Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPR019W (CDC54)93391743410.0
Scas_707.4492987536990.0
CAGL0K02431g92486434840.0
Kwal_14.217590985532710.0
ADL026W88886531830.0
KLLA0C17512g89287731720.0
KLLA0E23276g8265718911e-106
Kwal_56.232827617238731e-104
Scas_590.67677768731e-104
ADR041W8135368731e-103
CAGL0F04939g7727348601e-102
AGR276W7347088441e-100
Scas_721.368555298481e-99
CAGL0M05423g8125418424e-99
Kwal_27.120028335258427e-99
CAGL0J06424g9725848462e-98
KLLA0D09262g7467048314e-98
KLLA0F10087g10035928449e-98
Scas_712.4910195808413e-97
YBR202W (CDC47)8455608217e-96
Kwal_47.1896610445778311e-95
YLR274W (CDC46)7757368123e-95
Sklu_2098.48465808164e-95
AFR546W10055798229e-95
Scas_710.218746757941e-91
CAGL0J04444g8796737824e-90
KLLA0F12584g8776657782e-89
YBL023C (MCM2)8686787772e-89
Sklu_1863.19545927795e-89
AFR178W8856647721e-88
Kwal_14.20908606647666e-88
KLLA0E22330g9315877583e-86
Kwal_27.101749456497504e-85
Sklu_2087.48846687458e-85
YGL201C (MCM6)10173597412e-83
CAGL0L01397g9456517074e-79
YEL032W (MCM3)9715886847e-76
Scas_499.29855856803e-75
AFR355C9435856624e-73
KLLA0E14278g473111820.11
Scas_626.13463161712.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR019W
         (917 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR019W (CDC54) [5453] chr16 (596745..599546) Protein involved i...  1676   0.0  
Scas_707.44                                                          1429   0.0  
CAGL0K02431g complement(219027..221801) highly similar to sp|P30...  1346   0.0  
Kwal_14.2175                                                         1264   0.0  
ADL026W [1716] [Homologous to ScYPR019W (CDC54) - SH] complement...  1230   0.0  
KLLA0C17512g complement(1537707..1540385) similar to sp|P30665 S...  1226   0.0  
KLLA0E23276g complement(2065845..2068325) similar to sp|P38132 S...   347   e-106
Kwal_56.23282                                                         340   e-104
Scas_590.6                                                            340   e-104
ADR041W [1782] [Homologous to ScYBR202W (CDC47) - SH] complement...   340   e-103
CAGL0F04939g 503890..506208 highly similar to sp|P29496 Saccharo...   335   e-102
AGR276W [4587] [Homologous to ScYLR274W (CDC46) - SH] complement...   329   e-100
Scas_721.36                                                           331   1e-99
CAGL0M05423g 577097..579535 highly similar to sp|P38132 Saccharo...   328   4e-99
Kwal_27.12002                                                         328   7e-99
CAGL0J06424g complement(611935..614853) highly similar to sp|P53...   330   2e-98
KLLA0D09262g 780273..782513 similar to sp|P29496 Saccharomyces c...   324   4e-98
KLLA0F10087g complement(935618..938629) similar to sp|P53091 Sac...   329   9e-98
Scas_712.49                                                           328   3e-97
YBR202W (CDC47) [385] chr2 (625729..628266) Member of MCM/P1 fam...   320   7e-96
Kwal_47.18966                                                         324   1e-95
YLR274W (CDC46) [3667] chr12 (691557..693884) Member of the MCM/...   317   3e-95
Sklu_2098.4 YBR202W, Contig c2098 6426-8966 reverse complement        318   4e-95
AFR546W [3738] [Homologous to ScYGL201C (MCM6) - SH] complement(...   321   9e-95
Scas_710.21                                                           310   1e-91
CAGL0J04444g 417656..420295 highly similar to sp|P29469 Saccharo...   305   4e-90
KLLA0F12584g complement(1165710..1168343) similar to sp|P29469 S...   304   2e-89
YBL023C (MCM2) [172] chr2 complement(174885..177491) Member of t...   303   2e-89
Sklu_1863.1 YEL032W, Contig c1863 2885-5749                           304   5e-89
AFR178W [3370] [Homologous to ScYBL023C (MCM2) - SH] complement(...   301   1e-88
Kwal_14.2090                                                          299   6e-88
KLLA0E22330g 1981275..1984070 similar to sp|P24279 Saccharomyces...   296   3e-86
Kwal_27.10174                                                         293   4e-85
Sklu_2087.4 YBL023C, Contig c2087 7202-9856                           291   8e-85
YGL201C (MCM6) [1794] chr7 complement(117856..120909) Protein in...   290   2e-83
CAGL0L01397g 152718..155555 highly similar to sp|P24279 Saccharo...   276   4e-79
YEL032W (MCM3) [1393] chr5 (86937..89852) Member of the MCM/P1 f...   268   7e-76
Scas_499.2                                                            266   3e-75
AFR355C [3547] [Homologous to ScYEL032W (MCM3) - SH] (1082128..1...   259   4e-73
KLLA0E14278g complement(1260247..1261668) similar to sp|P43635 S...    36   0.11 
Scas_626.13                                                            32   2.6  

>YPR019W (CDC54) [5453] chr16 (596745..599546) Protein involved in
           DNA synthesis initiation, member of the MCM family of
           DNA-dependent ATPases required for initiation of DNA
           replication [2802 bp, 933 aa]
          Length = 933

 Score = 1676 bits (4341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 831/917 (90%), Positives = 831/917 (90%)

Query: 1   MSQQSSSPTKEXXXXXXXXXXXXXXXXXQLXXXXXXXXXXXXQGDIYGRNNSQNLSQGEG 60
           MSQQSSSPTKE                 QL            QGDIYGRNNSQNLSQGEG
Sbjct: 1   MSQQSSSPTKEDNNSSSPVVPNPDSVPPQLSSPALFYSSSSSQGDIYGRNNSQNLSQGEG 60

Query: 61  NIRAAIGSSPLNFPSSSQRQNSDVFXXXXXXXXXXXXXXXXXXXXYHSDLRSDRALPTSS 120
           NIRAAIGSSPLNFPSSSQRQNSDVF                    YHSDLRSDRALPTSS
Sbjct: 61  NIRAAIGSSPLNFPSSSQRQNSDVFQSQGRQGRIRSSASASGRSRYHSDLRSDRALPTSS 120

Query: 121 SSLGRNGQNRVHMRRNDIHTSDLSSPRRIVDFDTRSGVNTLDTXXXXXXXXXXXXXLRII 180
           SSLGRNGQNRVHMRRNDIHTSDLSSPRRIVDFDTRSGVNTLDT             LRII
Sbjct: 121 SSLGRNGQNRVHMRRNDIHTSDLSSPRRIVDFDTRSGVNTLDTSSSSAPPSEASEPLRII 180

Query: 181 WGTNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSN 240
           WGTNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSN
Sbjct: 181 WGTNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSN 240

Query: 241 LNLDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETKF 300
           LNLDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETKF
Sbjct: 241 LNLDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETKF 300

Query: 301 YKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEI 360
           YKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEI
Sbjct: 301 YKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEI 360

Query: 361 DRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVY 420
           DRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVY
Sbjct: 361 DRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVY 420

Query: 421 DELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYXXXXXXXXXXXXRLDVDTST 480
           DELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTY            RLDVDTST
Sbjct: 421 DELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYVDVVHVKKVSDKRLDVDTST 480

Query: 481 IEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGI 540
           IEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGI
Sbjct: 481 IEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGI 540

Query: 541 LLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVG 600
           LLQL            RYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVG
Sbjct: 541 LLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVG 600

Query: 601 LTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAG 660
           LTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAG
Sbjct: 601 LTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAG 660

Query: 661 IITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDREL 720
           IITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDREL
Sbjct: 661 IITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDREL 720

Query: 721 AKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKM 780
           AKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKM
Sbjct: 721 AKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKM 780

Query: 781 GDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDP 840
           GDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDP
Sbjct: 781 GDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDP 840

Query: 841 KTGKIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMSFNELIKQINEHSQDRVES 900
           KTGKIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMSFNELIKQINEHSQDRVES
Sbjct: 841 KTGKIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMSFNELIKQINEHSQDRVES 900

Query: 901 SDIQEALSRLQQEDKVI 917
           SDIQEALSRLQQEDKVI
Sbjct: 901 SDIQEALSRLQQEDKVI 917

>Scas_707.44
          Length = 929

 Score = 1429 bits (3699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 702/875 (80%), Positives = 763/875 (87%), Gaps = 6/875 (0%)

Query: 43  QGDIYGRNNSQNLSQGEGNIRAAIGSSPLNFPSSSQRQNSDVFXXXXXXXXXXXXXXXXX 102
           Q DI+GR+ SQ    G     AA GSSP+N+PSSSQ Q+SD+                  
Sbjct: 45  QSDIFGRHGSQ---AGTARNNAAFGSSPMNYPSSSQNQSSDLLNPQRRTRRPGGSSTNTP 101

Query: 103 XXXYHSDLRSDRALPTSSSSLGRNGQNRVHMRRNDIHTSDLSSPRRIVDFDTRSGVNTLD 162
                SD+RSDR +P+SSSS G + +N + MRRNDIH SDLSSPRRIVDFD+ SGV+T  
Sbjct: 102 GTTRFSDIRSDRNIPSSSSSFGSS-RNNIRMRRNDIHASDLSSPRRIVDFDSHSGVHT-- 158

Query: 163 TXXXXXXXXXXXXXLRIIWGTNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTDE 222
           +             LRIIWGTNVSIQEC T FRNFLMSFKYKFRK LDERE+FIN+TTDE
Sbjct: 159 SSSSAVPTSDANEPLRIIWGTNVSIQECATKFRNFLMSFKYKFRKTLDEREQFINSTTDE 218

Query: 223 ELYYIKQLNEMRELGTSNLNLDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVS 282
           ELYY++QLNEMRE+G  NLNLDARNLLA+KQTE+LY+QLLNYPQEVISIMDQTIKDCMVS
Sbjct: 219 ELYYVQQLNEMREVGNCNLNLDARNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVS 278

Query: 283 LIVDNNLDYDLDEIETKFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDM 342
           L+VDN+LD++LD+IETKFYKVRPYNVG+ KGMRELNPNDIDKLI+LKGLVLR+TPVIPDM
Sbjct: 279 LVVDNHLDFNLDDIETKFYKVRPYNVGTVKGMRELNPNDIDKLISLKGLVLRATPVIPDM 338

Query: 343 KVAFFKCNVCDHTMAVEIDRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQET 402
           KVAFFKCNVCDHTM VEIDRGVIQEPARCER+DC E NSMSLIHNRCSFADKQVIKLQET
Sbjct: 339 KVAFFKCNVCDHTMVVEIDRGVIQEPARCERVDCGEQNSMSLIHNRCSFADKQVIKLQET 398

Query: 403 PDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYXX 462
           PD VPDGQTPH++SLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQR+LKSLYKTY  
Sbjct: 399 PDLVPDGQTPHAVSLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRILKSLYKTYID 458

Query: 463 XXXXXXXXXXRLDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLL 522
                     RL VDTSTIEQELMQNK+DHNEVEEV++ITDQD+AKIR+VA REDLY +L
Sbjct: 459 VVHIKKVSDTRLGVDTSTIEQELMQNKLDHNEVEEVKKITDQDIAKIRDVANREDLYDVL 518

Query: 523 ARSIAPSIYELEDVKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVH 582
           +RSIAPSI+EL+DVKKGILLQL            RYRGDINILLCGDPSTSKSQILQYVH
Sbjct: 519 SRSIAPSIFELDDVKKGILLQLFGGANKVFKKGGRYRGDINILLCGDPSTSKSQILQYVH 578

Query: 583 KITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTR 642
           KI PRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGG+CCIDEFDKMSDSTR
Sbjct: 579 KIAPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGICCIDEFDKMSDSTR 638

Query: 643 SVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRF 702
           SVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRF
Sbjct: 639 SVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRF 698

Query: 703 DLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHPII 762
           DLVYLVLDKVDE  DRELAKHLT+LYL+DKPEH+S  D+LPVEFLTMYI+YAKEHIHP+I
Sbjct: 699 DLVYLVLDKVDESTDRELAKHLTSLYLQDKPEHVSNADILPVEFLTMYINYAKEHIHPVI 758

Query: 763 TEAAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDV 822
            E AK ELVRAYVGMRK+GDDSRSDEKRITATTRQLESMIRLAEAHAKM+L N V+LEDV
Sbjct: 759 LEEAKIELVRAYVGMRKLGDDSRSDEKRITATTRQLESMIRLAEAHAKMRLSNEVQLEDV 818

Query: 823 QEAVRLIRSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMS 882
           QEAVRL++SAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDL+RE++ VL +  SDSMS
Sbjct: 819 QEAVRLMKSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLTREVLRVLTNHTSDSMS 878

Query: 883 FNELIKQINEHSQDRVESSDIQEALSRLQQEDKVI 917
           FNELIKQINEHSQDRVESSDI + LSRLQQEDKVI
Sbjct: 879 FNELIKQINEHSQDRVESSDISDVLSRLQQEDKVI 913

>CAGL0K02431g complement(219027..221801) highly similar to sp|P30665
           Saccharomyces cerevisiae YPR019w Cell division control
           protein, start by similarity
          Length = 924

 Score = 1346 bits (3484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 654/864 (75%), Positives = 739/864 (85%), Gaps = 3/864 (0%)

Query: 56  SQGEGNIRAAIGSSPLNFPSSSQR-QNSDVFXXXXXXXXXXXXXXXXXXXXYHSDLRSDR 114
           SQ +G+ +    SSP++FPSSS R  +SDV                       SD  SDR
Sbjct: 46  SQPQGDSQPVAPSSPIHFPSSSNRPMSSDVHSQGRRSNRNHLAANRSSALGRFSDYGSDR 105

Query: 115 -ALPTSSSSLGRNGQNRVHMRRNDIHTSDLSSPRRIVDFDTRSGVNTLDTXXXXXXXXXX 173
             L +SSS++G     R ++RRNDIH SDLSSPRRIVDFD+RSG+    +          
Sbjct: 106 QVLHSSSSNMGGYPSQRTNLRRNDIHASDLSSPRRIVDFDSRSGIQQP-SSSSSSMPSEA 164

Query: 174 XXXLRIIWGTNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEM 233
              LRIIWGTNVSIQEC  +FRNFLMSFKYK+R++LD + +  ++  +EELYY+KQLNEM
Sbjct: 165 TEPLRIIWGTNVSIQECANSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLNEM 224

Query: 234 RELGTSNLNLDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDL 293
           RELGTSNLNLDARNLLA+KQTE+LY+QLLNYPQEVISIMDQTIKDCMVSL+VDN L+++L
Sbjct: 225 RELGTSNLNLDARNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVVDNQLEHEL 284

Query: 294 DEIETKFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCD 353
           DEIE+KFYKVRPYNV + KGMRELNPNDIDKLI+LKGLVLR+TPVIPDMKVAFFKCN+CD
Sbjct: 285 DEIESKFYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKCNICD 344

Query: 354 HTMAVEIDRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPH 413
           HTMAVEIDRGVIQEPARCER+DCNE NSM+LIHNRCSFADKQVIKLQETPD VPDGQTPH
Sbjct: 345 HTMAVEIDRGVIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPDGQTPH 404

Query: 414 SISLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYXXXXXXXXXXXXR 473
           S+SLCVYDELVDSCRAGDRIEVTGTFRSIPI+ANSRQRVLKSLYKTY            R
Sbjct: 405 SVSLCVYDELVDSCRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVKKVSNTR 464

Query: 474 LDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYEL 533
           + VD STIEQEL+QNK+D+N+VEEVRQI+D ++ KI++VA R DLY LLARSIAPSIYEL
Sbjct: 465 IGVDVSTIEQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSIAPSIYEL 524

Query: 534 EDVKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSG 593
           +DVKKGILLQL            RYRGDINILLCGDPSTSKSQILQYVHKI PRGVYTSG
Sbjct: 525 DDVKKGILLQLFGGTNKTFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSG 584

Query: 594 KGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQT 653
           KGSSAVGLTAY+TRDVD+KQLVLESGALVLSDGG+CCIDEFDKMS+STRSVLHEVMEQQT
Sbjct: 585 KGSSAVGLTAYVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSVLHEVMEQQT 644

Query: 654 ISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVD 713
           IS+AKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVY++LDKVD
Sbjct: 645 ISVAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYIILDKVD 704

Query: 714 EKNDRELAKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRA 773
           E  DR+LAKHLT+LYLEDKP H++ DDVLP++FLT YI+Y K+++HP++TE AK ELV+A
Sbjct: 705 ESTDRDLAKHLTSLYLEDKPAHVTTDDVLPIDFLTQYINYVKQNVHPLVTEQAKNELVKA 764

Query: 774 YVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAI 833
           YVGMRKMGDDSRSDEKRITATTRQLESMIRL+EAHAKM+L + V+LEDV+EAVRL++SAI
Sbjct: 765 YVGMRKMGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSSTVDLEDVREAVRLMKSAI 824

Query: 834 KDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMSFNELIKQINEH 893
           KDYATDPKTGKIDMNLVQTGKSVIQRKLQEDL+REI+ +LK+  +DSMSFNELIKQINE 
Sbjct: 825 KDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLAREIIRILKEYPADSMSFNELIKQINEQ 884

Query: 894 SQDRVESSDIQEALSRLQQEDKVI 917
           +QDRVE S +   LSRLQQEDKVI
Sbjct: 885 AQDRVEPSQVSSTLSRLQQEDKVI 908

>Kwal_14.2175
          Length = 909

 Score = 1264 bits (3271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/855 (72%), Positives = 708/855 (82%), Gaps = 17/855 (1%)

Query: 66  IGSSPLNFPSSSQRQ---NSDVFXXXXXXXXXXXXXXXXXXXXYHSDLRSDRALPTSSSS 122
           +GSSP  +PSSSQ      SD F                      +D  SD  + +SS S
Sbjct: 53  VGSSPFRYPSSSQDHPHVTSDTFASQSRTQRSSGPGR-------FTDFSSDGGILSSSLS 105

Query: 123 LGRNGQNRVHMRRNDIHTSDLSSPRRIVDFDTRSGVNTLDTXXXXXXXXXXXXXLRIIWG 182
               G      RR+D+H SDLSSPRR+VD D++   N+                LRIIWG
Sbjct: 106 --GRGSQHAAQRRSDLHASDLSSPRRMVDLDSQPPPNS-----SSDPVSEATEPLRIIWG 158

Query: 183 TNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSNLN 242
           TNVSIQEC TNFRNFLMSFKYKFRK LD  E+F+N T DEELYY+K+LN+MRE+G+ NLN
Sbjct: 159 TNVSIQECATNFRNFLMSFKYKFRKTLDGNEDFLNETDDEELYYVKRLNQMREMGSLNLN 218

Query: 243 LDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETKFYK 302
           LDARNLL++K TE LY+QL++YPQE+ISIMDQT+KDCMVSL+VDNNL+  LDEIE+KFYK
Sbjct: 219 LDARNLLSFKATEKLYYQLMSYPQEIISIMDQTVKDCMVSLVVDNNLESGLDEIESKFYK 278

Query: 303 VRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDR 362
           +RPYN+ + KGMRELNPNDIDKLI++KGLVLRSTP+IPDMKVAFFKCN+CDHT  VEIDR
Sbjct: 279 IRPYNIETQKGMRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDHTAVVEIDR 338

Query: 363 GVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDE 422
           GVIQEPARC R+ CN+ NSM+L+HNRCSFADKQVIKLQETPD VPDGQTPHS+SLCVYDE
Sbjct: 339 GVIQEPARCPRVACNQQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQTPHSVSLCVYDE 398

Query: 423 LVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYXXXXXXXXXXXXRLDVDTSTIE 482
           LVDSCRAGDRIE+TG FRSIPIRA++ QR LKSLYKTY            RL  DTST+E
Sbjct: 399 LVDSCRAGDRIEITGIFRSIPIRASTTQRALKSLYKTYLDVVHVKKVTNDRLGADTSTVE 458

Query: 483 QELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILL 542
           QEL+QN+++H++V+E+ QITD+ + K+  +AAR+D+Y +LARS+APSI+EL+D+KKGILL
Sbjct: 459 QELLQNEMNHSDVQEIPQITDEQIRKLHAIAARDDVYEVLARSVAPSIFELDDIKKGILL 518

Query: 543 QLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLT 602
           QL            RYRGDINILLCGDPSTSKSQILQYVHKI PRGVYTSGKGSSAVGLT
Sbjct: 519 QLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLT 578

Query: 603 AYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGII 662
           AYITRD+DTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGII
Sbjct: 579 AYITRDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGII 638

Query: 663 TTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAK 722
           TTLNAR+SILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDE  DRELAK
Sbjct: 639 TTLNARTSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDENTDRELAK 698

Query: 723 HLTNLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGD 782
           HLTNLYLED P + +  DVLPVE LT+YI+YAK+   P+I E AKTELVRAYV MRKMGD
Sbjct: 699 HLTNLYLEDAPTNETDGDVLPVELLTLYINYAKQQYAPVIIEQAKTELVRAYVTMRKMGD 758

Query: 783 DSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDPKT 842
           DSRSDEKRITATTRQLESMIRLAEAHAKM+L   VEL+DVQEAVRLI+SAIKDYATDPKT
Sbjct: 759 DSRSDEKRITATTRQLESMIRLAEAHAKMRLSQTVELQDVQEAVRLIKSAIKDYATDPKT 818

Query: 843 GKIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMSFNELIKQINEHSQDRVESSD 902
           GKIDMNLVQTGKSVIQRKLQEDL+RE++++L  +++ ++S+NEL++ INE SQD+VE++D
Sbjct: 819 GKIDMNLVQTGKSVIQRKLQEDLAREVVSILGARSNLTISYNELLRSINEQSQDKVEAAD 878

Query: 903 IQEALSRLQQEDKVI 917
           I EAL RLQQEDKV+
Sbjct: 879 ISEALVRLQQEDKVV 893

>ADL026W [1716] [Homologous to ScYPR019W (CDC54) - SH]
           complement(653657..656323) [2667 bp, 888 aa]
          Length = 888

 Score = 1230 bits (3183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/865 (69%), Positives = 706/865 (81%), Gaps = 27/865 (3%)

Query: 57  QGEGNIRAAIGSSPLNFPSSSQRQNSDVFXXXXXXXXXXXXXXXXXXXXYHSDLRSDRAL 116
           +G+ N    IGSSP ++PSSSQ Q +                            RS+R+ 
Sbjct: 31  RGQQNAGNMIGSSPFHYPSSSQSQQN-------------TRSNRGGAFSSQGVPRSERSY 77

Query: 117 PTSSSSLGRNGQNRV-HMRRNDIHTSDLSSPRRIVDFDTRSGVNTLDTXXXXXXXXXXXX 175
             + SSL    + R+ H  R+DIH SDLSSPRR+V+F++ S +++ D             
Sbjct: 78  --AGSSLPGTARTRLQHYGRSDIHASDLSSPRRMVNFNSPSTLSSSDPPSENDEP----- 130

Query: 176 XLRIIWGTNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRE 235
            +RIIWGTNVSIQE    F+NFLM+FKYK+RKI DE+E FIN TTDEELYY+ QL++MR+
Sbjct: 131 -MRIIWGTNVSIQEVACTFKNFLMTFKYKYRKIKDEQELFINETTDEELYYVNQLHQMRQ 189

Query: 236 LGTSNLNLDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVD---NNLDYD 292
           LGT NLNLD RNL+++  TE LYHQLLNYPQEVISIMDQ +KDCMV L VD      + +
Sbjct: 190 LGTCNLNLDVRNLISFPGTEKLYHQLLNYPQEVISIMDQAVKDCMVQLAVDIDGAEGNEN 249

Query: 293 LDEIETKFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVC 352
           L E+E+K YK+RPYN+ S +GMRELNPNDIDKL+++KGLVLRSTPVIPDMK+AFFKC+VC
Sbjct: 250 LIEVESKIYKIRPYNLDSERGMRELNPNDIDKLVSIKGLVLRSTPVIPDMKLAFFKCSVC 309

Query: 353 DHTMAVEIDRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTP 412
           DHT AVEIDRG+IQEP RC R+ CN+ NSMSLIHNRCSFADKQVIKLQETPD VPDGQTP
Sbjct: 310 DHTTAVEIDRGIIQEPLRCPRVACNQRNSMSLIHNRCSFADKQVIKLQETPDLVPDGQTP 369

Query: 413 HSISLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYXXXXXXXXXXXX 472
           HS+SLC+YDELVDSCRAGDRIEVTG FRSIPIRAN RQR LKSLYKTY            
Sbjct: 370 HSVSLCIYDELVDSCRAGDRIEVTGIFRSIPIRANQRQRALKSLYKTYLDVVHVRKVSAR 429

Query: 473 RLDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYE 532
           RLD+DTST+EQ+++QN++D+  VEE+R++TD+D+AKI  VAAR D+Y +LARSIAPSIYE
Sbjct: 430 RLDIDTSTVEQQILQNQMDN--VEELRKVTDEDIAKINAVAARPDVYEVLARSIAPSIYE 487

Query: 533 LEDVKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTS 592
           L+D+KKGILLQL            RYRGDINILLCGDPSTSKSQILQYVHKI PRGVYTS
Sbjct: 488 LDDIKKGILLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKIAPRGVYTS 547

Query: 593 GKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQ 652
           GKGSSAVGLTAYITRD DTKQ VLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVM+QQ
Sbjct: 548 GKGSSAVGLTAYITRDADTKQSVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMKQQ 607

Query: 653 TISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKV 712
            IS+AKAGIITTLNAR+SILASANPIGSRYN NLPVTENIDLPPPLLSRFDLVYLVLDKV
Sbjct: 608 PISVAKAGIITTLNARTSILASANPIGSRYNTNLPVTENIDLPPPLLSRFDLVYLVLDKV 667

Query: 713 DEKNDRELAKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVR 772
            E  DRELAKHLT+LYLEDKP H+S+ D+LPV FLTMYI+YAK+HIHP+ITE AKTELVR
Sbjct: 668 SESTDRELAKHLTSLYLEDKPAHVSESDILPVHFLTMYINYAKQHIHPVITEGAKTELVR 727

Query: 773 AYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSA 832
           AYV MR MGDDSR+DEKRITATTRQLESMIRL+EAHAK++L   VE+ DVQEAVRLI+SA
Sbjct: 728 AYVNMRSMGDDSRADEKRITATTRQLESMIRLSEAHAKVRLSQQVEVSDVQEAVRLIKSA 787

Query: 833 IKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMSFNELIKQINE 892
           IKDYA DPKTGKIDMNL+QTGKSVIQRKLQEDL+REI+ +L ++++D +++NEL + +NE
Sbjct: 788 IKDYAIDPKTGKIDMNLIQTGKSVIQRKLQEDLAREIVRLLTERSADVITYNELARLLNE 847

Query: 893 HSQDRVESSDIQEALSRLQQEDKVI 917
           +SQDR+++  I +AL+RLQQEDK++
Sbjct: 848 NSQDRLDNMTISDALNRLQQEDKIV 872

>KLLA0C17512g complement(1537707..1540385) similar to sp|P30665
           Saccharomyces cerevisiae YPR019w CDC54 member of the
           CDC46P/MCM2P/MCM3P family, start by similarity
          Length = 892

 Score = 1226 bits (3172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/877 (69%), Positives = 710/877 (80%), Gaps = 31/877 (3%)

Query: 47  YGRNNSQNLSQGEGNIRAAIGSSPLNFPSSSQRQNSDVFXXXXXXXXXXXXXXXXXXXXY 106
           +G  +SQ  SQ  G     +GSSP ++PSSS     +                       
Sbjct: 25  HGTQDSQ-ASQDRG-----VGSSPFHYPSSSSNATQETARAAPSS--------------- 63

Query: 107 HSDLRSDR------ALPTSSSSLGRNGQNRVHMRRNDIHTSDLSSPRRIVDFDTRSGVNT 160
            S LRS+          +S SS  R G++    RR +I+ SDLSSPRRIV F+  S  + 
Sbjct: 64  -SGLRSNNLRSDLLNYSSSLSSSAREGRHS-RSRRGEINASDLSSPRRIVTFNNLSSSDN 121

Query: 161 LDTXXXXXXXXXXXXXLRIIWGTNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTT 220
             +             L+IIWGTNVSIQEC  +FR FLMSFK K+RK LD++E FIN TT
Sbjct: 122 GFSSSSRPASEAADQPLKIIWGTNVSIQECGNSFREFLMSFKLKYRKELDDQEIFINETT 181

Query: 221 DEELYYIKQLNEMRELGTSNLNLDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCM 280
           D+ELYY+ QLN+MR+LGTSNLNLD RNLLAYK TE L+HQ+L YPQE+I+IMDQT+KDCM
Sbjct: 182 DQELYYVNQLNQMRQLGTSNLNLDIRNLLAYKHTEKLFHQILYYPQEIIAIMDQTVKDCM 241

Query: 281 VSLIVDNNLDYDLDEIETKFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIP 340
           VSL +DN L+  L+EIE+K +KVRPYNV + KGMRELNPNDIDKL+++KGLVLRSTP+IP
Sbjct: 242 VSLALDNGLESYLNEIESKLFKVRPYNVETKKGMRELNPNDIDKLVSIKGLVLRSTPIIP 301

Query: 341 DMKVAFFKCNVCDHTMAVEIDRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQ 400
           DM VAFFKCNVC+HT+ VEIDRG+IQEP RC R+ CN PNSM L+HNRC+F D+QVIKLQ
Sbjct: 302 DMSVAFFKCNVCNHTVEVEIDRGIIQEPVRCPRVVCNSPNSMVLVHNRCTFQDRQVIKLQ 361

Query: 401 ETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTY 460
           ETPD VPDGQTPHS+SLCVYDELVDSCRAGDRIEV+G FRSIPIR+N +QR LKSLYKTY
Sbjct: 362 ETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVSGIFRSIPIRSNPKQRALKSLYKTY 421

Query: 461 XXXXXXXXXXXXRLDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYS 520
                       R+ VDTST+EQ+L+QN++D+  VEE+R ++ +D+ +I+E A R D+Y 
Sbjct: 422 IDVVHIQKVAKDRVGVDTSTVEQQLLQNQIDN--VEEIRTLSSEDIRRIKETARRSDVYD 479

Query: 521 LLARSIAPSIYELEDVKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQY 580
           +L+RSIAPSIYEL+DVKKGILLQL            RYRGDINILLCGDPSTSKSQILQY
Sbjct: 480 VLSRSIAPSIYELDDVKKGILLQLFGGANKTFKKGGRYRGDINILLCGDPSTSKSQILQY 539

Query: 581 VHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDS 640
           VHKI PRGVYTSGKGSSAVGLTAY+TRDVDTKQLVLESGALVLSDGGVCCIDEFDKM+D+
Sbjct: 540 VHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCIDEFDKMNDN 599

Query: 641 TRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLS 700
           TRSVLHEVMEQQTISIAKAGIITTLNAR+SILASANPI SRYNPNLPVTENIDLPPPLLS
Sbjct: 600 TRSVLHEVMEQQTISIAKAGIITTLNARTSILASANPINSRYNPNLPVTENIDLPPPLLS 659

Query: 701 RFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHP 760
           RFDLVYLVLDKV+E +DRELAKHLT+LYLED+P+ +SQ D+LPVEFLT YI+YAK++IHP
Sbjct: 660 RFDLVYLVLDKVNEASDRELAKHLTSLYLEDRPDSVSQGDILPVEFLTAYINYAKQNIHP 719

Query: 761 IITEAAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELE 820
           +ITE+AKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRL+EAHAKM+L   VELE
Sbjct: 720 VITESAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSERVELE 779

Query: 821 DVQEAVRLIRSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDS 880
           DV+EAVRLI+SAIKDYATDPKTGKIDMNLVQTGKSV+QRKL EDL+REI+ +L ++ +D+
Sbjct: 780 DVEEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVVQRKLLEDLAREILKILTERTTDT 839

Query: 881 MSFNELIKQINEHSQDRVESSDIQEALSRLQQEDKVI 917
           +SFNEL K INE SQD+VES ++  AL+RLQQEDKV+
Sbjct: 840 ISFNELSKLINEQSQDKVESIELSNALTRLQQEDKVV 876

>KLLA0E23276g complement(2065845..2068325) similar to sp|P38132
           Saccharomyces cerevisiae YBR202w CDC47 cell division
           control protein, start by similarity
          Length = 826

 Score =  347 bits (891), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 216/571 (37%), Positives = 329/571 (57%), Gaps = 44/571 (7%)

Query: 302 KVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEID 361
           K++P +V      RE+  + + KLI ++G++ R + V P + V  + C+ C H +  E++
Sbjct: 212 KLKPMSV------REIKGSYLGKLITVRGIITRVSDVKPSVTVNAYTCDQCGHEVFQEVN 265

Query: 362 RGVIQEPARCERIDC--NEPNSMSLIHNRCS-FADKQVIKLQETPDFVPDGQTPHSISLC 418
           +        C    C  N+      +  R S F+  Q  K+QE  D VP G  P ++++ 
Sbjct: 266 KRTFTPIIECPSAQCSENQTKGQLFMSTRASKFSAFQECKIQELSDQVPIGHIPRTLTIH 325

Query: 419 VYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKS--LYKTYXXXXXXXXXXXXRLDV 476
           +   L  S   GD ++VTG +   P       R LK+  L +TY               +
Sbjct: 326 INGPLTRSMIPGDVVDVTGIYLPSPYTGF---RALKAGLLTETY---------------L 367

Query: 477 DTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDV 536
           +T  + Q        H +     Q+ DQ   ++ ++  + D+Y+ LA+SIAP IY   DV
Sbjct: 368 ETQFVYQ--------HKKKFASFQVDDQLKERVAKIVNQGDVYNRLAKSIAPEIYGNLDV 419

Query: 537 KKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGS 596
           KK +LL L            + RGDINI L GDP  +KSQ+L+ + KI+PRGVYT+GKGS
Sbjct: 420 KKSLLLLLVGGVEKKVGDGLKIRGDINICLMGDPGVAKSQLLKSICKISPRGVYTTGKGS 479

Query: 597 SAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISI 656
           S VGLTA + +D  T ++VLE GALVL+D G+CCIDEFDKM +S R+ +HEVMEQQTISI
Sbjct: 480 SGVGLTAAVMKDPVTDEMVLEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISI 539

Query: 657 AKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKN 716
           +KAGI TTLNAR+SILA+ANP+  RYNP L   ENI+LP  LLSRFD+++L+LD   ++N
Sbjct: 540 SKAGINTTLNARASILAAANPLYGRYNPRLSPLENINLPAALLSRFDIMFLLLDMPSKEN 599

Query: 717 DRELAKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVG 776
           D +LA+H+T +++ D+      + + P   +  YI+YAK    P+++      +V +Y  
Sbjct: 600 DEKLAEHVTYVHMYDRQPDFGFEPI-PSSEMREYIAYAKTK-RPVLSADVNEHIVLSYTR 657

Query: 777 MRKMGDDSRSDEKRIT---ATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAI 833
           MR+  D  ++ + + +   AT R L ++IRL++A AK++L + VE+EDV EA+RL+  + 
Sbjct: 658 MRQ--DSKKALDSKFSFGQATPRTLLAIIRLSQALAKLRLSDTVEIEDVDEALRLVEVSK 715

Query: 834 KDYATDPKTGKIDMNLVQTGKSVIQRKLQED 864
           +   +D K    D N      ++I++   E+
Sbjct: 716 ESLYSDRKNPYEDENPTTRIYTIIKKMATEN 746

>Kwal_56.23282
          Length = 761

 Score =  340 bits (873), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 225/723 (31%), Positives = 365/723 (50%), Gaps = 82/723 (11%)

Query: 189 ECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSNLNLDARNL 248
           E   +F NF++ F+                  D    Y +QL     +   ++ +D  +L
Sbjct: 26  EIVKSFHNFVLEFRL-----------------DAHFVYREQLRSNLLVKNYSITVDTAHL 68

Query: 249 LAYKQTEDLYHQLLNYPQEVISIMDQTIKDC---MVSLIVDNNLDYDLDEIETKFYKVRP 305
           + Y   EDLY +L + P +V+ + +Q +      +  L  D N+D + +++E       P
Sbjct: 69  IGYN--EDLYKRLYDEPTDVLPLFEQAVSQVARRIALLSRDPNMDPN-NQLENASTDDAP 125

Query: 306 -------YNVGSCKGM----------RELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFK 348
                  +++ +C+ M          R L   ++ K++ + G+V+ ++ +          
Sbjct: 126 NSGASLAFDIPTCQVMLISDSSETSLRVLGSENVSKIVRVSGIVVSASVLSSRATFLTLM 185

Query: 349 CNVCDHTMAVEIDR------GVIQEPARCERIDCNEPNS-------MSLIHNRCSFADKQ 395
           C  C H   + ++         +  P  C      E  S         ++H    F D+Q
Sbjct: 186 CRNCRHVTTMHLNSFGSLGGNHVSLPRNCLADHSRETGSNPCGQDPYMIVHESSRFVDQQ 245

Query: 396 VIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKS 455
            +KLQE P+ VP G+ P +I +     L +    G R  + G +               S
Sbjct: 246 FLKLQEIPELVPVGEMPRNILMSCDRYLTNRIVPGTRATIVGIY---------------S 290

Query: 456 LYKTYXXXXXXXXXXXXRLDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAR 515
           +Y+               + +    ++   +Q  +D N +      TD++  +   ++ R
Sbjct: 291 IYQAKSRGAGTAASGGKAVAIRNPYVKILGIQTDLDGNPMSNTVVFTDEEEEQFLTLSRR 350

Query: 516 EDLYSLLARSIAPSIYELEDVKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKS 575
            DLY +  +SIAPSIY  ED+KK I+  L            R RGDIN+LL GDP T+KS
Sbjct: 351 PDLYEIFTKSIAPSIYGNEDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDPGTAKS 410

Query: 576 QILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFD 635
           Q+L++V K++P  VYTSGKGSSA GLTA + RD  T++  LE GA+VL+DGGV CIDEFD
Sbjct: 411 QLLKFVEKVSPISVYTSGKGSSAAGLTASVQRDPATREFYLEGGAMVLADGGVVCIDEFD 470

Query: 636 KMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLP 695
           KM D  R  +HE MEQQTISIAKAGI T LN+R+S+LA+ANPI  RY+      ENID  
Sbjct: 471 KMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGENIDFQ 530

Query: 696 PPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLY----LEDKPEHISQDDVLPVEFLTMYI 751
             +LSRFD++++V D  +E+ D  +A H+ N++      ++ E  +  + +P+E +  YI
Sbjct: 531 TTILSRFDMIFIVKDHHNEERDISIANHVMNIHTGRTATNEEEREAAANEIPIEKMKRYI 590

Query: 752 SYAKEHIHPIITEAAKTELVRAYVGMRK--MGDDSRSDEK-RITATTRQLESMIRLAEAH 808
           +Y +    P ++  A  +L   +VG+RK  + ++ +S+++  I  T RQLE++IR++E+ 
Sbjct: 591 TYCRMKCAPRLSPQAAEKLSSHFVGIRKKLLINELQSEQRSSIPITVRQLEAIIRISESL 650

Query: 809 AKMKLKNVVELEDVQEAVRLIRSAIKDYATDPKTGKIDMN--LVQTGKSVIQRKLQEDLS 866
           AK++L  V     V EA+RL +++  D A+    G +  N  LVQ       R+++E+L 
Sbjct: 651 AKLELSPVAHERHVDEAIRLFQASTMDAASQDPIGGLGQNQDLVQD-----VRRIEEELK 705

Query: 867 REI 869
           R +
Sbjct: 706 RRL 708

>Scas_590.6
          Length = 767

 Score =  340 bits (873), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 237/776 (30%), Positives = 390/776 (50%), Gaps = 96/776 (12%)

Query: 189 ECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSNLNLDARNL 248
           E   +F+NF++ F+                  D +  Y  QL     +   +LN++  +L
Sbjct: 26  EIIKSFKNFILEFRL-----------------DSQFIYRDQLRNSLLVKNYSLNVNMEHL 68

Query: 249 LAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIV-------DNNLDYDLDEIETKF- 300
           + Y   EDL+ +L + P +VI + +  I      + +       +N    + D+++T+  
Sbjct: 69  IGYN--EDLFKRLSDGPSDVIPLFETAITQVAKRITLLNRSSQNENGTANETDDLDTRNS 126

Query: 301 --------YKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVC 352
                   +++   +  +   +R L+   + K++ L G+++ ++ +          C  C
Sbjct: 127 ISSALIPNFQLILTSTANQTPLRSLDSEHVSKIVRLSGIIISASVLSSRATHLSLMCRSC 186

Query: 353 DHTMAVEIDR------GVIQEPARC-------------ERIDCNEPNSMSLIHNRCSFAD 393
            HT +++ID         +  P  C                +C  P+   +IH   +F D
Sbjct: 187 RHTTSIKIDNFNSITGNSVTLPHACLSSVTATDTGDDSNNKNCG-PDPYLIIHESSTFID 245

Query: 394 KQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVL 453
           +Q +KLQE P+ VP G+ P +I++     L +    G R+ + G + SI    +S++R  
Sbjct: 246 QQFLKLQEIPELVPVGEMPRNITMSCDRYLTNRVIPGTRVTIVGIY-SI---YSSKKRGY 301

Query: 454 KSL--YKTYXXXXXXXXXXXXRLDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIRE 511
            S                   + DV+TS+I                V   ++++  +  +
Sbjct: 302 NSNNDGGGVAIRNPFIKVLGIQTDVETSSIWN-------------SVTMFSEEEEEEFLQ 348

Query: 512 VAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPS 571
           ++ REDLY +L +SIAPSI+  ED+KK I+  L            R RGDIN+LL GDP 
Sbjct: 349 LSRREDLYEVLTKSIAPSIFGNEDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDPG 408

Query: 572 TSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCI 631
           T+KSQ+L++V K++P  VYTSGKGSSA GLTA + RD  T++  LE GA+VL+DGGV CI
Sbjct: 409 TAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPATREFYLEGGAMVLADGGVVCI 468

Query: 632 DEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTEN 691
           DEFDKM D  R  +HE MEQQTISIAKAGI T LN+R+S+LA+ANPI  RY+      EN
Sbjct: 469 DEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGEN 528

Query: 692 IDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHISQD-----DVLPVEF 746
           ID    +LSRFD++++V D+ +E  D  +A H+ N++  +      QD       L +E 
Sbjct: 529 IDFQTTILSRFDMIFIVKDEHNEARDISIANHVINIHTGNSTTQQDQDLENSGSELSMEK 588

Query: 747 LTMYISYAKEHIHPIITEAAKTELVRAYVGMRK---MGDDSRSDEKRITATTRQLESMIR 803
           +  YI+Y +    P ++  A  +L   +V +RK   + +   ++   I  T RQLE++IR
Sbjct: 589 MKRYITYCRIKCAPRLSVQAAEKLSSQFVTIRKQLLINELESTERSSIPITIRQLEAIIR 648

Query: 804 LAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYAT-DPKTGKIDMNLVQTGKSVIQ--RK 860
           + E+ AK++L  V     V+EA+RL +++  D A+ DP  G   +N    G +++   R+
Sbjct: 649 ITESLAKLELSPVAHERHVEEAIRLFQASTMDAASQDPIGG---LNQTGNGSNIMAEIRR 705

Query: 861 LQEDLSREIMNVLKDQASDSMSFNELIKQINEHSQDRVESSDIQEALSRLQQEDKV 916
           ++ +L R +          S S+  L ++  E   +R     + +AL  L++ D +
Sbjct: 706 IESELKRRL------PIGWSTSYQTLRREFVE--SNRFSQGALDKALYALEKHDTI 753

>ADR041W [1782] [Homologous to ScYBR202W (CDC47) - SH]
           complement(777754..780195) [2442 bp, 813 aa]
          Length = 813

 Score =  340 bits (873), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 207/536 (38%), Positives = 310/536 (57%), Gaps = 38/536 (7%)

Query: 315 RELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDRGVIQEPARCERI 374
           RE+  + + KLI + G+V R + V P + V  + C+ C   +  E+++        C   
Sbjct: 215 REVKGSHLGKLITVSGIVTRISDVKPAVLVTAYTCDQCGAEVFQEVNKRTFTPFLECTSR 274

Query: 375 DC--NEPNSMSLIHNRCS-FADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGD 431
            C  N+      +  R S F+  Q  K+QE    VP G  P ++++ V   LV S   GD
Sbjct: 275 QCQQNQNKGQLFMSTRASKFSAFQECKIQEMSHQVPIGHIPRTLTIHVNGPLVRSMVPGD 334

Query: 432 RIEVTGTFRSIPIRANSRQRVLKS--LYKTYXXXXXXXXXXXXRLDVDTSTIEQELMQNK 489
            ++VTG +   P       + LK+  L +TY                      Q + Q+K
Sbjct: 335 IVDVTGIYLPAPYTGF---KALKAGLLTETYLEA-------------------QYVRQHK 372

Query: 490 VDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXXX 549
              +  E    IT     ++  +  + D+Y+ LA+SIAP IY   DVKK +LL +     
Sbjct: 373 KKFSSFE----ITSDVEKRVMSIVQQGDVYTRLAKSIAPEIYGNLDVKKALLLLMVGGVH 428

Query: 550 XXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDV 609
                  + RGDINI L GDP  +KSQ+L+ + KITPRGVYT+GKGSS VGLTA + +D 
Sbjct: 429 KTVGDGMKIRGDINICLMGDPGVAKSQLLKSICKITPRGVYTTGKGSSGVGLTAAVMKDP 488

Query: 610 DTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARS 669
            T ++VLE GALVL+D G+CCIDEFDKM +S R+ +HEVMEQQTISI+KAGI TTLNAR+
Sbjct: 489 VTDEMVLEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNART 548

Query: 670 SILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYL 729
           SILA+ANP+  RYNP L   ENI+LP  LLSRFD+++L+LD    +ND +LA+H+  +++
Sbjct: 549 SILAAANPVYGRYNPRLSPLENINLPAALLSRFDIMFLLLDMPHRENDEKLAEHVAYVHM 608

Query: 730 EDKPEHISQDDVLPVEFLTM--YISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSD 787
            ++   +   D  P+E   M  +I++AK    PI+T+     +V++Y+ MR+   +    
Sbjct: 609 HNRQPEL---DFEPIEPAAMREFIAFAKTK-RPIMTQEVNELVVQSYIRMRQDSKNVTDP 664

Query: 788 EKRIT-ATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDPKT 842
           +++   AT R L ++IR+++A AK++  + V++EDV+EA+RLI+ +      D +T
Sbjct: 665 KQQFGQATPRTLLAVIRISQALAKLRFSDQVDVEDVEEALRLIQVSKDSLYNDTQT 720

>CAGL0F04939g 503890..506208 highly similar to sp|P29496
           Saccharomyces cerevisiae YLR274w CDC46 cell division
           control protein, start by similarity
          Length = 772

 Score =  335 bits (860), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 229/734 (31%), Positives = 368/734 (50%), Gaps = 93/734 (12%)

Query: 189 ECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSNLNLDARNL 248
           E    F+ F++ F+                  D +  Y  QL     +   +L++D  +L
Sbjct: 26  EIIKAFKRFILEFRL-----------------DSQFLYRDQLRNSLLVKNYSLSVDLEHL 68

Query: 249 LAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDN---NLDYDLDEIE-------- 297
           + Y   EDLY +L + P +VI + +  I      +++ N   N +  LD+I+        
Sbjct: 69  IGYN--EDLYKRLSDEPSDVIPLFETAITQVAKRIMILNKSSNTNDGLDDIDENSNDLAD 126

Query: 298 -------TKFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCN 350
                     +++   +  +   +R+LN   +  ++ L G+++ ++ +          C 
Sbjct: 127 DEDGITDIPVFQLILSSRANQVSLRQLNSEHVSNIVRLSGIIVSASVLSQRATHLSLMCR 186

Query: 351 VCDHTMAVEIDR------GVIQEPARCERIDCNE-----------------------PNS 381
            C HTM++ I+         +  P  C+  + N                        P+ 
Sbjct: 187 NCRHTMSLNINNFNSITGNSVTLPHSCQSTNNNSTAAYIHDTGDDPTGSGAASKNCGPDP 246

Query: 382 MSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRS 441
             +IH    F D+Q +KLQE P+ VP  + P +I++     L +    G R+ + G + S
Sbjct: 247 YIIIHESSKFIDQQFLKLQEVPELVPVSEMPRNITMTCDRYLTNRVNPGTRVTIEGIY-S 305

Query: 442 IPIRANSRQRVLKSLYKTYXXXXXXXXXXXXRLDVDTSTIEQELMQNKVDHNEV-EEVRQ 500
           I    NS++R                      + + T  I+   +Q  V+ + +   +  
Sbjct: 306 I---YNSKKR------------SGAAGQSGSGVAIRTPYIKVLGIQTDVEASSIWNSMTM 350

Query: 501 ITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXXXXXXXXXXRYRG 560
            ++++  +  +++ R D+Y LLA SIAPSI+  +D+KK I+  L            R RG
Sbjct: 351 FSEEEEEEFLQLSRRPDIYELLANSIAPSIFGNQDIKKAIVCLLMGGSKKLLPDGMRLRG 410

Query: 561 DINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGA 620
           DIN+LL GDP T+KSQ+L++V K++P  VYTSGKGSSA GLTA + RD  TK+  LE GA
Sbjct: 411 DINVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPITKEFFLEGGA 470

Query: 621 LVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGS 680
           +VL+DGGV CIDEFDKM D  R  +HE MEQQTISIAKAGI T LN+R+S+LA+ANPI  
Sbjct: 471 MVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYG 530

Query: 681 RYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHISQDD 740
           RY+      ENID    +LSRFD++++V D+ +E+ D  +A H+ N++       +  + 
Sbjct: 531 RYDELKSPGENIDFQTTILSRFDMIFIVKDEHNEERDISIANHVMNIHTGHTDAQLEANG 590

Query: 741 V-LPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRK---MGDDSRSDEKRITATTR 796
             L +E +  YI+Y K    P +T  A  +L   +V +RK   + +   ++   I  T R
Sbjct: 591 SELSIEKMKRYITYCKSRCAPRLTPEAAEKLSSQFVTIRKQLLINELESTERSSIPITIR 650

Query: 797 QLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYAT-DPKTGKIDMNLVQTGKS 855
           QLE++IR+ E+ AK++L  + E   V EA+RL +++  D A  DP  G   MN  QT   
Sbjct: 651 QLEAIIRITESLAKLELSPIAEERHVDEAIRLFQASTMDAAAQDPIGG---MN--QTNSL 705

Query: 856 VIQRKLQEDLSREI 869
              R+++++L R +
Sbjct: 706 SDIRRVEQELKRRL 719

>AGR276W [4587] [Homologous to ScYLR274W (CDC46) - SH]
           complement(1257348..1259552) [2205 bp, 734 aa]
          Length = 734

 Score =  329 bits (844), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 224/708 (31%), Positives = 360/708 (50%), Gaps = 79/708 (11%)

Query: 189 ECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSNLNLDARNL 248
           E   +FR+F++ F+   R +   RE+  NN              +R      L ++  +L
Sbjct: 26  EVVRSFRDFVLEFRLDARFVY--REQLRNNLL------------VRRYA---LRVNTEHL 68

Query: 249 LAYKQTEDLYHQLLNYPQEVISIMDQTIKDC---MVSLIVDNNLDYDLDEIETKFYKVRP 305
           + Y   E LY  + + P E + + +Q + +    M  L  ++       ++E +      
Sbjct: 69  IGYN--EALYKLVRDEPVETVPLFEQAVTEIARRMARLRAEDAGALPAVQVELQ------ 120

Query: 306 YNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDR--- 362
            +  +   +R+L+   + +L+ L G+V+ ++ +          C  C HT A++++    
Sbjct: 121 -SAAAETALRQLDSQSVSRLVRLSGIVVSTSVLTSRATHVALMCRNCRHTTALDLNNFQS 179

Query: 363 ---GVIQEPARCERIDCNEPNSMS----------LIHNRCSFADKQVIKLQETPDFVPDG 409
                +  P  C     N+  S +          ++H    F D+Q +KLQE P+ VP G
Sbjct: 180 LAGSNVALPRACLADHSNDDGSAAGNPCGQDPYMIVHESSRFVDQQFLKLQEVPESVPIG 239

Query: 410 QTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYXXXXXXXXX 469
           + P ++ L     L +    G R+ V G +               ++Y++          
Sbjct: 240 EMPRNLLLTCDRYLTNRVVPGTRVTVVGIY---------------AIYQSKGGQGGARAV 284

Query: 470 XXXRLDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPS 529
                 V    IE +        +    +   ++++  +   +A   +LY L A SIAPS
Sbjct: 285 AIRNPYVKVLGIEAQ------AGSPAGVLSMFSEEEEEEFLRLARTPNLYQLFAESIAPS 338

Query: 530 IYELEDVKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGV 589
           IY  ED+KK I+  L            R RGDIN+LL GDP T+KSQ+L++V K++P  V
Sbjct: 339 IYGNEDIKKAIVCLLMGGSKKLLPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVSPIAV 398

Query: 590 YTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVM 649
           YTSGKGSSA GLTA + RD +T++  LE GA+VL+DGGV CIDEFDKM D  R  +HE M
Sbjct: 399 YTSGKGSSAAGLTASVQRDPNTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAM 458

Query: 650 EQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVL 709
           EQQTISIAKAGI T LN+R+S+LA+ANPI  RY+      ENID    +LSRFD++++V 
Sbjct: 459 EQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDELKSPGENIDFQTTILSRFDMIFIVK 518

Query: 710 DKVDEKNDRELAKHLTNLYLEDK--PE--HISQDDVLPVEFLTMYISYAKEHIHPIITEA 765
           D+ +E+ D  +A+H+ N++      P+      D  +P++ +  YI+Y +    P ++  
Sbjct: 519 DEHNEQRDMSIAQHVMNIHTGRTAVPDAGAAGADREIPIDKMRRYITYCRSKCAPRLSTH 578

Query: 766 AKTELVRAYVGMRK--MGDDSRSDEK-RITATTRQLESMIRLAEAHAKMKLKNVVELEDV 822
           A  +L   +V +RK  + ++  S EK  I  T RQLE++IR++E+ AK++L +V E   V
Sbjct: 579 AAEKLSSHFVTIRKQLLINELESKEKSSIPITVRQLEAIIRISESLAKLELSSVAEERHV 638

Query: 823 QEAVRLIRSAIKDYAT-DPKTGKIDMNLVQTGKSVIQRKLQEDLSREI 869
            EA+RL +++  D A+ DP  G  + N+V        R L+ +L R +
Sbjct: 639 DEAIRLFQASTMDAASQDPIGGMQNSNVVSE-----VRNLEAELKRRL 681

>Scas_721.36
          Length = 855

 Score =  331 bits (848), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 208/529 (39%), Positives = 312/529 (58%), Gaps = 46/529 (8%)

Query: 314 MRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDRGVIQEPARCER 373
           +RE+  + + +LI ++G+V R + V P + V  + C+ C + +  E+          C  
Sbjct: 227 VREIKGDFLGQLITVRGIVTRVSDVKPSVLVIAYTCDQCGYEVFQEVHSRTFTPLIDCTS 286

Query: 374 IDC--NEPNSMSLIHNRCS-FADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAG 430
            +C  N+      +  R S F+  Q +K+QE    VP G  P S+S+ V   LV S   G
Sbjct: 287 EECAQNQTKGQLFMSTRASKFSAFQEVKIQELSQQVPVGHIPRSLSIHVNGALVRSMTPG 346

Query: 431 DRIEVTGTFRSIPIRANSRQRVLKS--LYKTYXXXXXXXXXXXXRLDVDTSTIEQELMQN 488
           D ++V+G F   P       + LK+  L +TY                      Q + Q+
Sbjct: 347 DIVDVSGIFLPSPYTGF---KALKAGLLTETYLEA-------------------QFVRQH 384

Query: 489 KVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXX 548
           K      +    + D    ++ E+ A+ D+Y+ +A+SIAP IY   DVKK +LL L    
Sbjct: 385 KKKFASFDLSSGMED----RVTEMIAQGDVYNRMAKSIAPEIYGNLDVKKALLLLLVGGV 440

Query: 549 XXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRD 608
                   + RGDIN+ L GDP  +KSQ+L+ + KI+PRGVYT+GKGSS VGLTA + +D
Sbjct: 441 DKKVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAAVMKD 500

Query: 609 VDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNAR 668
             T +++LE GALVL+D G+CCIDEFDKM +S R+ +HEVMEQQTISI+KAGI TTLNAR
Sbjct: 501 PVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNAR 560

Query: 669 SSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLY 728
           +SILA+ANP+  RYNP L   ENI+LP  LLSRFD+++L+LD  + +ND +LA+H+  ++
Sbjct: 561 ASILAAANPLYGRYNPRLSPLENINLPAALLSRFDILFLLLDTPNRENDEKLAEHVAYVH 620

Query: 729 LEDKPEHISQDDV--LPVEFLTM--YISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDS 784
           +     H SQ D+   P+E   M  YI++AK    P++ EA    +++AY+ +R+  D  
Sbjct: 621 M-----HQSQPDLEFEPIEPARMREYIAFAKSK-RPVMNEAVNEYVIQAYIRLRQ--DSK 672

Query: 785 RSDEKRIT---ATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIR 830
           R  + + +   AT R L  +IRL++  AK++L + V+++DV+EA+RL+R
Sbjct: 673 REMDSKFSFGQATPRTLLGIIRLSQGLAKLRLSDTVDIDDVEEALRLVR 721

>CAGL0M05423g 577097..579535 highly similar to sp|P38132
           Saccharomyces cerevisiae YBR202w CDC47, start by
           similarity
          Length = 812

 Score =  328 bits (842), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 209/541 (38%), Positives = 311/541 (57%), Gaps = 43/541 (7%)

Query: 301 YKVRPYNVGSCK-GMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVE 359
           Y  + Y  GS    +R++    + +LI ++G++ R + V P + V  + C+ C + +  E
Sbjct: 207 YNSKKYLTGSIPLSVRQIKGELLGELITVRGIITRVSDVKPAVTVIAYTCDQCGYEIFQE 266

Query: 360 IDRGVIQEPARCERIDC--NEPNSMSLIHNRCS-FADKQVIKLQETPDFVPDGQTPHSIS 416
           ++         C   +C  N+      +  R S F   Q  K+QE    VP G  P S++
Sbjct: 267 VNSKTFTPLVECTSRECSQNQTKGQLFMSTRASKFNAFQECKIQELSQQVPVGHIPRSLT 326

Query: 417 LCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKS--LYKTYXXXXXXXXXXXXRL 474
           + V   LV S   GD +++ G F   P       + LK+  L +TY              
Sbjct: 327 IHVNGPLVRSVTPGDIVDIAGIFLPSPYTGF---KALKAGLLTETY-------------- 369

Query: 475 DVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELE 534
            ++   + Q        H +     Q+T Q  + +  +A   ++Y  LA+SIAP IY   
Sbjct: 370 -LEAHHVRQ--------HKKKFASFQMTPQVRSNVDALAQSGNVYERLAKSIAPEIYGNL 420

Query: 535 DVKKGILLQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGK 594
           DVKK +LL L            + RGDINI L GDP  +KSQ+L+ + KITPRGVYT+GK
Sbjct: 421 DVKKALLLLLVGGVDKRVGDGMKIRGDINICLMGDPGVAKSQLLKAICKITPRGVYTTGK 480

Query: 595 GSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTI 654
           GSS VGLTA + +D  T +++LE GALVL+D G+CCIDEFDKM +S R+ +HEVMEQQTI
Sbjct: 481 GSSGVGLTAAVMKDPVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTI 540

Query: 655 SIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDE 714
           SI+KAGI TTLNAR+SILA+ANP+  RYNP L   ENI+LP  LLSRFD+++L+LD  + 
Sbjct: 541 SISKAGINTTLNARTSILAAANPLYGRYNPRLSPLENINLPAALLSRFDVMFLLLDTPNR 600

Query: 715 KNDRELAKHLTNLYLEDKPEHISQDDVLPVEFLTM--YISYAKEHIHPIITEAAKTELVR 772
           +ND +LA H+  +++ +K   +   D  P+E   M  +I+YA+  + P++T      +V 
Sbjct: 601 ENDEQLANHVAYVHMYNKQPDL---DFEPIEPTMMREFIAYART-MRPVMTAEINDHVVS 656

Query: 773 AYVGMRKMGDDSRSDEKRIT---ATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLI 829
           AY+ +R+  D  R  + + +   AT R L ++IRL++A AK++L   V+++DV+EA+RLI
Sbjct: 657 AYIRLRQ--DSKREMDSKFSFGQATPRTLLAIIRLSQALAKLRLSETVDIDDVEEALRLI 714

Query: 830 R 830
           R
Sbjct: 715 R 715

>Kwal_27.12002
          Length = 833

 Score =  328 bits (842), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 202/525 (38%), Positives = 310/525 (59%), Gaps = 38/525 (7%)

Query: 314 MRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDRGVIQEPARCER 373
           +R++  + +  LI  +G+V R + V P + V  + C+ C + +  E++       A C  
Sbjct: 217 VRQIRGDLLGNLITARGIVTRVSDVKPSVMVNAYTCDQCGYEVFQEVNSRTFTPLAECTS 276

Query: 374 IDC--NEPNSMSLIHNRCS-FADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAG 430
             C  N+      +  R S F+  Q  K+QE  + VP G  P ++++ +   LV S   G
Sbjct: 277 EQCSQNQTKGQLFMSTRASKFSAFQECKIQEMSEQVPIGHIPRTLTIHINGALVRSLTPG 336

Query: 431 DRIEVTGTFRSIPIRANSRQRVLKS--LYKTYXXXXXXXXXXXXRLDVDTSTIEQELMQN 488
           D ++VTG +   P       + LK+  L +TY                      Q + Q+
Sbjct: 337 DVVDVTGIYMPAPYTGF---KALKAGLLTETYLEA-------------------QYVFQH 374

Query: 489 KVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXX 548
           K      E    IT +  A++  +A + D+Y+ LA+SIAP IY   DVKK +LL L    
Sbjct: 375 KKKFATFE----ITPETEARVFNIARQGDVYNRLAKSIAPEIYGNLDVKKALLLLLVGGV 430

Query: 549 XXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRD 608
                   + RGDINI L GDP  +KSQ+L+ + KI+PRGVYT+GKGSS VGLTA + +D
Sbjct: 431 DKKVGDGMKIRGDINICLMGDPGVAKSQLLKSICKISPRGVYTTGKGSSGVGLTAAVMKD 490

Query: 609 VDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNAR 668
             T ++VLE GALVLSD G+CCIDEFDKM +  R+ +HEVMEQQTISI+KAGI TTLNAR
Sbjct: 491 PVTDEMVLEGGALVLSDNGICCIDEFDKMDEGDRTAIHEVMEQQTISISKAGINTTLNAR 550

Query: 669 SSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLY 728
           +SILA+ANP+  RYNP L   ENI+LP  LLSRFD+++L+LD  + ++D +LA+H+  ++
Sbjct: 551 TSILAAANPLYGRYNPRLSPLENINLPAALLSRFDILFLLLDTPNREDDEKLAEHVAFVH 610

Query: 729 LEDKPEHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSDE 788
           + +K   +  + + P + +  +I+YAK    P ++      +V++Y+ MR+  D  ++ +
Sbjct: 611 MHNKQPDLGFEPIEPSD-MREFIAYAKTK-RPTMSSEVNEYVVQSYIRMRQ--DSKKAMD 666

Query: 789 KRIT---ATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIR 830
            R +   AT R L ++IRL++  AK++  ++VE++D++EA+RLI+
Sbjct: 667 SRFSFGQATPRTLLAIIRLSQGLAKLRFSDIVEVDDIEEALRLIQ 711

>CAGL0J06424g complement(611935..614853) highly similar to sp|P53091
           Saccharomyces cerevisiae YGL201c MCM6, start by
           similarity
          Length = 972

 Score =  330 bits (846), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 209/584 (35%), Positives = 314/584 (53%), Gaps = 62/584 (10%)

Query: 299 KFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAV 358
           + +++  +N+ +   +RE+  + I  L+ + G V R++ V P++  A F C++C   M  
Sbjct: 248 RLFQISFFNLPTVHRIREIRSDKIGSLMCISGTVTRTSEVRPELYKASFTCDMC-RAMVD 306

Query: 359 EIDRGV-IQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISL 417
            +++     EP  C    C      +L  +R  F D Q +++QE  + +P+G  P ++ +
Sbjct: 307 NVEQSFKYTEPTFCPNPACENRAFWTLNVSRSKFLDWQKVRIQENTNEIPNGSMPRTLDV 366

Query: 418 CVYDELVDSCRAGDRIEVTGTFRSIP-----------------IRA--------NSRQRV 452
            +  + VD  + GD+ + TG    +P                  R         NS    
Sbjct: 367 ILRGDAVDRAKPGDKCQFTGVEIVVPDVSQLMLPGVKPSSSLDTRGIARSSEGLNSGVTG 426

Query: 453 LKSL------YKTYXXXXXXXXXXXXRLDVDTSTIEQEL-MQNKVDHNEVEEVRQ----- 500
           LKSL      YK                  + S+ E  L   +K+ +N++   R+     
Sbjct: 427 LKSLGVRDLTYKITFLGSHVVSVGSNMNPNENSSAETNLQFISKLQNNDIYSDREKDQEI 486

Query: 501 ----ITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXXXXXXXXXX 556
               ++  ++ +++++   + +Y  L RSIAPS++  E +KKGILLQ+            
Sbjct: 487 FLSSLSPDEINELQDMVKDDHVYDKLVRSIAPSVFGHEAIKKGILLQMLGGVHKTTVEGI 546

Query: 557 RYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVL 616
           + RGDINI + GDPSTSKSQ L+YV +  PR VYTSGK SSA GLTA + RD +     +
Sbjct: 547 KLRGDINICIVGDPSTSKSQFLKYVCRFAPRSVYTSGKASSAAGLTAAVVRDEEGGDYTI 606

Query: 617 ESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASAN 676
           E+GAL+L+D G+CCIDEFDKM  S +  +HE MEQQTISIAKAGI  TLNAR+SILA+AN
Sbjct: 607 EAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAAN 666

Query: 677 PIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHI 736
           PIG RYN    +  N+++  P++SRFDL ++VLD  +EK D ELA H+ +L       H+
Sbjct: 667 PIGGRYNRKTSLRANLNMTAPIMSRFDLFFVVLDDCNEKIDTELASHIIDL-------HM 719

Query: 737 SQDDVL----PVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSDEK--- 789
            QD+ +      E L  YI YAK    P+I + A+  LV  Y  +RK  DD++   +   
Sbjct: 720 KQDEAITSPYSAEQLQRYIKYAKT-FKPVINKEARKFLVEKYKALRK--DDAQGYSRSSY 776

Query: 790 RITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAI 833
           RI  T RQLESM+RL+EA A+    + +  E V EA  L++ +I
Sbjct: 777 RI--TVRQLESMVRLSEAIARANCSDEITPEFVAEAYDLLKQSI 818

>KLLA0D09262g 780273..782513 similar to sp|P29496 Saccharomyces
           cerevisiae YLR274w CDC46 cell division control protein,
           start by similarity
          Length = 746

 Score =  324 bits (831), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 225/704 (31%), Positives = 350/704 (49%), Gaps = 88/704 (12%)

Query: 178 RIIWGTNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELG 237
           R++ G  +S  E +   ++F  SF  +FR              D    Y +QL     + 
Sbjct: 12  RVLAGEELSSNENSEIIKSF-KSFILEFR-------------LDSNFVYREQLRNNLLVH 57

Query: 238 TSNLNLDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIE 297
              L+++  +L+ Y   EDLY +L + P ++I + +Q I      +++ +  D D+D  E
Sbjct: 58  KYFLDVNTEHLIGYN--EDLYKKLQDEPIDIIPLFEQAITQVAKRIVLLSQ-DSDIDP-E 113

Query: 298 TKFYKVRPYNVGSCK----------GMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFF 347
           T        N   C+           +R L+ + + K++ + G+++ S+ +         
Sbjct: 114 TALS-----NFPLCQLILNSSSMEIPLRSLDSDHVSKIVRITGIIISSSVLTSRATQLSL 168

Query: 348 KCNVCDHTMAVEIDRGVIQE------PARCERIDCNE---------PNSMSLIHNRCSFA 392
            C  C H   ++++            P  C     NE         P+   ++H    F 
Sbjct: 169 MCRSCKHMTTLKLNNFQNLNNNNVQLPRECLADRSNETDETAASCGPDPYLIVHESSQFI 228

Query: 393 DKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTF-------RSIPIR 445
           D+Q +KLQE P+ VP G+ P ++ +     L +    G R+ + G +       +SI   
Sbjct: 229 DQQFLKLQELPESVPIGELPRNLLMTCDRYLTNQVVPGTRVTIIGIYSIYQSKNKSINSS 288

Query: 446 ANSRQRVLKSLYKTYXXXXXXXXXXXXRLDVDTSTIEQELMQNKVDHNEVEEVRQITDQD 505
            N    +     K               L + + + EQE +                   
Sbjct: 289 GNKAVAIRNPYVKVIGIKHLSNNPLNNSLSMFSESEEQEFL------------------- 329

Query: 506 LAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXXXXXXXXXXRYRGDINIL 565
                E++ R DLY L A SIAPSIY   D+KK I+  L            R RGDIN+L
Sbjct: 330 -----ELSQRPDLYELFANSIAPSIYGNTDIKKAIVCLLMGGSKKLLPDGMRLRGDINVL 384

Query: 566 LCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSD 625
           L GDP T+KSQ+L++V K++P  VYTSGKGSSA GLTA + RD  T++  LE GA+VL+D
Sbjct: 385 LLGDPGTAKSQLLKFVEKVSPISVYTSGKGSSAAGLTASVQRDPTTREFYLEGGAMVLAD 444

Query: 626 GGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPN 685
           GGV CIDEFDKM D  R  +HE MEQQTISIAKAGI T LN+R+S+LA+ANP+  RY+  
Sbjct: 445 GGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPVYGRYDDL 504

Query: 686 LPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHISQDDV---- 741
               ENID    +LSRFD++++V D  +E  D ++A H+ N++     ++   D+     
Sbjct: 505 KSPGENIDFQTTILSRFDMIFIVKDDHNEARDIQIANHVMNIHTGRTQQNDPNDNSNSNN 564

Query: 742 -LPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDS--RSDEK-RITATTRQ 797
            +P+E +  Y+SY +    P ++  A T+L   ++ +RK   +S   S+E+  I  T RQ
Sbjct: 565 EIPIETMKRYVSYCRLKCAPRLSPEAATKLSSHFITIRKQLQESERHSNERSSIPITVRQ 624

Query: 798 LESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYAT-DP 840
           LE++IR+ E+ AK++L  V   + V EA+RL +++  D A+ DP
Sbjct: 625 LEAIIRITESLAKLELNPVATEKHVDEAIRLFQASTMDAASQDP 668

>KLLA0F10087g complement(935618..938629) similar to sp|P53091
           Saccharomyces cerevisiae YGL201c MCM6 involved in
           replication, start by similarity
          Length = 1003

 Score =  329 bits (844), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 212/592 (35%), Positives = 317/592 (53%), Gaps = 65/592 (10%)

Query: 294 DEIETKFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCD 353
           D++E +  ++   N+ +   +R++  N I  L+ + G V R++ + P++  A F C +C 
Sbjct: 239 DQVE-RVLQISFLNLPTVHRIRDIRANKIGSLMAISGTVTRTSEIRPELYKASFTCELCR 297

Query: 354 HTMAVEIDRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPH 413
             +          EP  C    C   +  SL  NR  F D Q +++QE  + +P G  P 
Sbjct: 298 AVIDNVEQVFKYTEPTSCPNPTCENQSFWSLNVNRSKFLDWQKVRIQENSNEIPSGSMPR 357

Query: 414 SISLCVYDELVDSCRAGDRIEVTGTFRSIP---------IRA----------------NS 448
           ++ + +  + V+  + GDR +  GT   +P         ++A                NS
Sbjct: 358 TLDIILRGDCVERAKPGDRCKFIGTEIVVPDVSQLGLPGVKASSTPDSRGISRTTEGLNS 417

Query: 449 RQRVLKSLYK---TYXXXXXXXXXXXXRLDVDTSTIEQELM--QNKVDHNEVE-----EV 498
               LKSL     TY                + S I +E     +K D+  +      E+
Sbjct: 418 GISGLKSLGVRDLTYKISFLACHVENVGTSFNGSRINEEDADKTSKFDYINLRNYQNYEM 477

Query: 499 RQITDQDLA----------KIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXX 548
              TDQ++           +++E+   E++Y  L +SIAP+++  E +KKGILLQ+    
Sbjct: 478 AAETDQEIFLTRLDSDEINELKEMVKDENIYDKLVKSIAPAVFGHETIKKGILLQMLSGV 537

Query: 549 XXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRD 608
                   + RGDINI + GDPSTSKSQ L+YV   +PR VYTSGK SSA GLTA + +D
Sbjct: 538 HKTTVEGIKLRGDINICIVGDPSTSKSQFLKYVCNFSPRAVYTSGKASSAAGLTAAVVKD 597

Query: 609 VDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNAR 668
            +     +E+GAL+L+D GVCCIDEFDKM  + +  +HE MEQQTISIAKAGI  TLNAR
Sbjct: 598 EEGGDFTIEAGALMLADNGVCCIDEFDKMDIADQVAIHEAMEQQTISIAKAGIHATLNAR 657

Query: 669 SSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLY 728
           +SILA+ANP+G RYN  L +  N+++  P++SRFDL +++LD  +EK D ELA H+ +L 
Sbjct: 658 TSILAAANPVGGRYNRKLTLRSNLNMSAPIMSRFDLFFVILDDCNEKIDTELASHIVDL- 716

Query: 729 LEDKPEHISQDDVLPVEF----LTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDS 784
                 H+ +D  +   F    L+ YI+YAK    P++T+ A+  LV+ Y  +RK  DD+
Sbjct: 717 ------HMKRDSAINPPFSAEQLSRYINYAKT-FKPVMTKEARDYLVKRYTELRK--DDA 767

Query: 785 RSDEK---RITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAI 833
           +   K   RI  T RQLES+IRL+EA A+    + +    V EA  L+R +I
Sbjct: 768 QGYSKSSYRI--TVRQLESLIRLSEAIARANCVDEIVPSFVAEAYDLLRQSI 817

>Scas_712.49
          Length = 1019

 Score =  328 bits (841), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 209/580 (36%), Positives = 306/580 (52%), Gaps = 54/580 (9%)

Query: 299 KFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAV 358
           + +++  +N+ +   +R++    I  L+++ G V R++ V P++  A F C++C   +  
Sbjct: 249 RIFQISFFNLPTVFRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDLCRAQVDN 308

Query: 359 EIDRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLC 418
                   EP  C    C      +L   R  F D Q +++QE  + +P G  P ++ + 
Sbjct: 309 VEQSFKYTEPTFCPNPSCENRAFWTLNVTRSKFLDWQKVRIQENANEIPSGSMPRTLDVI 368

Query: 419 VYDELVDSCRAGDRIEVTGTFRSIP-----------------IRANSRQ----------- 450
           +  + V+  + GDR + TGT   +P                  R  +R            
Sbjct: 369 LRGDCVERAKPGDRCKFTGTEIVVPDVTQLGLPGIKPTSSMDTRGIARSTEGLNNGVSGL 428

Query: 451 RVLKSLYKTYXXXXXXXXXXXXRLDVDTST---IEQELMQNKV--------DHNEVEEV- 498
           R L     TY              + D S+    E EL             D+ + +EV 
Sbjct: 429 RALGVRDLTYKISFLACHVISIGSNTDASSNGNTENELQLAATLHGSNVYQDYEKDQEVF 488

Query: 499 -RQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXXXXXXXXXXR 557
              +  +++ +++E+   E +Y  L RSIAP+++  E VKKGILLQ+            +
Sbjct: 489 LNSLNSEEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHKSTVEGIK 548

Query: 558 YRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLE 617
            RGDINI + GDPSTSKSQ L+YV    PR VYTSGK SSA GLTA + RD +     +E
Sbjct: 549 LRGDINICIVGDPSTSKSQFLKYVCGFVPRSVYTSGKASSAAGLTAAVVRDEEGGDYTIE 608

Query: 618 SGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANP 677
           +GAL+L+D G+CCIDEFDKM  S +  +HE MEQQTISIAKAGI  TLNAR+SILA+ANP
Sbjct: 609 AGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANP 668

Query: 678 IGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLE-DKPEHI 736
           IG RYN  L +  N+++  P++SRFDL +++LD  +EK D ELA H+ +L+++ D   H 
Sbjct: 669 IGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMKRDAAIH- 727

Query: 737 SQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSDEK---RITA 793
                   E L  YI YA+    PI+T+ A+  LV  Y  +RK  DD++   K   RI  
Sbjct: 728 ---SPFTAEQLRRYIRYART-FKPILTKEARQYLVEKYKDLRK--DDAQGYSKSSYRI-- 779

Query: 794 TTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAI 833
           T RQLESMIRL+EA A+    + +    + EA  L+R +I
Sbjct: 780 TVRQLESMIRLSEAIARANCVDEITPAFIAEAYDLLRQSI 819

>YBR202W (CDC47) [385] chr2 (625729..628266) Member of MCM/P1 family
           of proteins involved in DNA synthesis initiation [2538
           bp, 845 aa]
          Length = 845

 Score =  320 bits (821), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 207/560 (36%), Positives = 323/560 (57%), Gaps = 42/560 (7%)

Query: 314 MRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDRGVIQEPARCER 373
           +R++  + + +LI ++G++ R + V P ++V  + C+ C + +  E++       + C  
Sbjct: 227 VRQIKGDFLGQLITVRGIITRVSDVKPAVEVIAYTCDQCGYEVFQEVNSRTFTPLSECTS 286

Query: 374 IDC--NEPNSMSLIHNRCS-FADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAG 430
            +C  N+      +  R S F+  Q  K+QE    VP G  P S+++ V   LV S   G
Sbjct: 287 EECSQNQTKGQLFMSTRASKFSAFQECKIQELSQQVPVGHIPRSLNIHVNGTLVRSLSPG 346

Query: 431 DRIEVTGTFRSIPIRANSRQRVLKS--LYKTYXXXXXXXXXXXXRLDVDTSTIEQELMQN 488
           D ++VTG F   P       + LK+  L +TY                    +E + ++ 
Sbjct: 347 DIVDVTGIFLPAPYTGF---KALKAGLLTETY--------------------LEAQFVRQ 383

Query: 489 KVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXX 548
              H +      +T     ++ E+    D+Y+ LA+SIAP IY   DVKK +LL L    
Sbjct: 384 ---HKKKFASFSLTSDVEERVMELITSGDVYNRLAKSIAPEIYGNLDVKKALLLLLVGGV 440

Query: 549 XXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRD 608
                   + RGDIN+ L GDP  +KSQ+L+ + KI+PRGVYT+GKGSS VGLTA + +D
Sbjct: 441 DKRVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAAVMKD 500

Query: 609 VDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNAR 668
             T +++LE GALVL+D G+CCIDEFDKM +S R+ +HEVMEQQTISI+KA I T   AR
Sbjct: 501 PVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAVINTNPGAR 560

Query: 669 SSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLY 728
           +SILA+ANP+  R NP L   +NI+LP  LLSRFD+++L+LD     +D +LA+H+T ++
Sbjct: 561 TSILAAANPLYGRINPRLSPLDNINLPAALLSRFDILFLMLDIPSRDDDEKLAEHVTYVH 620

Query: 729 LEDKPEHISQDDVLPVEFLTM--YISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRS 786
           + +K   +   D  PVE   M  YI+YAK    P+++EA    +V+AY+ +R+  D  R 
Sbjct: 621 MHNKQPDL---DFTPVEPSKMREYIAYAKTK-RPVMSEAVNDYVVQAYIRLRQ--DSKRE 674

Query: 787 DEKRIT---ATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDPKTG 843
            + + +   AT R L  +IRL++A AK++L ++V+++DV+EA+RL+R + +    +    
Sbjct: 675 MDSKFSFGQATPRTLLGIIRLSQALAKLRLADMVDIDDVEEALRLVRVSKESLYQETNKS 734

Query: 844 KIDMNLVQTGKSVIQRKLQE 863
           K D +      ++I++ LQE
Sbjct: 735 KEDESPTTKIFTIIKKMLQE 754

>Kwal_47.18966
          Length = 1044

 Score =  324 bits (831), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 207/577 (35%), Positives = 309/577 (53%), Gaps = 50/577 (8%)

Query: 299 KFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAV 358
           + +++  +N+ +   +R++    I  L+++ G V R++ V P++  A F C +C   +  
Sbjct: 278 RIFQISFFNLPTVNRIRDIRAEKIGSLMSISGTVTRTSEVRPELYKASFTCEMCRAVVDN 337

Query: 359 EIDRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLC 418
                   +P  C    C      +L   R  F D Q +++QE  + +P G  P ++ + 
Sbjct: 338 VEQVFKYTQPTYCPNPSCENQAFWTLSVGRSKFLDWQKVRIQENANEIPTGSMPRTLDVV 397

Query: 419 VYDELVDSCRAGDRIEVTGTFRSIP---------------------IRA----NSRQRVL 453
           +  + V+  + GDR + TGT   +P                      R+    N+    L
Sbjct: 398 LRGDCVERAKPGDRCKFTGTEIVVPDITQLGLPGVKPSSTMDNRGIARSSEGLNTGVSGL 457

Query: 454 KSLYK---TYXXXXXXXXXXXXRLDVDTSTIEQE----LMQNKVDH--NEVEEVRQI--- 501
           KSL     TY              D + +   Q+    L+  +V++  N+ E  ++I   
Sbjct: 458 KSLGVRDLTYKISFLACHVTPTGKDANNNANAQDEGGDLLSMQVNNVGNDDERDQEIFLN 517

Query: 502 --TDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXXXXXXXXXXRYR 559
               Q++ +++E+   E +Y  L RSIAP+++    VKKGILLQ+              R
Sbjct: 518 SLNSQEINELKEMVKDEQIYDKLVRSIAPAVFGHNTVKKGILLQMLGGVHKTTVEGINLR 577

Query: 560 GDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESG 619
           GDINI + GDPSTSKSQ L+YV    PR VYTSGK SSA GLTA + +D +     +E+G
Sbjct: 578 GDINICIVGDPSTSKSQFLKYVCGFAPRAVYTSGKASSAAGLTAAVVKDEEAGDFTIEAG 637

Query: 620 ALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIG 679
           AL+L+D G+CCIDEFDKM  S +  +HE MEQQTISIAKAGI  TLNAR+SILA+ANP+G
Sbjct: 638 ALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPVG 697

Query: 680 SRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHISQD 739
            RYN  L +  N+++  P++SRFDL ++VLD  +EK D ELA H+ +L+++ + E I  D
Sbjct: 698 GRYNRKLTLRGNLNMTAPIMSRFDLFFVVLDDCNEKIDTELAAHIVDLHMK-RDEAI--D 754

Query: 740 DVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSDEK---RITATTR 796
                E L  YI YA+    P++ E A+  LV  Y  +R+  DD++   K   RI  T R
Sbjct: 755 PPFTAEQLRRYIKYART-FKPVMNEEARNYLVEKYKELRR--DDAQGFSKSSYRI--TVR 809

Query: 797 QLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAI 833
           QLESMIRL+E  A+    + +    V EA  L+R +I
Sbjct: 810 QLESMIRLSEGIARANCVDEITPNFVAEAYDLLRQSI 846

>YLR274W (CDC46) [3667] chr12 (691557..693884) Member of the MCM/P1
           family, component of the MCM complex that binds at ARS
           elements to initiate DNA replication [2328 bp, 775 aa]
          Length = 775

 Score =  317 bits (812), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 219/736 (29%), Positives = 364/736 (49%), Gaps = 94/736 (12%)

Query: 189 ECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSNLNLDARNL 248
           E   +F+NF++ F+                  D +  Y  QL     +   +L ++  +L
Sbjct: 26  EIIKSFKNFILEFRL-----------------DSQFIYRDQLRNNILVKNYSLTVNMEHL 68

Query: 249 LAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIV------DNNLDYD---------- 292
           + Y   ED+Y +L + P ++I + +  I      + +       NN D D          
Sbjct: 69  IGYN--EDIYKKLSDEPSDIIPLFETAITQVAKRISILSRAQSANNNDKDPENTSMDTDS 126

Query: 293 --LDEIETKFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCN 350
             L+ + T F  +   N      +R+L+   + K++ L G+++ ++ +          C 
Sbjct: 127 LLLNSLPT-FQLILNSNANQIP-LRDLDSEHVSKIVRLSGIIISTSVLSSRATYLSIMCR 184

Query: 351 VCDHTMAVEIDR------GVIQEPARC------ERIDCNE-------------PNSMSLI 385
            C HT ++ I+         +  P  C      E    NE             P+   +I
Sbjct: 185 NCRHTTSITINNFNSITGNTVSLPRSCLSTIESESSMANESNIGDESTKKNCGPDPYIII 244

Query: 386 HNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIPIR 445
           H    F D+Q +KLQE P+ VP G+ P ++++     L +    G R+ + G +      
Sbjct: 245 HESSKFIDQQFLKLQEIPELVPVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIY------ 298

Query: 446 ANSRQRVLKSLYKT---YXXXXXXXXXXXXRLDVDTSTIEQELMQNKVDHNEV-EEVRQI 501
                    S+Y +                 + + T  I+   +Q+ V+ + +   V   
Sbjct: 299 ---------SIYNSKNGAGSGRSGGGNGGSGVAIRTPYIKILGIQSDVETSSIWNSVTMF 349

Query: 502 TDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXXXXXXXXXXRYRGD 561
           T+++  +  +++    LY +L  SIAPSI+  ED+KK I+  L            R RGD
Sbjct: 350 TEEEEEEFLQLSRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGD 409

Query: 562 INILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGAL 621
           IN+LL GDP T+KSQ+L++V K++P  VYTSGKGSSA GLTA + RD  T++  LE GA+
Sbjct: 410 INVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAM 469

Query: 622 VLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSR 681
           VL+DGGV CIDEFDKM D  R  +HE MEQQTISIAKAGI T LN+R+S+LA+ANPI  R
Sbjct: 470 VLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGR 529

Query: 682 YNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHISQDD- 740
           Y+      +NID    +LSRFD++++V D  +E+ D  +A H+ N++  +     +Q + 
Sbjct: 530 YDDLKSPGDNIDFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQNQQEE 589

Query: 741 ---VLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRK---MGDDSRSDEKRITAT 794
               + +E +  YI+Y +    P ++  A  +L   +V +RK   + +   ++   I  T
Sbjct: 590 NGSEISIEKMKRYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPIT 649

Query: 795 TRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDPKTGKIDMNLVQTGK 854
            RQLE++IR+ E+ AK++L  + +   V EA+RL +++  D A+    G ++     +G 
Sbjct: 650 IRQLEAIIRITESLAKLELSPIAQERHVDEAIRLFQASTMDAASQDPIGGLNQ---ASGT 706

Query: 855 SVIQ-RKLQEDLSREI 869
           S+ + R+ +++L R +
Sbjct: 707 SLSEIRRFEQELKRRL 722

>Sklu_2098.4 YBR202W, Contig c2098 6426-8966 reverse complement
          Length = 846

 Score =  318 bits (816), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 214/580 (36%), Positives = 323/580 (55%), Gaps = 58/580 (10%)

Query: 314 MRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDRGVIQEPARCER 373
           +RE+    + +LI ++G++ R + V P + V  + C+ C   +  E++         C  
Sbjct: 223 VREIKGRYLGQLITVRGIITRVSDVKPAVLVNAYTCDQCGFEVFQEVNSRTFTPLIECTS 282

Query: 374 IDC--NEPNSMSLIHNRCS-FADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAG 430
             C  N+      +  R S F+  Q  K+QE    V  G  P ++++ V   LV S   G
Sbjct: 283 EQCSQNQTKGQLFMSTRASKFSAFQECKIQELSQQVRIGHIPRTLTIHVNGSLVRSITPG 342

Query: 431 DRIEVTGTFRSIPIRANSRQRVLKS--LYKTYXXXXXXXXXXXXRLDVDTSTIEQELMQN 488
           D ++VTG +   P       + LK+  L +TY                         MQ 
Sbjct: 343 DVVDVTGIYLPSPYTGF---KALKAGLLTETYLS-----------------------MQY 376

Query: 489 KVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXX 548
              H +     +IT +  + + E+A++ D+Y+ LA+SIAP IY   DVKK +LL L    
Sbjct: 377 VRQHKKKFASFEITPEVESNVMEIASQGDVYNRLAKSIAPEIYGHLDVKKALLLLLVGGV 436

Query: 549 XXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRD 608
                   + RGDINI L GDP  +KSQ+L+ + KI+PR VYT+GKGSS VGLTA + RD
Sbjct: 437 DKKVGDGMKIRGDINICLMGDPGVAKSQLLKTICKISPRSVYTTGKGSSGVGLTAAVMRD 496

Query: 609 VDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNAR 668
             T ++VLE GALVL+D G+CCIDEFDKM +  R+ +HEVMEQQTISI+KAGI TTLNAR
Sbjct: 497 PVTDEMVLEGGALVLADNGICCIDEFDKMDEGDRTAIHEVMEQQTISISKAGINTTLNAR 556

Query: 669 SSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLY 728
           +SILA+ANP+  RYNP L   +NI+LP  LLSRFD+++L+LD  + ++D +LA+H+  ++
Sbjct: 557 ASILAAANPLYGRYNPRLSPLDNINLPAALLSRFDVMFLMLDTPNREDDEKLAEHVAYVH 616

Query: 729 LEDKPEHISQDDVLPVEFLTM--YISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRS 786
           + +K   +   D  P+E   M  +I++AK    P + +     LV++Y+ MR+  D  R 
Sbjct: 617 MHNKHPTL---DFTPIEPSRMREFIAFAKTK-RPTMGQEVNEYLVQSYIRMRQ--DSKRE 670

Query: 787 DEKRIT---ATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDPKTG 843
            + + +   AT R L  +IRL++A AK++  + VE +DV+EA+RLI+ + +         
Sbjct: 671 MDSKFSFGQATPRTLLGVIRLSQALAKLRFSDSVEADDVEEALRLIQVSKE--------- 721

Query: 844 KIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMSF 883
               +L Q G    +RK  E+ + +I  ++K  A D   F
Sbjct: 722 ----SLYQDGN---KRKNDENPTTKIYTIIKKMAMDESQF 754

>AFR546W [3738] [Homologous to ScYGL201C (MCM6) - SH]
           complement(1415577..1418594) [3018 bp, 1005 aa]
          Length = 1005

 Score =  321 bits (822), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 202/579 (34%), Positives = 303/579 (52%), Gaps = 53/579 (9%)

Query: 299 KFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAV 358
           + +++  +N+     +R++    +  L+ + G V R++ V P++  A F C++C   +  
Sbjct: 267 RIFQISFFNIPVTNRIRDIRAEKVGTLMTISGTVTRTSEVRPELFKASFTCDMCRAVVDN 326

Query: 359 EIDRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLC 418
                   EP  C    C      +L   R  F D Q +++QE  + +P G  P ++ + 
Sbjct: 327 VEQVFKFTEPTFCPNPSCENQAFWTLNIGRSRFLDWQRVRIQENSNEIPTGSMPRTLDVI 386

Query: 419 VYDELVDSCRAGDRIEVTGTFRSIP-----------------IRA--------NSRQRVL 453
           +  + V+  + GDR   TGT   +P                  R         NS    L
Sbjct: 387 LRGDCVERAKPGDRCRFTGTEIVMPDVTQLGLAGMKPSSAPDTRGISRTMEGLNSGVSGL 446

Query: 454 KSL------YKTYXXX---XXXXXXXXXRLDVDTSTIEQELMQN---KVDHNEVEE---V 498
           K+L      YK                 + DV +  ++  ++Q+    +D  E ++   +
Sbjct: 447 KTLGVRDLTYKIAFLACHVMGVGNNSNPQGDVLSHELDVNMLQHLNKGIDDTERDQELFL 506

Query: 499 RQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXXXXXXXXXXRY 558
             ++  ++ +++E+   E +Y  L +SIAP+++  E VKKG+LLQ+            + 
Sbjct: 507 NSLSSDEINELKEMVKDERIYDKLVQSIAPAVFGHETVKKGLLLQMLGGVHKTTVEGIKL 566

Query: 559 RGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLES 618
           RGDINI + GDPSTSKSQ L+YV    PR VYTSGK SSA GLTA + +D +     +E+
Sbjct: 567 RGDINICIVGDPSTSKSQFLKYVCAFVPRAVYTSGKASSAAGLTAAVVKDEEGGDFTIEA 626

Query: 619 GALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPI 678
           GAL+L+D G+CCIDEFDKM  S +  +HE MEQQTISIAKAGI  TLNAR+SILA+ANP+
Sbjct: 627 GALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPV 686

Query: 679 GSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHISQ 738
           G RYN  L +  N+++  P++SRFDL +++LD  ++K D ELA H+ NL       H+  
Sbjct: 687 GGRYNRKLTLRGNLNMTAPIMSRFDLFFVILDDCNQKVDTELASHIVNL-------HMKC 739

Query: 739 DDVLPVEF----LTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSDEKRITAT 794
           DD +   F    L  YI YA+    PI+TE A+  LV  Y  +RK  D     +     T
Sbjct: 740 DDAIDPPFTMDQLRRYIKYART-FKPILTEDARQFLVEKYKELRK-NDIQGYSKSSYRIT 797

Query: 795 TRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAI 833
            RQLESMIRL+EA A+    + +    V EA  L+R +I
Sbjct: 798 VRQLESMIRLSEAIARANCVDEITPAFVAEAYDLLRQSI 836

>Scas_710.21
          Length = 874

 Score =  310 bits (794), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 209/675 (30%), Positives = 337/675 (49%), Gaps = 77/675 (11%)

Query: 206 RKILDEREEFINNTTDE--ELYYIKQLNEMRELGTSNLNLDARNLLAYKQTEDLYHQLLN 263
           R I  E + F+   TDE     Y  ++  + E+   +L ++ R+L   K    L+  L  
Sbjct: 207 RTIARELKSFLLEYTDETGRSVYGARIRTLGEMNAESLEVNYRHLAESKAILALF--LAK 264

Query: 264 YPQEVISIMDQTIKDCMVSLIVDNNLDY-DLDEIETKFYKVRPYNVGSCKGMRELNPNDI 322
            P+E++ I D    +          L Y D   I ++ + VR  +  +   +REL  +++
Sbjct: 265 CPEEMLKIFDLVAMEA-------TELHYPDYARIHSEIH-VRISDFPTIHSLRELRESNL 316

Query: 323 DKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEI-DRGVIQEPARCERIDCNEPNS 381
             L+ + G+V R T V P +K   F C  C   +     D     + + C  ++C     
Sbjct: 317 SSLVRVTGVVTRRTGVFPQLKYVKFNCIKCGTILGPFFQDSNEEIKISYC--VNCKSKGP 374

Query: 382 MSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRS 441
            ++   +  + + Q I LQE+P  VP G+ P    + +  +LVD  + G+ +EVTG +++
Sbjct: 375 FTVNGEKTVYRNYQRITLQESPGTVPAGRLPRHREVILLADLVDVSKPGEEVEVTGIYKN 434

Query: 442 IPIRANSRQRVLKSLYKTYXXXXXXXXXXXXRLDVDTSTIEQELMQNKVDHNEVEEVRQI 501
                N   +    ++ T                ++ +++++    +  +  E  +V   
Sbjct: 435 -NYDGNLNAKNGFPVFATI---------------LEANSVKRREGNSANEGEEGLDVFGW 478

Query: 502 TDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXXXXXXXXXXRYRGD 561
           T+++  + R+++    +   +  S+APSIY   D+K  +   L              RGD
Sbjct: 479 TEEEEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGD 538

Query: 562 INILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGAL 621
           IN+LL GDP T+KSQIL+YV K   R V+ +G+G+SAVGLTA + +D  TK+  LE GAL
Sbjct: 539 INVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGAL 598

Query: 622 VLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSR 681
           VL+D GVC IDEFDKM+D  R+ +HE MEQQ+ISI+KAGI+TTL AR SI+A+ANP G R
Sbjct: 599 VLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGR 658

Query: 682 YNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHI----- 736
           YN  +P+ +N+ L  P+LSRFD++ +V D VDE+ D  LA  + + +L   PE+I     
Sbjct: 659 YNSTIPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHLRSHPENIDGNLT 718

Query: 737 --------------SQDDV----------------------LPVEFLTMYISYAKEHIHP 760
                         ++D V                      +P E L  YI YA+  IHP
Sbjct: 719 GEGQPDGDENMDGNNEDGVEPLSARQRRLQSQKKKEEEISPIPQELLMKYIHYARTKIHP 778

Query: 761 IITEAAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELE 820
            + +    ++ R Y  +R+    + S       T R LES++R+AE+ AKM+L   V   
Sbjct: 779 KLHQMDMDKVSRVYADLRRESISTGS----FPITVRHLESILRIAESFAKMRLSEFVSSW 834

Query: 821 DVQEAVRLIRSAIKD 835
           D+  A++++  +  D
Sbjct: 835 DLDRAIKVVVDSFVD 849

>CAGL0J04444g 417656..420295 highly similar to sp|P29469
           Saccharomyces cerevisiae YBL023c MCM2, start by
           similarity
          Length = 879

 Score =  305 bits (782), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 212/673 (31%), Positives = 335/673 (49%), Gaps = 80/673 (11%)

Query: 206 RKILDEREEFINNTTDE--ELYYIKQLNEMRELGTSNLNLDARNLLAYKQTEDLYHQLLN 263
           R I  E + F+   TDE     Y  ++  + E+ + +L ++ R+L   K    L+  L  
Sbjct: 222 RTIARELKSFLLEYTDETGRSVYGARIRVLGEMNSESLEVNFRHLAESKAILALF--LAK 279

Query: 264 YPQEVISIMDQTIKDCMVSLIVDNNLDY-DLDEIETKFYKVRPYNVGSCKGMRELNPNDI 322
            P+E++ I D    +          L Y D   I ++ + VR  +  +   +REL  +++
Sbjct: 280 CPEEMLKIFDLVAMEA-------TELHYPDYSRIHSEIH-VRISDFPTIHNLRELRQSNL 331

Query: 323 DKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEI-DRGVIQEPARCERIDCNEPNS 381
             L+ + G+V R T V P +K   F C  C   +     D     + + C   +C     
Sbjct: 332 STLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIKISFC--TNCKSKGP 389

Query: 382 MSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRS 441
            S+   +  + + Q I LQE P  VP G+ P    + +  +LVD  + G+ IEVTG ++ 
Sbjct: 390 FSINGEKTVYRNYQRITLQEAPGTVPAGRLPRHREVILLADLVDVSKPGEEIEVTGIYK- 448

Query: 442 IPIRANSRQRVLKSLYKTYXXXXXXXXXXXXRLDVDTSTIEQELMQNKVDH--NEVEE-- 497
                N+    L +                    V  + IE   ++ +  +  NE EE  
Sbjct: 449 -----NNYDGNLNA---------------KNGFPVFATIIEANAVRRREGNLANENEEGL 488

Query: 498 -VRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXXXXXXXXXX 556
            V   T+++  + R+++    +   +  S+APSIY  +D+K  +   L            
Sbjct: 489 NVFSWTEEEEREFRKLSKDRGIVDKIIASMAPSIYGHKDIKTAVACSLFSGVPKNINGKH 548

Query: 557 RYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVL 616
             RGDIN+L+ GDP T+KSQIL+YV K   R V+ +G+G+SAVGLTA + +D  TK+  L
Sbjct: 549 AIRGDINVLVLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTL 608

Query: 617 ESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASAN 676
           E GALVL+D GVC IDEFDKM+D  R+ +HE MEQQ+ISI+KAGI+TTL AR SI+A+AN
Sbjct: 609 EGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAAN 668

Query: 677 PIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHI 736
           P G RYN  LP+++N+ L  P+LSRFD++ +V D VDE++D  LA  + + ++   P + 
Sbjct: 669 PNGGRYNSTLPLSQNVSLTEPILSRFDILCVVRDVVDEESDERLASFVVDSHVRSHPGYD 728

Query: 737 SQDD----------------------------------VLPVEFLTMYISYAKEHIHPII 762
           S DD                                   +P E L  YI YA+  ++P +
Sbjct: 729 SIDDEEGKDGEQKNDDDIQLSNRQKRAERQRKKEEEISPIPQELLIKYIHYARTKVYPRL 788

Query: 763 TEAAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDV 822
            +    ++ + Y  +R+    + S       T R LES++R+AE+ AKM+L   V   D+
Sbjct: 789 HQMDMDKVSKVYADLRRESITTGS----FPITVRHLESILRIAESFAKMRLSEFVSSWDL 844

Query: 823 QEAVRLIRSAIKD 835
             A++++  +  D
Sbjct: 845 DRAIKVVVDSFVD 857

>KLLA0F12584g complement(1165710..1168343) similar to sp|P29469
           Saccharomyces cerevisiae YBL023c MCM2 member of the
           MCM2P, MCM3P, CDC46P family, start by similarity
          Length = 877

 Score =  304 bits (778), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 206/665 (30%), Positives = 329/665 (49%), Gaps = 73/665 (10%)

Query: 206 RKILDEREEFINNTTDE--ELYYIKQLNEMRELGTSNLNLDARNLLAYKQTEDLYHQLLN 263
           R I  E + F+   TDE  +  Y  ++  + E+ + +L ++ R+L+  K    L+  L  
Sbjct: 215 RTIARELKSFLLEYTDESGKSVYGARIRTLGEMNSESLEVNYRHLVESKAILALF--LAK 272

Query: 264 YPQEVISIMDQTIKDCMVSLIVDNNLDY-DLDEIETKFYKVRPYNVGSCKGMRELNPNDI 322
            P+E++ I D    +          L Y D   I ++ + VR  +  S   +R L    +
Sbjct: 273 SPEEMLKIFDTVAMEA-------TQLHYPDYTRIHSEIH-VRISDFPSILNLRALRETHL 324

Query: 323 DKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEI-DRGVIQEPARCERIDCNEPNS 381
           + L+ + G+V R T V P +K   F C  C  T+     D     + + C   +C     
Sbjct: 325 NSLVRVSGVVTRRTGVFPQLKYVKFNCLKCGATLGPYYQDSNEEIKISFC--TNCRSKGP 382

Query: 382 MSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRS 441
             +   +  + + Q I +QE+P  VP G+ P    + +  +LVD  + G+ +EVTG +  
Sbjct: 383 FRINMEKTLYRNYQRITIQESPGSVPAGRLPRHREVILLWDLVDIAKPGEEVEVTGIY-- 440

Query: 442 IPIRANSRQRVLKSLYKTYXXXXXXXXXXXXRLDVDTSTIEQELMQNKVDHNEVEEVRQI 501
                       K+ Y                L+ ++    +  + +  +H  ++     
Sbjct: 441 ------------KNTYDGNLNAKNGFPVFATVLEANSVKRREGGLHDGDEHEGLDAFSWT 488

Query: 502 TDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXXXXXXXXXXRYRGD 561
            D++  + R+++    +   +  S+APSIY   D+K  I   L              RGD
Sbjct: 489 EDEE-REFRKMSRDRGIIDKIISSMAPSIYGHRDIKTAIACSLFGGVPKNINGKHSIRGD 547

Query: 562 INILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGAL 621
           INILL GDP T+KSQIL+YV K   R V+ +G+G+SAVGLTA + +D  TK+  LE GAL
Sbjct: 548 INILLLGDPGTAKSQILKYVEKTANRAVFATGQGASAVGLTASVRKDQITKEWTLEGGAL 607

Query: 622 VLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSR 681
           VL+D GVC IDEFDKM+D  R+ +HE MEQQ+ISI+KAGI+TTL AR SILA+ANPIG R
Sbjct: 608 VLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSILAAANPIGGR 667

Query: 682 YNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHIS---- 737
           YN  LP+++N++L  P+LSRFD++ +V D VDE++D  LA  + + ++   P+       
Sbjct: 668 YNSTLPLSQNVNLTEPILSRFDILCVVRDLVDEESDNRLASFVVDSHIRSHPDKDLDDFD 727

Query: 738 --------------------------------QDDVLPV--EFLTMYISYAKEHIHPIIT 763
                                           ++++ P+    L  YI YA+  ++P + 
Sbjct: 728 DGNVPTENPNGEGDEETPLSAKQRRLQNLRKREEEISPISQHMLMKYIHYARTKVYPKLH 787

Query: 764 EAAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQ 823
           +    ++ R Y  +R+    + S       T R LES++R+AEA AKM+L   V   D+ 
Sbjct: 788 QMDMDKVSRVYADLRRESVTTGS----FPITVRHLESILRIAEAFAKMRLSEFVSSWDLD 843

Query: 824 EAVRL 828
            A+++
Sbjct: 844 RAIKV 848

>YBL023C (MCM2) [172] chr2 complement(174885..177491) Member of the
           MCM/P1 family that acts as a complex at ARS sequences to
           initiate DNA replication [2607 bp, 868 aa]
          Length = 868

 Score =  303 bits (777), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 207/678 (30%), Positives = 333/678 (49%), Gaps = 83/678 (12%)

Query: 206 RKILDEREEFINNTTDE--ELYYIKQLNEMRELGTSNLNLDARNLLAYKQTEDLYHQLLN 263
           R I  E + F+   TDE     Y  ++  + E+ + +L ++ R+L   K    L+  L  
Sbjct: 205 RTIARELKSFLLEYTDETGRSVYGARIRTLGEMNSESLEVNYRHLAESKAILALF--LAK 262

Query: 264 YPQEVISIMDQTIKDCMVSLIVDNNLDY-DLDEIETKFYKVRPYNVGSCKGMRELNPNDI 322
            P+E++ I D    +          L Y D   I ++ + VR  +  +   +REL  +++
Sbjct: 263 CPEEMLKIFDLVAMEA-------TELHYPDYARIHSEIH-VRISDFPTIYSLRELRESNL 314

Query: 323 DKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDRGVIQEPARCERI----DCNE 378
             L+ + G+V R T V P +K   F C  C   +         Q+     RI    +C  
Sbjct: 315 SSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILG-----PFFQDSNEEIRISFCTNCKS 369

Query: 379 PNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGT 438
                +   +  + + Q + LQE P  VP G+ P    + +  +LVD  + G+ +EVTG 
Sbjct: 370 KGPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKPGEEVEVTGI 429

Query: 439 FRSIPIRANSRQRVLKSLYKTYXXXXXXXXXXXXRLDVDTSTIEQELMQNKVDHNEVEEV 498
           +++     N   +    ++ T                ++ ++I++       +  E  +V
Sbjct: 430 YKN-NYDGNLNAKNGFPVFATI---------------IEANSIKRREGNTANEGEEGLDV 473

Query: 499 RQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXXXXXXXXXXRY 558
              T+++  + R+++    +   +  S+APSIY   D+K  +   L              
Sbjct: 474 FSWTEEEEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSI 533

Query: 559 RGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLES 618
           RGDIN+LL GDP T+KSQIL+YV K   R V+ +G+G+SAVGLTA + +D  TK+  LE 
Sbjct: 534 RGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEG 593

Query: 619 GALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPI 678
           GALVL+D GVC IDEFDKM+D  R+ +HE MEQQ+ISI+KAGI+TTL AR SI+A+ANP 
Sbjct: 594 GALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPN 653

Query: 679 GSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEH--- 735
           G RYN  LP+ +N+ L  P+LSRFD++ +V D VDE+ D  LA  + + ++   PE+   
Sbjct: 654 GGRYNSTLPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDED 713

Query: 736 ---------------ISQDDV-----------------------LPVEFLTMYISYAKEH 757
                            +D++                       +P E L  YI YA+  
Sbjct: 714 REGEELKNNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTK 773

Query: 758 IHPIITEAAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVV 817
           I+P + +    ++ R Y  +R+    + S       T R LES++R+AE+ AKM+L   V
Sbjct: 774 IYPKLHQMDMDKVSRVYADLRRESISTGS----FPITVRHLESILRIAESFAKMRLSEFV 829

Query: 818 ELEDVQEAVRLIRSAIKD 835
              D+  A++++  +  D
Sbjct: 830 SSYDLDRAIKVVVDSFVD 847

>Sklu_1863.1 YEL032W, Contig c1863 2885-5749
          Length = 954

 Score =  304 bits (779), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 200/592 (33%), Positives = 307/592 (51%), Gaps = 100/592 (16%)

Query: 315 RELNPNDIDKLINLKGLVLRSTPVIPDM--------KVAFFKCNVCDHTMAVEIDRGVIQ 366
           R LN + ++KLI+++G+V +++ V P +        K   F     D+  A       I 
Sbjct: 143 RTLNSHHLNKLISIEGIVTKTSLVRPKLIRSVHYADKTGRFHYR--DYRDATTTLTTQIP 200

Query: 367 EPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDS 426
            PA     D  E N ++  +   ++ D Q I +QE P+  P GQ P SI + + ++LVD 
Sbjct: 201 TPAIYPTEDP-EGNKLTTEYGYSTYIDHQRITVQEMPEKAPPGQLPRSIDVILDEDLVDK 259

Query: 427 CRAGDRIEVTGTFRSIPI-----RANSRQRVLKSLYKTYXXXXXXXXXXXXRLDVDTSTI 481
            + GDRI + G ++S+        A   Q    S ++T                     +
Sbjct: 260 TKPGDRINIVGVYKSMGAGGLNGAATKEQSNALSGFRTL-------------------IL 300

Query: 482 EQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGIL 541
              +         V   + ++D D+  I +++ + D++ ++++S+APSIY  E +KK IL
Sbjct: 301 GNTVYPLHARSTGVSAKQNLSDSDIRNINKLSKKSDIFEMMSQSLAPSIYGHEQIKKAIL 360

Query: 542 LQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGL 601
           L L              RGDIN+L+ GDPST+KSQ+L++V       + T+G+GSS VGL
Sbjct: 361 LMLLGGVEKNLENGSHLRGDINLLMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGL 420

Query: 602 TAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGI 661
           TA +T D +T +  LE+GA+VL+D G+ CIDEFDKMSD  R  +HEVMEQQT++IAKAGI
Sbjct: 421 TAAVTMDKETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGI 480

Query: 662 ITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELA 721
            TTLNAR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D ++E  DR ++
Sbjct: 481 HTTLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRAIS 540

Query: 722 KH-------LTNLYLEDKPEH--------ISQDDV------------------------- 741
           +H       L   YLE +P          +  DD+                         
Sbjct: 541 EHVLRTHRYLPPGYLEGEPIREAINLSLAVGDDDIEQMQDDEDDDEEGGKVFEKFNPLLH 600

Query: 742 ----------------LP----VEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMG 781
                           +P    + FL  Y+ YAKE I P++T+ A   +V+ Y  +R   
Sbjct: 601 AGAKLAKNRGNHHGSEIPQIVCIPFLRKYVQYAKERIAPVLTQEAIDVIVKTYSDLR--- 657

Query: 782 DDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAI 833
           +DS + +  ITA  R LE++IRL+ AHAK++L  +VE +D + A  L+R A+
Sbjct: 658 NDSNTKKSPITA--RTLETLIRLSSAHAKVRLSKIVERQDSRVAANLLRFAL 707

>AFR178W [3370] [Homologous to ScYBL023C (MCM2) - SH]
           complement(763632..766289) [2658 bp, 885 aa]
          Length = 885

 Score =  301 bits (772), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 209/664 (31%), Positives = 332/664 (50%), Gaps = 73/664 (10%)

Query: 206 RKILDEREEFINNTTDE--ELYYIKQLNEMRELGTSNLNLDARNLLAYKQTEDLYHQLLN 263
           R I  E + F+   TDE  +  Y  ++  + EL + +L ++ R+L   K    L+  L  
Sbjct: 224 RTIARELKSFLLEYTDEYGKSVYGARIRTLGELNSESLEVNYRHLAESKAILALF--LAR 281

Query: 264 YPQEVISIMDQTIKDCMVSLIVDNNLDY-DLDEIETKFYKVRPYNVGSCKGMRELNPNDI 322
            P+E++ I D    +          L Y +   I ++ + VR  +  +   +REL   ++
Sbjct: 282 CPEEMLKIFDTVAMEA-------TQLHYPEYTRIHSEIH-VRISDFPTIHNLRELREANL 333

Query: 323 DKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEI-DRGVIQEPARCERIDCNEPNS 381
           + L+ + G+V R T V P +K   F C  C   +     D     + + C   +C     
Sbjct: 334 NSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPYYQDSNEEIKISFC--TNCRSKGP 391

Query: 382 MSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRS 441
                 +  + + Q + LQE+P  VP G+ P    + +  +LVD  + G+ +EVTG +++
Sbjct: 392 FRTNMEKTLYRNYQRLTLQESPGTVPAGRLPRHREVILLWDLVDVAKPGEEVEVTGIYKN 451

Query: 442 IPIRANSRQRVLKSLYKTYXXXXXXXXXXXXRLDVDTSTI---EQELMQNKVDHNEVEEV 498
                N   R    ++ T                ++ ++I   E  L       +E  +V
Sbjct: 452 T-YDGNLNARNGFPVFATV---------------LEANSIKRREGGLHSGDDAGDEGLDV 495

Query: 499 RQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXXXXXXXXXXRY 558
              T+++  + R+++    +   +  SIAPSIY   D+K  +   L              
Sbjct: 496 FGWTEEEEREFRKMSRDRGIIDKIISSIAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSI 555

Query: 559 RGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLES 618
           RGDIN+LL GDP T+KSQIL+YV K   R V+ +G+G+SAVGLTA + +D  TK+  LE 
Sbjct: 556 RGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEG 615

Query: 619 GALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPI 678
           GALVL+D GVC IDEFDKM+D  R+ +HE MEQQ+ISI+KAGI+TTL AR SI+A+ANP 
Sbjct: 616 GALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPN 675

Query: 679 GSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEH-IS 737
           G RYN  LP+++N+DL  P+LSRFD++ +V D VDE++D  LA  + + ++   PE  I 
Sbjct: 676 GGRYNSTLPLSQNVDLTEPILSRFDILCVVRDLVDEESDERLATFVVDSHIRSHPESDIH 735

Query: 738 QDDV---------------------------------LPVEFLTMYISYAKEHIHPIITE 764
           Q+                                   +P E L  YI YA+  ++P + +
Sbjct: 736 QEPADEDMEEADAGTAALSNRQKKLKRHRDKEGEISPIPQEVLMKYIHYARTKVNPKLHQ 795

Query: 765 AAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQE 824
               ++ + Y  +R+    + S       T R LES++R+AE+ AKM+L   V   D+  
Sbjct: 796 MDMGKVSKVYADLRRESITTGS----FPITVRHLESILRIAESFAKMRLSEFVSSWDLDR 851

Query: 825 AVRL 828
           A+++
Sbjct: 852 AIKV 855

>Kwal_14.2090
          Length = 860

 Score =  299 bits (766), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 209/664 (31%), Positives = 325/664 (48%), Gaps = 72/664 (10%)

Query: 206 RKILDEREEFINNTTDE--ELYYIKQLNEMRELGTSNLNLDARNLLAYKQTEDLYHQLLN 263
           R I  E + F+   TDE     Y  ++  + EL + +L ++ R+L   K    L+  L  
Sbjct: 195 RTIARELKSFLLEYTDEWGRSVYGARIRTLGELNSESLEVNYRHLAESKAILALF--LAK 252

Query: 264 YPQEVISIMDQTIKDCMVSLIVDNNLDY-DLDEIETKFYKVRPYNVGSCKGMRELNPNDI 322
            P+E++ I D    D          L Y D   I  + + VR  +  +   +REL  +++
Sbjct: 253 CPEEMLKIFDIVAMDA-------TQLHYPDYARIHAEIH-VRISDFPTVLNLRELRESNL 304

Query: 323 DKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEI-DRGVIQEPARCERIDCNEPNS 381
           + L+ + G+V R T V P +K   F C  C   +     D     + + C   +C     
Sbjct: 305 NSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGAVLGPYFQDSNEEIKISFC--TNCRSKGP 362

Query: 382 MSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRS 441
                 +  + + Q + LQE P  VP G+ P    + +  +LVD  + G+ IEVTG +++
Sbjct: 363 FRTNAEKTLYRNYQRLTLQEAPGTVPAGRLPRHREVILLWDLVDIAKPGEEIEVTGIYKN 422

Query: 442 IPIRANSRQRVLKSLYKTYXXXXXXXXXXXXRLDVDTSTIEQELMQNKVDHNEVEEVRQI 501
                N   R    ++ T                   +   +E  +   D  E  +V   
Sbjct: 423 T-YDGNLNARNGFPVFATIIEA--------------NAVRRREGGRRSGDDEEGLDVFGW 467

Query: 502 TDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXXXXXXXXXXRYRGD 561
           T+++  + R+++    +   +  SIAPSIY  +D+K  +   L              RGD
Sbjct: 468 TEEEEREFRKLSRDRGIIDKVISSIAPSIYGHKDIKTAVACALFSGVPKNVNGKHSIRGD 527

Query: 562 INILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGAL 621
           IN+LL GDP T+KSQIL+YV K   R V+ +G+G+SAVGLTA + +D  T++  LE GAL
Sbjct: 528 INVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITREWTLEGGAL 587

Query: 622 VLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSR 681
           VL+D GVC IDEFDKM+D  R+ +HE MEQQ ISI+KAGI+T+L AR SI+A+ANP G R
Sbjct: 588 VLADKGVCLIDEFDKMNDQDRTSIHEAMEQQNISISKAGIVTSLQARCSIIAAANPNGGR 647

Query: 682 YNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEH------ 735
           YN  LP+ +N+DL  P+LSRFD++ +V D VDE  D  LA+ + + +L   P H      
Sbjct: 648 YNSALPLAQNVDLTEPILSRFDILCVVRDLVDEVKDERLARFVVDSHLRSHPLHDRLDDG 707

Query: 736 ---------ISQD----------------------DVLPVEFLTMYISYAKEHIHPIITE 764
                    +++D                        +P E L  YI YA+  + P + +
Sbjct: 708 DDDDGDNDAMNEDANEPLSARQRRQQKDREREEEISPIPQETLMKYIQYARTRVFPKLHQ 767

Query: 765 AAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQE 824
               ++ R Y  +R+    + S       T R LES++R++E+ AKM+L   V   D+  
Sbjct: 768 MDMDKVSRVYADLRRESITTGS----FPITVRHLESILRISESFAKMRLSEFVSSWDLDR 823

Query: 825 AVRL 828
           A+++
Sbjct: 824 AIKV 827

>KLLA0E22330g 1981275..1984070 similar to sp|P24279 Saccharomyces
           cerevisiae YEL032w MCM3 replication initiation protein,
           start by similarity
          Length = 931

 Score =  296 bits (758), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 203/587 (34%), Positives = 301/587 (51%), Gaps = 93/587 (15%)

Query: 315 RELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTM------AVEIDRGVIQEP 368
           R LN   ++KLI+++G+V R++ V P +  +        H        A       +  P
Sbjct: 148 RTLNSTHLNKLISVEGIVTRTSLVRPKLLRSVHYAQTTGHHHYRDYRDATTTLTTSVPTP 207

Query: 369 ARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCR 428
           A     D  E N +   +  C + D Q I +QE P+  P GQ P SI + + D+LVD  +
Sbjct: 208 AIYPEED-QEGNKLVTEYGFCHYMDHQRITVQEMPEKAPPGQLPRSIDVILDDDLVDKTK 266

Query: 429 AGDRIEVTGTFRSIPIRA-------NSRQRVLKSLYKTYXXXXXXXXXXXXRLDVDTSTI 481
            GDRI + G ++S+           N +     S ++T                     I
Sbjct: 267 PGDRINIVGVYKSLGAGGLTGGSNNNDKGNGALSGFRTV-------------------VI 307

Query: 482 EQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGIL 541
              +         V  V  ++D D+  I +++  ++++  L++S+APSIY  E +KK IL
Sbjct: 308 GNTVYPLHARSTGVSAVETLSDNDIRNINKLSMHDNIFDTLSQSLAPSIYGHEHIKKAIL 367

Query: 542 LQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGL 601
           L L              RGDINIL+ GDPST+KSQ+L++V       + T+G+GSS VGL
Sbjct: 368 LMLMGGVEKNLPNGSHLRGDINILMVGDPSTAKSQMLRFVLNTAALAIATTGRGSSGVGL 427

Query: 602 TAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGI 661
           TA +T D +T +  LE+GA+VL+D G+ CIDEFDKMSD  R  +HEVMEQQT++IAKAGI
Sbjct: 428 TAAVTTDKETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGI 487

Query: 662 ITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELA 721
            TTLNAR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D +++  DR ++
Sbjct: 488 HTTLNARCSVIAAANPVFGQYDVNKDPHKNIALPDSLLSRFDLLFVVTDDINDIRDRAIS 547

Query: 722 KH-------LTNLYLEDKP--EHI------------------------------------ 736
           +H       L   YLE +P  E I                                    
Sbjct: 548 EHVLRTHRYLPPGYLEGEPVREQINLSLAVGEDIENEEEDDDEDVVFEKFNPLLHAGAKL 607

Query: 737 ------SQDDVLP----VEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRS 786
                 S    LP    + F+  YI YAKE I P +T+ A   ++++Y  +R   +D  +
Sbjct: 608 AKNRGDSNGSELPQIVAIPFIRKYIQYAKERIIPQLTQEAVDVIIKSYSNLR---NDQNT 664

Query: 787 DEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAI 833
            +  ITA  R LE++IRL+ AHAK++L   VELED + A +L+R A+
Sbjct: 665 KKSPITA--RTLETLIRLSSAHAKVRLSKKVELEDAKVATQLLRFAL 709

>Kwal_27.10174
          Length = 945

 Score =  293 bits (750), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 205/649 (31%), Positives = 317/649 (48%), Gaps = 98/649 (15%)

Query: 257 LYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETKFYKVRPYNVGSCKGMRE 316
            +  +LN P + +   ++ + D  ++L    + +      ++     R          R 
Sbjct: 79  FWTGILNMPAQYVPAAERALGDTAMTLEETRSGNTVSPGSQSWKLSFRGSFGAHALSPRT 138

Query: 317 LNPNDIDKLINLKGLVLRSTPVIPDM--------KVAFFKCNVCDHTMAVEIDRGVIQEP 368
           LN + ++KL++++G+V + + V P +        K   F     D+  A       I  P
Sbjct: 139 LNSHYLNKLLSIEGIVTKVSLVRPKLLRSVHYAEKTGRFHYR--DYRDATTTLITQIPTP 196

Query: 369 ARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCR 428
           A     D  E N ++  +   ++ D Q I +QE P+  P GQ P SI + + ++LVD  +
Sbjct: 197 AIYPTEDP-EGNKLTTEYGYSTYIDHQRITVQEMPEKAPPGQLPRSIDVIMDEDLVDKTK 255

Query: 429 AGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYXXXXXXXXXXXXRLDVDTSTIEQELMQN 488
            GDRI + G                  +YK+                   S     ++ N
Sbjct: 256 PGDRINIVG------------------IYKSLGGGGLSSSGSSNDQGSSLSGFRTMVLAN 297

Query: 489 -----KVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQ 543
                      V   + +TD D+  I +++ ++D++ LL++S+APSIY  + +KK ILL 
Sbjct: 298 TAYPLHARSTGVAARQALTDSDIRNINKLSKKDDIFDLLSQSLAPSIYGHDHIKKAILLM 357

Query: 544 LXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTA 603
           L              RGDIN+L+ GDPST+KSQ+L++V       + T+G+GSS VGLTA
Sbjct: 358 LMGGVEKNLENGSHLRGDINLLMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTA 417

Query: 604 YITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIIT 663
            +T D +T +  LE+GA+VL+D G+ CIDEFDKMSD  R  +HEVMEQQT++IAKAGI T
Sbjct: 418 AVTMDKETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGIHT 477

Query: 664 TLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKH 723
           TLNAR S++A+ANP+  +Y+ N     NI LP  LLSRFDL+++V D ++E  DR +++H
Sbjct: 478 TLNARCSVIAAANPVFGQYDLNKDPHYNIALPDSLLSRFDLLFVVTDDINENTDRAISEH 537

Query: 724 -------LTNLYLEDKP--EHIS------------------------------------- 737
                  L   YLE +P  E I+                                     
Sbjct: 538 VLRTHRYLPPGYLEGEPIGEAINLSLSVGDDNGFANEEEDDDDDEGKVFEKFNPLLHAGA 597

Query: 738 ---------QDDVLP----VEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDS 784
                    Q   LP    + FL  Y+ YAKE + P++++ A   +VR Y  +R     +
Sbjct: 598 KLARNKGNRQGTELPQIVSIPFLRKYVQYAKERVVPMLSQEAVNIVVRTYTELR-----N 652

Query: 785 RSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAI 833
             + K+   T R LE++IRLA AHAK++L   V+ ED + A  L+R A+
Sbjct: 653 DQNTKKSPITPRTLETLIRLASAHAKVRLSKTVDREDARVAAHLLRFAL 701

>Sklu_2087.4 YBL023C, Contig c2087 7202-9856
          Length = 884

 Score =  291 bits (745), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 205/668 (30%), Positives = 325/668 (48%), Gaps = 73/668 (10%)

Query: 206 RKILDEREEFINNTTDE--ELYYIKQLNEMRELGTSNLNLDARNLLAYKQTEDLYHQLLN 263
           R I  E + F+   TDE  +  Y  ++  + E+ + +L ++ R+L   K    L+  L  
Sbjct: 213 RTIARELKSFLLEYTDESGKSVYGARIRTLGEVNSESLEVNYRHLAESKAILALF--LAK 270

Query: 264 YPQEVISIMDQTIKDCMVSLIVDNNLDY-DLDEIETKFYKVRPYNVGSCKGMRELNPNDI 322
            P+E++ I D    +          L Y D   I ++ + VR  +  +   +REL  +++
Sbjct: 271 CPEEMLKIFDLVAMEA-------TELHYPDYSRIHSEIH-VRISDFPTVHNLRELRESNL 322

Query: 323 DKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEI-DRGVIQEPARCERIDCNEPNS 381
           + L+ + G+V R T V P +K   F C  C   +     D     + + C   +C     
Sbjct: 323 NSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEVKISFC--TNCRSKGP 380

Query: 382 MSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRS 441
                 +  + + Q I LQE P  VP G+ P    + +  +LVD  + G+ +EVTG +++
Sbjct: 381 FRTNAEKTLYRNYQRITLQEAPGTVPAGRLPRHREVILLWDLVDVAKPGEEVEVTGVYKN 440

Query: 442 IPIRANSRQRVLKSLYKTYXXXXXXXXXXXXRLDVDTSTIEQELMQNKVDHNEVEEVRQI 501
                N   +    ++ T             R  +   +IE E     +D     E  + 
Sbjct: 441 T-YDGNLNAKNGFPVFATVIEANSIKRREGGR--ISNESIEDE---EGLDPFSWTEEEER 494

Query: 502 TDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXXXXXXXXXXRYRGD 561
             + +++ R +  +      +  S+APSIY  +D+K  +   L              RGD
Sbjct: 495 EFRRMSRDRAIIDK------IISSMAPSIYGHKDIKTAVACSLFGGVPKNVNGKHSIRGD 548

Query: 562 INILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGAL 621
           IN+LL GDP T+KSQIL+Y+ K   R V+ +G+G+SAVGLTA + +D  T++  LE GAL
Sbjct: 549 INVLLLGDPGTAKSQILKYIEKTAHRAVFATGQGASAVGLTASVRKDPITREWTLEGGAL 608

Query: 622 VLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSR 681
           VL+D GVC IDEFDKM+D  R+ +HE MEQQ+ISI+KAGI+TTL AR SI+A+ANP G R
Sbjct: 609 VLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGR 668

Query: 682 YNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKP-------- 733
           YN  LP+ +N+DL  P+LSRFD++ +V D VDE+ D  LA  + + ++   P        
Sbjct: 669 YNSTLPLAQNVDLTEPILSRFDILCVVRDLVDEEADERLATFVVSSHVRSHPDSDRLRED 728

Query: 734 ---------------------------------EHISQDDVLPVEFLTMYISYAKEHIHP 760
                                            E   +   +P + L  YI YA+  I+P
Sbjct: 729 PQDDDLDQQTEDEREDDEPAPMSARQKRLQRQREKEGEISPIPQDTLMKYIHYARIKIYP 788

Query: 761 IITEAAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELE 820
            + +    ++ R Y  +R+    + S       T R LES++R+AE+ AKM+L   V   
Sbjct: 789 KLHQMDMDKVSRVYADLRRESITTGS----FPITVRHLESILRIAESFAKMRLSEFVSSW 844

Query: 821 DVQEAVRL 828
           D+  A+++
Sbjct: 845 DLDRAIKV 852

>YGL201C (MCM6) [1794] chr7 complement(117856..120909) Protein
           involved in DNA replication, member of the MCM/P1 family
           of proteins [3054 bp, 1017 aa]
          Length = 1017

 Score =  290 bits (741), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 163/359 (45%), Positives = 223/359 (62%), Gaps = 30/359 (8%)

Query: 482 EQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGIL 541
           +QE+  N +  +E+ E           ++E+   E +Y  L RSIAP+++  E VKKGIL
Sbjct: 500 DQEVFLNSLSSDEINE-----------LKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGIL 548

Query: 542 LQLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGL 601
           LQ+            + RGDINI + GDPSTSKSQ L+YV    PR VYTSGK SSA GL
Sbjct: 549 LQMLGGVHKSTVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSGKASSAAGL 608

Query: 602 TAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGI 661
           TA + RD +     +E+GAL+L+D G+CCIDEFDKM  S +  +HE MEQQTISIAKAGI
Sbjct: 609 TAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGI 668

Query: 662 ITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELA 721
             TLNAR+SILA+ANP+G RYN  L +  N+++  P++SRFDL +++LD  +EK D ELA
Sbjct: 669 HATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELA 728

Query: 722 KHLTNLYLEDKPEHISQDDVLPVEF----LTMYISYAKEHIHPIITEAAKTELVRAYVGM 777
            H+ +L       H+ +D+ +   F    L  YI YA+    PI+T+ A++ LV  Y  +
Sbjct: 729 SHIVDL-------HMKRDEAIEPPFSAEQLRRYIKYART-FKPILTKEARSYLVEKYKEL 780

Query: 778 RKMGDDSRSDEK---RITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAI 833
           RK  DD++   +   RI  T RQLESMIRL+EA A+    + +    + EA  L+R +I
Sbjct: 781 RK--DDAQGFSRSSYRI--TVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSI 835

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 69/145 (47%)

Query: 299 KFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAV 358
           + +++  +N+ +   +R++    I  L+++ G V R++ V P++  A F C++C   +  
Sbjct: 261 RVFQISFFNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDMCRAIVDN 320

Query: 359 EIDRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLC 418
                   EP  C    C      +L   R  F D Q +++QE  + +P G  P ++ + 
Sbjct: 321 VEQSFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVRIQENANEIPTGSMPRTLDVI 380

Query: 419 VYDELVDSCRAGDRIEVTGTFRSIP 443
           +  + V+  + GDR + TG    +P
Sbjct: 381 LRGDSVERAKPGDRCKFTGVEIVVP 405

>CAGL0L01397g 152718..155555 highly similar to sp|P24279
           Saccharomyces cerevisiae YEL032w MCM3 replication
           initiation protein, hypothetical start
          Length = 945

 Score =  276 bits (707), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 202/651 (31%), Positives = 329/651 (50%), Gaps = 105/651 (16%)

Query: 257 LYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETKFYKVRPYNVG--SCKGM 314
            +  +LN P   I   ++ + +   +L  D++    +D +  K    RP+ +      G 
Sbjct: 103 FWRGVLNEPAYYIPPAERALSEIATAL--DDSPRNTVDAVSAK----RPWRLSFKGSFGS 156

Query: 315 RELNPNDID-----KLINLKGLVLRSTPVIPD-MKVAFF-----KCNVCDHTMAVEIDRG 363
             L+P  ++     KL++++G+V +++ V P  M+   +     + +  D+T +      
Sbjct: 157 HTLSPGTLNAMYLNKLVSIEGIVTKTSLVRPKLMRSVHYAEKTGRFHYRDYTDSTTSLTT 216

Query: 364 VIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDEL 423
            +  PA     D  + N ++  +   ++ D Q I +QE P+    G  P S+ + + D+L
Sbjct: 217 RVPTPAIYPTEDP-DGNKLTTEYGFSTYIDHQRITVQEMPEMAQVGPVPRSVDIILDDDL 275

Query: 424 VDSCRAGDRIEVTGTFRSIPIRA-NSRQRVLKSLYKTYXXXXXXXXXXXXRLDVDTSTIE 482
           VD  + GDRI V G F+S+     N  +    + ++T              L +  S   
Sbjct: 276 VDKTKPGDRINVVGVFKSVGAGGLNQGESNTLNGFRT--------------LIIGNSVYP 321

Query: 483 QELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILL 542
                  V   E      + D D+  I +++ R D++ +LA+S+APSIY  E++K+ +LL
Sbjct: 322 LHARSTGVSAKET-----LNDLDIRNINKLSKRGDIFEILAQSLAPSIYGHENIKRAVLL 376

Query: 543 QLXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLT 602
            L              RGDINIL+ GDPST+KSQ+L++V       + T+G+GSS VGLT
Sbjct: 377 MLFGGVEKNLENGSHLRGDINILMVGDPSTAKSQMLRFVLNTASLAIATTGRGSSGVGLT 436

Query: 603 AYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGII 662
           A +T D +T +  LE+GA+VL+D G+ CIDEFDKM+D  R  +HEVMEQQT++IAKAGI 
Sbjct: 437 AAVTTDRETGERRLEAGAMVLADRGIVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIH 496

Query: 663 TTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAK 722
           TTLN+R S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D ++E  DR +++
Sbjct: 497 TTLNSRCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEARDRSISE 556

Query: 723 HL--TNLYL--------------------------EDKPEHISQDD-------------- 740
           H+  T+ YL                          E+  ++ +QD+              
Sbjct: 557 HVLRTHRYLSPGMVEGEPVRDRLNLSLAVGTDEDDENANDNTNQDEEDQVFEKFNPLLQA 616

Query: 741 ------------------VLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGD 782
                             ++ + FL  Y+ YAKE + P +T  A   +V+ Y  +R   +
Sbjct: 617 GAMLAKNRGNYNGTEIPKLVKISFLRKYVQYAKERVVPQLTTEAVDVIVKNYTDLR---N 673

Query: 783 DSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAI 833
           D  + +  ITA  R LE++IRLA AHAK++L   V+  D   A  L+R ++
Sbjct: 674 DENTKKSPITA--RTLETLIRLATAHAKVRLSRTVDKVDATVAANLLRFSL 722

>YEL032W (MCM3) [1393] chr5 (86937..89852) Member of the MCM/P1
           family, part of the MCM complex that assembles at ARS
           elements to initiate replication [2916 bp, 971 aa]
          Length = 971

 Score =  268 bits (684), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 196/588 (33%), Positives = 298/588 (50%), Gaps = 88/588 (14%)

Query: 315 RELNPNDIDKLINLKGLVLRSTPVIPDM------KVAFFKCNVCDHTMAVEIDRGVIQEP 368
           R L    ++KL++++G+V +++ V P +           + +  D+T A       I  P
Sbjct: 169 RTLTAQHLNKLVSVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRIPTP 228

Query: 369 ARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCR 428
           A     D  E N ++  +   +F D Q I +QE P+  P GQ P SI + + D+LVD  +
Sbjct: 229 AIYPTEDT-EGNKLTTEYGYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTK 287

Query: 429 AGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYXXXXXXXXXXXXRLDVDTSTIEQELMQN 488
            GDR+ V G F+S+     ++                        +   T  +   +   
Sbjct: 288 PGDRVNVVGVFKSLGAGGMNQSN------------------SNTLIGFKTLILGNTVYPL 329

Query: 489 KVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXXXX 548
                 V   + +TD D+  I +++ ++D++ +L++S+APSIY  + +KK ILL L    
Sbjct: 330 HARSTGVAARQMLTDFDIRNINKLSKKKDIFDILSQSLAPSIYGHDHIKKAILLMLMGGV 389

Query: 549 XXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRD 608
                     RGDINIL+ GDPST+KSQ+L++V       + T+G+GSS VGLTA +T D
Sbjct: 390 EKNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVTTD 449

Query: 609 VDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNAR 668
            +T +  LE+GA+VL+D GV CIDEFDKM+D  R  +HEVMEQQT++IAKAGI TTLNAR
Sbjct: 450 RETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLNAR 509

Query: 669 SSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKH----- 723
            S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D ++E  DR +++H     
Sbjct: 510 CSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTH 569

Query: 724 --LTNLYLEDKPEH--------ISQD-DVLPVEFLTMYIS----------YAKEHIHPII 762
             L   YLE +P          + +D D+ P E                 +  E  +P++
Sbjct: 570 RYLPPGYLEGEPVRERLNLSLAVGEDADINPEEHSNSGAGVENEGEDDEDHVFEKFNPLL 629

Query: 763 TEAAK----------TEL--------VRAYVG-----------------MRKMGDDSRSD 787
              AK          TE+        +R YV                  + K   D R+D
Sbjct: 630 QAGAKLAKNKGNYNGTEIPKLVTIPFLRKYVQYAKERVIPQLTQEAINVIVKNYTDLRND 689

Query: 788 E--KRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAI 833
           +  K+   T R LE++IRLA AHAK++L   V   D + A  L+R A+
Sbjct: 690 DNTKKSPITARTLETLIRLATAHAKVRLSKTVNKVDAKVAANLLRFAL 737

>Scas_499.2
          Length = 985

 Score =  266 bits (680), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 195/585 (33%), Positives = 291/585 (49%), Gaps = 82/585 (14%)

Query: 315 RELNPNDIDKLINLKGLVLRSTPVIPDM--------KVAFFKCNVCDHTMAVEIDRGVIQ 366
           R LN   ++KLI+++G+V R++ V P +        K   F     D+T A       I 
Sbjct: 177 RTLNSQFLNKLISIEGIVTRTSLVRPKLIRSVHYAEKTGRFHYR--DYTDATTTLTTKIP 234

Query: 367 EPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDS 426
            PA     D +  N +   +   +F D Q I +QE P+  P GQ P SI + + D+LVD 
Sbjct: 235 TPAIYPTEDTDG-NKLITEYGYSTFVDHQRITIQEMPEMAPAGQLPRSIDVILDDDLVDK 293

Query: 427 CRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYXXXXXXXXXXXXRLDVDTSTIEQELM 486
            + GDR+ V G F+S           L +                      T  I   + 
Sbjct: 294 TKPGDRVNVIGVFKS-----------LGAGGLNNGGNGGGADSGASMSGFRTLIIGNTVY 342

Query: 487 QNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLXX 546
                   V   + +TD D+  I +++ ++D++ +LA+S+APSIY  E +K+ ILL L  
Sbjct: 343 PLHARSTGVSARQTLTDFDIRNINKLSKKKDIFDVLAQSLAPSIYGHEHIKRAILLMLMG 402

Query: 547 XXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYIT 606
                       RGDINIL+ GDPST+KSQ+L++V       + T+G+GSS VGLTA +T
Sbjct: 403 GVEKNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVT 462

Query: 607 RDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLN 666
            D +T +  LE+GA+VL+D GV CIDEFDKM+D  R  +HEVMEQQT++IAKAGI TTLN
Sbjct: 463 NDRETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLN 522

Query: 667 ARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTN 726
           AR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D ++E  DR +++H+  
Sbjct: 523 ARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLR 582

Query: 727 LYLEDKPEHISQDDVLPVEFLTMYISY-------------------AKEHIHPIITEAAK 767
            +    P ++  + +     L++ +                       E  +P++   AK
Sbjct: 583 THRYLPPGYLEGEPIRERLNLSLAVGVDDNINEENKDGGEEDEEDQVFEKFNPLLQAGAK 642

Query: 768 ----------TEL--------VRAYVGMRK---------------------MGDDSRSDE 788
                     TE+        +R YV   K                     + +D  + +
Sbjct: 643 LAKNKGNHNGTEIPKLVTIPFLRKYVQYAKERVIPQLTQQAIDVIVKNYADLRNDENTKK 702

Query: 789 KRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAI 833
             ITA  R LE++IRLA AHAK++L   V   D   A  L+R A+
Sbjct: 703 SPITA--RTLETLIRLATAHAKVRLSKTVNKRDANVAAGLLRYAL 745

>AFR355C [3547] [Homologous to ScYEL032W (MCM3) - SH]
           (1082128..1084959) [2832 bp, 943 aa]
          Length = 943

 Score =  259 bits (662), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 191/585 (32%), Positives = 290/585 (49%), Gaps = 87/585 (14%)

Query: 315 RELNPNDIDKLINLKGLVLRSTPVIPDM-KVAFFKCNVCDH----------TMAVEIDRG 363
           R L    +++L++++G+V R++ V P + +      N   H          T+  E+   
Sbjct: 138 RTLMATHLNQLVSIEGIVTRTSIVRPKLLRSVHLSKNTGAHYYRDYRDATTTLVTEV--- 194

Query: 364 VIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDEL 423
               PA     D  E N ++  +   ++ D Q + +QE P+  P GQ P S+ + + D+L
Sbjct: 195 --PTPAIYPEADP-EGNPLNTEYGYSTYMDHQRVTVQEMPEKAPPGQLPRSVDVILDDDL 251

Query: 424 VDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYXXXXXXXXXXXXRLDVDTSTIEQ 483
           VD  + GDR+ + G F+S                                    T  I  
Sbjct: 252 VDKTKPGDRVNIVGVFKS-------------IGAGGMSGGSSSDHGNNGLAGFKTLIIGN 298

Query: 484 ELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQ 543
            +         V    +++D D+  I ++A   D++ LLA+S+APSIY  E +KK +LL 
Sbjct: 299 TVYPLHARSTGVAASERLSDTDIRNINKLAKSADVFDLLAQSLAPSIYGHEHIKKAVLLM 358

Query: 544 LXXXXXXXXXXXXRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTA 603
           L              RGDINIL+ GDPST+KSQ+L++V       + T+G+GSS VGLTA
Sbjct: 359 LMGGVEKNLENGSHLRGDINILMVGDPSTAKSQMLRFVLNTAALAIATTGRGSSGVGLTA 418

Query: 604 YITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIIT 663
            +T D +T +  LE+GA+VL+D G+ CIDEFDKMSD  R  +HEVMEQQT++IAKAGI T
Sbjct: 419 AVTMDRETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGIHT 478

Query: 664 TLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKH 723
           TLNAR S++A+ANP+  +Y+ N    +NI LP  LLSRFDL+++V D +++  DR +++H
Sbjct: 479 TLNARCSVIAAANPVFGQYDVNKDPHKNIALPDSLLSRFDLLFVVTDDINDVRDRAISEH 538

Query: 724 -------LTNLYLEDKPEHISQDDVLPVEFLTMYISYAK-----------EHIHPIITEA 765
                  L   Y+E +P  I +   L +   T  +S              E   P++   
Sbjct: 539 VLRTHRYLPPGYMEGEP--IREAINLSLSVGTDGVSIDPDADDDTTDKVFEKYDPLLHAG 596

Query: 766 AK------------------TELVRAYVGMRK------MGDDS-----------RSDE-- 788
           AK                     +R YV   K      +  D+           R+D+  
Sbjct: 597 AKLAKNRGDHRGAELPKVVSIPFIRKYVQYAKERIVPVLTQDAVNIIVKTYCDLRNDQNT 656

Query: 789 KRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAI 833
           K+   T R LE++IRL+ AHAK++L  +VE  D   A +L+R A+
Sbjct: 657 KKSPITARTLETLIRLSNAHAKVRLSKLVEARDANVAAQLLRFAL 701

>KLLA0E14278g complement(1260247..1261668) similar to sp|P43635
           Saccharomyces cerevisiae YPR001w CIT3 citrate
           (si)-synthase, mitochondrial, start by similarity
          Length = 473

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 52/111 (46%), Gaps = 10/111 (9%)

Query: 788 EKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAV--------RLIRSAIKDYATD 839
           EK +T+  R +  M +LA A A M  K  +  E  QE           +    +   A  
Sbjct: 144 EKLLTSLPRDMHPMTQLAIALASMN-KGSIFAEKYQEGSIGKMDYWEYVYEDVLNLIAAL 202

Query: 840 PK-TGKIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMSFNELIKQ 889
           PK TGKI  N+V  G+ +    +++D S  I ++L    SDS++ + L ++
Sbjct: 203 PKITGKIYSNIVNDGEPLGHYNVEKDWSYNIASLLGMTVSDSVNMHSLTQE 253

>Scas_626.13
          Length = 463

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/161 (18%), Positives = 58/161 (36%), Gaps = 25/161 (15%)

Query: 696 PPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAK 755
           P L    D  Y  +D  +   D+ L K   N+      E ++   V+P     MY +   
Sbjct: 290 PSLYPEVDAKYATMDYDESLTDKVLEKTFVNVAKSHHKERVAPSLVVPTNTGNMYTASVY 349

Query: 756 EHIHPIITEAAKTELVRAYVGMRKMGD------------------------DSRSDEKRI 791
             +  ++++    +L    +G+   G                         D++ +  R 
Sbjct: 350 ASLASLLSQVGSEKLQGKRIGLFSYGSGLAASLFSCKVVGDISNIISVLDIDAKLNANRQ 409

Query: 792 TATTRQLESMIRLAE-AHAKMKLKNVVELEDVQEAVRLIRS 831
             T  + E+ I+L E AH +   +    ++ +Q+ V  + S
Sbjct: 410 LGTPEEFEAAIKLREDAHLQKGFEPAGSIDQLQKGVYYLTS 450

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 26,563,781
Number of extensions: 1129322
Number of successful extensions: 4420
Number of sequences better than 10.0: 77
Number of HSP's gapped: 4505
Number of HSP's successfully gapped: 112
Length of query: 917
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 806
Effective length of database: 12,753,511
Effective search space: 10279329866
Effective search space used: 10279329866
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)