           MDAI+D TF+  +S+ Q+ EE+PSLLT++I+  PKLW  FD E  +KG +++VL++ IVF
Sbjct: 1   MDAIADSTFQINKSKVQLVEETPSLLTLVIDTNPKLWAEFDREVGKKGQLMQVLKSTIVF 60

Query: 61  LNAHLAFNSANKVAVIAAYSQGIKYLYPESTSALKASESENKTRSDLKIINSDMYRRFRN 120
           LNAHL+FN++N+V+VIAA S+GIKYLYP++    K   ++ K   D  IIN +MYR FRN
Sbjct: 61  LNAHLSFNNSNQVSVIAACSRGIKYLYPQADD--KEGSTKKKKSEDRSIINRNMYRGFRN 118

Query: 121 VDETLVEEIYKLFELEKKQIEQNSQ---RSTLAGAMSAGLTYVNRISKESVTTSLKSRLL 177
           VDE +VEE+Y++F+ E KQ+E       RSTL+GAMSAGLTY+NRI+ E+   SLKSRLL
Sbjct: 119 VDEAVVEELYRVFQQESKQLEDGVPQPFRSTLSGAMSAGLTYINRITHETEGVSLKSRLL 178

Query: 178 VLTCGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLH 237
           V+TCGS +SKDE+FQYIPIMNCIFSATKMKCPIDVVK+GG KESTFLQQ TDATNG YLH
Sbjct: 179 VITCGSSASKDEVFQYIPIMNCIFSATKMKCPIDVVKVGGVKESTFLQQATDATNGNYLH 238

Query: 238 VESTEGLIQYLATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSVCLCVLS 297
           V +T+GLIQYL+TAMFIDPSLR  +VKPN  SVDFRTSCYLTG+VVA+GF+CSVCLCVLS
Sbjct: 239 VANTDGLIQYLSTAMFIDPSLRQWVVKPNQSSVDFRTSCYLTGKVVAIGFVCSVCLCVLS 298

Query: 298 IIPPGNKCPACDSQFDEHVIAKLKRKPVV 326
           IIPPGNKCPACDS+FDE V+AKL RKPV+
Sbjct: 299 IIPPGNKCPACDSEFDEKVVAKLSRKPVI 327

>KLLA0B08569g complement(756558..757571) similar to sgd|S0006260
           Saccharomyces cerevisiae YPR056w TFB4 component of RNA
           polymerase transcription initiation TFIIH factor, start
           by similarity
          Length = 337

 Score =  426 bits (1095), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 206/342 (60%), Positives = 263/342 (76%), Gaps = 20/342 (5%)

Query: 1   MDAISDPTFKHARSRKQVTEESPSLLTVIIEIAPKLWTTFDEEGNEKG--------SIIK 52
           MDAI+D  F+  +S+ Q  E++PSLLTV+++ +   W    ++ +  G         +I+
Sbjct: 1   MDAIADTVFQGTKSKTQEIEDTPSLLTVVVDTSIHSWVQLTKQQSGSGSEGSSGEKQLIE 60

Query: 53  VLEALIVFLNAHLAFNSANKVAVIAAYSQGIKYLYPESTSALKASESENKTRSDLKIINS 112
            L++++VFLNAHLAFNS N+V +IAA+S+G+KYLYP + S           +  + +++S
Sbjct: 61  ALKSIVVFLNAHLAFNSGNQVCLIAAHSEGMKYLYPSADS-----------KPSMSMVSS 109

Query: 113 DMYRRFRNVDETLVEEIYKLFELE-KKQIEQNSQRSTLAGAMSAGLTYVNRISKESVTTS 171
           DMYR FRNVDE +VE+ Y+LF+ E + Q  + S +S+L+GAMS+ LTYVNRI KE+  TS
Sbjct: 110 DMYRGFRNVDEIVVEQWYRLFKEELEGQESKVSMKSSLSGAMSSALTYVNRILKENENTS 169

Query: 172 LKSRLLVLTCGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDAT 231
           L+SRLLV+TCG+   KDEIFQYIPIMNCIFSATKMKC IDVVKIGG  ESTFLQQ TDAT
Sbjct: 170 LRSRLLVITCGTSQGKDEIFQYIPIMNCIFSATKMKCSIDVVKIGGGIESTFLQQATDAT 229

Query: 232 NGVYLHVESTEGLIQYLATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSV 291
           +GVYLHVE+T GLIQYL+TAMFIDPSLR +I+KPN GSVDFRTSC+LTG+VVAVGF+CSV
Sbjct: 230 SGVYLHVENTRGLIQYLSTAMFIDPSLRNVIIKPNQGSVDFRTSCFLTGKVVAVGFVCSV 289

Query: 292 CLCVLSIIPPGNKCPACDSQFDEHVIAKLKRKPVVPRLKAKK 333
           CLCVLS+IPPG KCPACDS FD  +IA+L+RKPV+     KK
Sbjct: 290 CLCVLSVIPPGQKCPACDSPFDSKIIARLRRKPVLSNGVPKK 331

>ADL267W [1474] [Homologous to ScYOR198C (BFR1) - SH]
           complement(234113..235486) [1374 bp, 457 aa]
          Length = 457

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 49/119 (41%), Gaps = 13/119 (10%)

Query: 164 SKESVTTSLKSRLLVLTCGSGSSKDEIFQYIPIM----NCIFSATKMKCPIDVVKIGGSK 219
           SK  V    +SRL        S +DEIF  I  +    +  F A K K   D +K    +
Sbjct: 197 SKNQVVYDQRSRLFTKRSALYSKRDEIFAQIKKIRGDFDNEFKAYKKKLDDDRIKREEEE 256

Query: 220 ESTFLQQTTDATNG------VYLHVESTEGLIQYLATAMFIDPSLRPIIVKPNHGSVDF 272
             + + +  +   G      ++ H  +    I  + TA+F   SL P  VKP   ++DF
Sbjct: 257 RISRVLEDKEEKMGKLQEKLIHAHKPAFAYEISAIETALF---SLDPTFVKPATNTIDF 312

>Scas_680.13
          Length = 549

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 238 VESTEGLIQYL-ATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVG 286
           V  ++G ++Y+ A A  IDP  + I ++ NHG +  +TS      VVAVG
Sbjct: 159 VRRSQGEVKYVEAEATDIDPITKEIKIEENHGEI--KTSLKYDYLVVAVG 206

>CAGL0J01045g 101282..103579 highly similar to sp|P20448
           Saccharomyces cerevisiae YJL033w HCA4, start by
           similarity
          Length = 765

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 146 RSTLAGAMSAGLTYVNRISKESVTTSLKSRLLVLTCGSGSSKDEIFQYIPIMNCIF 201
           +STL G   A    +  I ++S+ TSL+   +  T  +GS K   F  +P++  ++
Sbjct: 50  KSTLKGLNEASFIKMTDIQRDSIVTSLQGHDVFGTAKTGSGKTLAF-LVPVLEKLY 104

>Scas_609.6
          Length = 428

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 3/37 (8%)

Query: 229 DATNGVYLHVESTEGLIQYLATAMFIDPSLRPIIVKP 265
           D   G+Y H     G  Q   +++ IDPS  PI++KP
Sbjct: 132 DEVFGIYFHPHLAVGAAQ---SSLLIDPSSDPILLKP 165

>CAGL0G02101g 184862..185956 highly similar to sp|P36156
           Saccharomyces cerevisiae YKR076w ECM4, start by
           similarity
          Length = 364

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 31/58 (53%)

Query: 101 NKTRSDLKIINSDMYRRFRNVDETLVEEIYKLFELEKKQIEQNSQRSTLAGAMSAGLT 158
           N++   ++I+NSD + +FR+ D  + + + K  E E  ++ + +  +   G   AG +
Sbjct: 168 NESSEIIRILNSDAFDQFRDSDAEVPDLVPKELEAEIDEVNKWTYDNINNGVYKAGFS 225

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,078,743
Number of extensions: 407520
Number of successful extensions: 1450
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1461
Number of HSP's successfully gapped: 26
Length of query: 333
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 231
Effective length of database: 13,065,073
Effective search space: 3018031863
Effective search space used: 3018031863
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)