Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPR016C (TIF6)24524212601e-178
Sklu_1537.124524212391e-175
Scas_602.524524212361e-175
CAGL0K02497g24524212341e-174
Kwal_14.219124524212301e-174
KLLA0D02046g24524212211e-172
ADL030C24524212171e-172
AER159C119167730.27
YKR031C (SPO14)168343671.4
Kwal_47.1887631130661.5
Kwal_33.1303333245634.0
YGL236C (MTO1)67961609.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR016C
         (242 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR016C (TIF6) [5450] chr16 complement(592327..593064) Translati...   489   e-178
Sklu_1537.1 YPR016C, Contig c1537 383-1120 reverse complement         481   e-175
Scas_602.5                                                            480   e-175
CAGL0K02497g 225229..225966 highly similar to sp|Q12522 Saccharo...   479   e-174
Kwal_14.2191                                                          478   e-174
KLLA0D02046g complement(175907..176644) highly similar to sp|Q12...   474   e-172
ADL030C [1712] [Homologous to ScYPR016C (TIF6) - SH] (647423..64...   473   e-172
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    33   0.27 
YKR031C (SPO14) [3286] chr11 complement(500986..506037) Phosphol...    30   1.4  
Kwal_47.18876                                                          30   1.5  
Kwal_33.13033                                                          29   4.0  
YGL236C (MTO1) [1763] chr7 complement(53756..55795) Protein with...    28   9.4  

>YPR016C (TIF6) [5450] chr16 complement(592327..593064) Translation
           initiation factor 6 (eIF6), nuclear protein required for
           transit of pre-60S ribosomal subunits from the nucleus
           to the cytoplasm [738 bp, 245 aa]
          Length = 245

 Score =  489 bits (1260), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 242/242 (100%), Positives = 242/242 (100%)

Query: 1   MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIG 60
           MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIG
Sbjct: 1   MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVP 180
           IDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVP
Sbjct: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240
           LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL
Sbjct: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240

Query: 241 IE 242
           IE
Sbjct: 241 IE 242

>Sklu_1537.1 YPR016C, Contig c1537 383-1120 reverse complement
          Length = 245

 Score =  481 bits (1239), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 234/242 (96%), Positives = 241/242 (99%)

Query: 1   MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIG 60
           MATRTQFENSNE+GVFSKLTN+YCLVA+GGSENFYSAFEAELGDAIPI HTTIAGTRIIG
Sbjct: 1   MATRTQFENSNEVGVFSKLTNSYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIIG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVP 180
           IDRETEELI+DVLGVEVFRQTISGN+LVGSYCSLSNQGGLVHPQT++QDQEELSSLLQVP
Sbjct: 121 IDRETEELIADVLGVEVFRQTISGNVLVGSYCSLSNQGGLVHPQTTIQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240
           LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL
Sbjct: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240

Query: 241 IE 242
           IE
Sbjct: 241 IE 242

>Scas_602.5
          Length = 245

 Score =  480 bits (1236), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 235/242 (97%), Positives = 240/242 (99%)

Query: 1   MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIG 60
           MATRTQFENSNEIGVFSKLTNTYCLVA+GGSENFYSAFEAELGDAIPI HTTIAGTRIIG
Sbjct: 1   MATRTQFENSNEIGVFSKLTNTYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIIG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELQHLRN LPDSVKIQRVEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNCLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVP 180
           IDRETEELISDVLGVEVFRQTISGNILVGSYC+LSNQGGLVHPQT++QDQEELSSLLQVP
Sbjct: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240
           LVAGTVNRGS+VVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL
Sbjct: 181 LVAGTVNRGSAVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240

Query: 241 IE 242
           IE
Sbjct: 241 IE 242

>CAGL0K02497g 225229..225966 highly similar to sp|Q12522
           Saccharomyces cerevisiae YPR016c Eukaryotic translation
           initiation factor 6, start by similarity
          Length = 245

 Score =  479 bits (1234), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 232/242 (95%), Positives = 241/242 (99%)

Query: 1   MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIG 60
           MATRTQFENSNE+GVFSKLTNTYCLVAVGGSENFYSAFEAELGD+IPI HTTIAGTRI+G
Sbjct: 1   MATRTQFENSNEVGVFSKLTNTYCLVAVGGSENFYSAFEAELGDSIPIAHTTIAGTRIVG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVP 180
           IDRETEELISDVLGVEVFRQTISGNILVGSYC+LSNQGGLVHPQT++QDQEELSSLLQVP
Sbjct: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240
           LVAGTVNRGS+VVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQP++ISGNLRDTL
Sbjct: 181 LVAGTVNRGSAVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPDAISGNLRDTL 240

Query: 241 IE 242
           IE
Sbjct: 241 IE 242

>Kwal_14.2191
          Length = 245

 Score =  478 bits (1230), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 240/242 (99%)

Query: 1   MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIG 60
           MA+RTQFENSNE+GVFSKLTN+YCLV VGGSENFYSAFEAELGDAIP+VHTTIAGTRIIG
Sbjct: 1   MASRTQFENSNEVGVFSKLTNSYCLVTVGGSENFYSAFEAELGDAIPMVHTTIAGTRIIG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQEL HLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELHHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVP 180
           +DRETEELI+DVLGVEVFRQTISGN+LVGSYC+LSNQGGLVHPQTS+QDQEELSSLLQVP
Sbjct: 121 VDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTSIQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240
           LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL
Sbjct: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240

Query: 241 IE 242
           IE
Sbjct: 241 IE 242

>KLLA0D02046g complement(175907..176644) highly similar to sp|Q12522
           Saccharomyces cerevisiae YPR016c TIF6 translation
           initiation factor 6 (eIF6) singleton, start by
           similarity
          Length = 245

 Score =  474 bits (1221), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 229/242 (94%), Positives = 239/242 (98%)

Query: 1   MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIG 60
           MATRTQFENSNEIGVFSKLTN+YCLVA+GGSENFYSAFEAELGDAIPI HTTIAGTRI+G
Sbjct: 1   MATRTQFENSNEIGVFSKLTNSYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIVG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELQHLRN LPD+VK+QRVEERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNCLPDAVKVQRVEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVP 180
           IDRETEELI+DVLGVEVFRQTISGN+LVGSYC+LSNQGGLVHPQT+VQDQEELSSLLQVP
Sbjct: 121 IDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTVQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240
           LVAGTVNRGS VVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPE+ISGNLRDTL
Sbjct: 181 LVAGTVNRGSQVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPEAISGNLRDTL 240

Query: 241 IE 242
           IE
Sbjct: 241 IE 242

>ADL030C [1712] [Homologous to ScYPR016C (TIF6) - SH]
           (647423..648160) [738 bp, 245 aa]
          Length = 245

 Score =  473 bits (1217), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 227/242 (93%), Positives = 239/242 (98%)

Query: 1   MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIG 60
           MATRTQFENSNE+GVFSKLTNTYCLV +GGSENFYSAFEAELGDAIPIVHTTIAGTRI+G
Sbjct: 1   MATRTQFENSNEVGVFSKLTNTYCLVTIGGSENFYSAFEAELGDAIPIVHTTIAGTRIVG 60

Query: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120
           RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQR+EERLSALGNVICCNDYVALVHPD
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRIEERLSALGNVICCNDYVALVHPD 120

Query: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVP 180
           ID ETEELI+DVLGVEVFRQTISGN+LVGSYC+LSNQGGLVHPQT++QDQEELSSLLQVP
Sbjct: 121 IDNETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180

Query: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240
           LVAGT+NRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDA P++ISGNLRDTL
Sbjct: 181 LVAGTINRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDANPDAISGNLRDTL 240

Query: 241 IE 242
           IE
Sbjct: 241 IE 242

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 32.7 bits (73), Expect = 0.27,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 7/67 (10%)

Query: 149 GSYCSLSNQGGLVHPQTSVQDQEELSSLLQVPLVAGTVNRGSSVVGAGMVVNDYLAVTGL 208
           G   + S+ G LV P      +    +L+  PL+   +  GSSV GAG         TG+
Sbjct: 314 GEQRATSDTGTLVMPSMRASHEFIAPTLVHTPLIMDFLQIGSSVGGAG-------GFTGV 366

Query: 209 DTTAPEL 215
           DT  P L
Sbjct: 367 DTADPTL 373

>YKR031C (SPO14) [3286] chr11 complement(500986..506037)
           Phospholipase D, catalyzes hydrolysis of
           phosphatidylcholine to yield phosphatidic acid and
           choline [5052 bp, 1683 aa]
          Length = 1683

 Score = 30.4 bits (67), Expect = 1.4,   Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 1   MATRTQFENSNEIGVFSKL-TNTYCLVAVGGSENFYSAFEAEL 42
           M+T T +   N  G F+ + TN++C   V G + F+S  EA L
Sbjct: 660 MSTSTPWSKPNRFGSFAPVRTNSFCKFLVDGRDYFWSLSEALL 702

>Kwal_47.18876
          Length = 311

 Score = 30.0 bits (66), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 2/30 (6%)

Query: 14 GVFSKLTNTYCL--VAVGGSENFYSAFEAE 41
          GVF KL N YCL   A GG+   Y  F  +
Sbjct: 50 GVFEKLWNNYCLHVCADGGANRLYEYFSCD 79

>Kwal_33.13033
          Length = 332

 Score = 28.9 bits (63), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 2/45 (4%)

Query: 63  TAGNRRGLLVPTQ-TTDQELQHLRNSLPDSVKIQRVEERLSALGN 106
           T+G +  +  PT+  TD + + + N LPDSV++Q +++RL    N
Sbjct: 233 TSGYKSEITNPTEYDTDCDYRKISN-LPDSVRLQNLKDRLCRAKN 276

>YGL236C (MTO1) [1763] chr7 complement(53756..55795) Protein with a
           role in mitochondrial translational accuracy, has strong
           similarity to E. coli gidA protein [2040 bp, 679 aa]
          Length = 679

 Score = 27.7 bits (60), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 4/61 (6%)

Query: 35  YSAFEAELGDAIPIVHTTIAGTRIIGRMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKI 94
           +SA E + GDA+P+  + +  T  +      +  G    T TT Q    LRN+L  S+ I
Sbjct: 251 FSALEVQKGDALPVPMSFLNETVSVEPTKQLDCFG----THTTPQMHDFLRNNLHQSIHI 306

Query: 95  Q 95
           Q
Sbjct: 307 Q 307

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,319,427
Number of extensions: 294019
Number of successful extensions: 784
Number of sequences better than 10.0: 12
Number of HSP's gapped: 770
Number of HSP's successfully gapped: 12
Length of query: 242
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 143
Effective length of database: 13,168,927
Effective search space: 1883156561
Effective search space used: 1883156561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)