Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPR015C24724410801e-151
Scas_707.46338983336e-37
Scas_602.4266633087e-34
YPR013C317633022e-32
CAGL0L05786g348682892e-30
CAGL0J01595g344622874e-30
Scas_602.4d256672651e-27
AEL077W336622191e-20
Scas_656.1*102552052e-20
KLLA0F20636g285522083e-19
KLLA0A04609g423572096e-19
ADL040W330572032e-18
Scas_710.9505562035e-18
Sklu_2398.2288591933e-17
ADR308C278531863e-16
Kwal_26.8011190601789e-16
Scas_717.18354541822e-15
KLLA0F11682g374561788e-15
ADL042W281531741e-14
Sklu_2244.3271541741e-14
Scas_718.36d330561742e-14
AGR186C287651732e-14
Scas_717.17d350531724e-14
Kwal_14.2206254541704e-14
AGL207W277541681e-13
ADL050W146541601e-13
CAGL0M01870g315531644e-13
ADL051W173551578e-13
Kwal_27.10467302561619e-13
KLLA0F22319g203481562e-12
Scas_697.35839541354e-09
YOR113W (AZF1)914531283e-08
CAGL0E01331g689531266e-08
ACR264W769531267e-08
CAGL0L03916g642531241e-07
Kwal_14.2543711551213e-07
AGL197W844571213e-07
Kwal_47.17888786531203e-07
Scas_687.33288631176e-07
YER028C394591176e-07
Scas_711.56832561187e-07
KLLA0F01463g781551179e-07
KLLA0F23782g782521179e-07
CAGL0M04323g703551161e-06
YJL056C (ZAP1)880551151e-06
Sklu_2389.2767551152e-06
CAGL0K12078g463631142e-06
Kwal_56.23925745531142e-06
AEL174W661541098e-06
CAGL0M06831g645541098e-06
CAGL0J05060g713551072e-05
KLLA0A10373g206581042e-05
CAGL0I02816g291561052e-05
Kwal_47.19045266521033e-05
AGR031W14064994e-05
KLLA0B00605g239581024e-05
Scas_718.44266541015e-05
AFR471C389521017e-05
CAGL0C02519g318521017e-05
CAGL0L07480g314541008e-05
Kwal_23.5400429541009e-05
YNL027W (CRZ1)678711019e-05
Scas_713.52620531011e-04
Scas_693.31635531001e-04
ABR089C571551001e-04
YDR146C (SWI5)70953992e-04
CAGL0A01628g42451982e-04
KLLA0F18524g35765972e-04
Scas_712.42*29052962e-04
YGL209W (MIG2)38252963e-04
YGL035C (MIG1)50451955e-04
KLLA0D16456g85470955e-04
Sklu_2351.654851955e-04
Kwal_14.227846351946e-04
YLR131C (ACE2)77053946e-04
Scas_709.3282256946e-04
YDR043C (NRG1)23154926e-04
Sklu_2357.715758907e-04
Scas_712.232754937e-04
CAGL0H07557g47655937e-04
Kwal_27.1016728555928e-04
Kwal_27.1146053156938e-04
Scas_695.257154939e-04
ADL198W54754930.001
Kwal_26.835169855920.001
KLLA0E10989g47452910.002
KLLA0B03454g47254900.002
Scas_575.345551900.002
CAGL0M13189g54155900.002
KLLA0F26961g69455880.003
CAGL0F05995g59754880.003
Kwal_27.1092526468870.003
CAGL0K09372g39652870.004
YGL254W (FZF1)29953860.005
YKL062W (MSN4)63055860.006
KLLA0E18645g43150850.007
Sklu_2443.2221347840.007
Scas_649.2873055860.008
KLLA0B04477g133247850.009
Sklu_2289.129150830.010
Scas_569.229367830.010
KLLA0E08679g59654840.011
CAGL0K02145g31761830.012
KLLA0F07073g55858830.014
YPR186C (PZF1)42973820.017
YMR037C (MSN2)70454820.018
YDR216W (ADR1)132358820.022
AEL278W47654810.025
Sklu_2181.141052800.033
CAGL0K03003g64750800.034
Kwal_47.1724140352800.035
YBR066C (NRG2)22062780.037
AER159C119147800.038
AGL071C39650790.047
Scas_602.954752790.048
CAGL0M00594g102049790.054
AFR580C83850780.074
CAGL0H04213g132147770.081
Kwal_26.802150751770.084
Scas_631.743354770.088
CAGL0L06072g30053760.100
CAGL0K04697g51559760.12
Scas_670.243556750.12
ACL057W52052750.13
Scas_707.3128955750.13
Kwal_47.16621117847760.13
KLLA0B07909g92253750.18
CAGL0H04873g45158730.22
Sklu_2206.235858730.23
Scas_721.92115247730.26
YMR070W (MOT3)49054730.26
KLLA0E13519g23056720.27
YER130C44352710.37
Scas_717.1752554710.39
Scas_683.2587963720.39
CAGL0K04631g101353720.42
Scas_703.23134147720.43
YLR375W34356710.44
Kwal_26.930030458700.57
Scas_627.6120775700.71
YML081W125147690.78
YDL048C (STP4)49056680.93
Scas_683.3047868681.0
YMR182C (RGM1)21166661.2
CAGL0E06116g61357671.3
CAGL0G10021g39438671.3
AAR170W60328671.6
Kwal_47.1657788160671.7
Scas_378.120850651.7
Sklu_1527.120551642.1
KLLA0E00726g51743652.3
YPL038W (MET31)17750632.5
KLLA0C17072g47452652.6
CAGL0L12562g22347633.0
YPR022C113358643.9
Scas_719.68135053634.3
YNL278W (CAF120)106055634.4
YJR127C (ZMS1)138047634.7
CAGL0K02343g116267625.6
KLLA0D11902g28950616.0
Sklu_2126.544839617.0
Scas_587.791042617.2
YGR067C79450618.3
Sklu_2359.572258609.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR015C
         (244 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protei...   420   e-151
Scas_707.46                                                           132   6e-37
Scas_602.4                                                            123   7e-34
YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putati...   120   2e-32
CAGL0L05786g complement(636176..637222) some similarities with t...   115   2e-30
CAGL0J01595g 151584..152618 some similarities with tr|Q12531 Sac...   115   4e-30
Scas_602.4d                                                           106   1e-27
AEL077W [2429] [Homologous to NOHBY] complement(483028..484038) ...    89   1e-20
Scas_656.1*                                                            84   2e-20
KLLA0F20636g complement(1914452..1915309) some similarities with...    85   3e-19
KLLA0A04609g complement(411494..412765) some similarities with s...    85   6e-19
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    83   2e-18
Scas_710.9                                                             83   5e-18
Sklu_2398.2 , Contig c2398 2210-3076 reverse complement                79   3e-17
ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,...    76   3e-16
Kwal_26.8011                                                           73   9e-16
Scas_717.18                                                            75   2e-15
KLLA0F11682g complement(1068992..1070116) some similarities with...    73   8e-15
ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....    72   1e-14
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                72   1e-14
Scas_718.36d                                                           72   2e-14
AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,...    71   2e-14
Scas_717.17d                                                           71   4e-14
Kwal_14.2206                                                           70   4e-14
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    69   1e-13
ADL050W [1691] [Homologous to NOHBY] complement(597229..597669) ...    66   1e-13
CAGL0M01870g complement(219813..220760) some similarities with t...    68   4e-13
ADL051W [1690] [Homologous to NOHBY] complement(595496..596017) ...    65   8e-13
Kwal_27.10467                                                          67   9e-13
KLLA0F22319g complement(2086613..2087224) some similarities with...    65   2e-12
Scas_697.35                                                            57   4e-09
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    54   3e-08
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    53   6e-08
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    53   7e-08
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    52   1e-07
Kwal_14.2543                                                           51   3e-07
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    51   3e-07
Kwal_47.17888                                                          51   3e-07
Scas_687.33                                                            50   6e-07
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    50   6e-07
Scas_711.56                                                            50   7e-07
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    50   9e-07
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    50   9e-07
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    49   1e-06
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    49   1e-06
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            49   2e-06
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...    49   2e-06
Kwal_56.23925                                                          49   2e-06
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    47   8e-06
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    47   8e-06
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    46   2e-05
KLLA0A10373g complement(907244..907864) some similarities with c...    45   2e-05
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    45   2e-05
Kwal_47.19045                                                          44   3e-05
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...    43   4e-05
KLLA0B00605g complement(46736..47455) some similarities with sp|...    44   4e-05
Scas_718.44                                                            44   5e-05
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    44   7e-05
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    44   7e-05
CAGL0L07480g complement(822240..823184) some similarities with s...    43   8e-05
Kwal_23.5400                                                           43   9e-05
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    44   9e-05
Scas_713.52                                                            44   1e-04
Scas_693.31                                                            43   1e-04
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    43   1e-04
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    43   2e-04
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    42   2e-04
KLLA0F18524g complement(1701498..1702571) some similarities with...    42   2e-04
Scas_712.42*                                                           42   2e-04
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    42   3e-04
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    41   5e-04
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    41   5e-04
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       41   5e-04
Kwal_14.2278                                                           41   6e-04
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    41   6e-04
Scas_709.32                                                            41   6e-04
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...    40   6e-04
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement        39   7e-04
Scas_712.2                                                             40   7e-04
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    40   7e-04
Kwal_27.10167                                                          40   8e-04
Kwal_27.11460                                                          40   8e-04
Scas_695.2                                                             40   9e-04
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    40   0.001
Kwal_26.8351                                                           40   0.001
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    40   0.002
KLLA0B03454g complement(314015..315433) some similarities with s...    39   0.002
Scas_575.3                                                             39   0.002
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    39   0.002
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    39   0.003
CAGL0F05995g complement(598819..600612) some similarities with s...    39   0.003
Kwal_27.10925                                                          38   0.003
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    38   0.004
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    38   0.005
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    38   0.006
KLLA0E18645g complement(1648263..1649558) some similarities with...    37   0.007
Sklu_2443.22 , Contig c2443 45390-46027                                37   0.007
Scas_649.28                                                            38   0.008
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    37   0.009
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          37   0.010
Scas_569.2                                                             37   0.010
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    37   0.011
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    37   0.012
KLLA0F07073g 675221..676897 some similarities with sgd|S0004367 ...    37   0.014
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    36   0.017
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    36   0.018
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    36   0.022
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    36   0.025
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            35   0.033
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    35   0.034
Kwal_47.17241                                                          35   0.035
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...    35   0.037
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    35   0.038
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    35   0.047
Scas_602.9                                                             35   0.048
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    35   0.054
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    35   0.074
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    34   0.081
Kwal_26.8021                                                           34   0.084
Scas_631.7                                                             34   0.088
CAGL0L06072g complement(679924..680826) some similarities with s...    34   0.100
CAGL0K04697g 458366..459913 some similarities with tr|Q07351 Sac...    34   0.12 
Scas_670.2                                                             33   0.12 
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    33   0.13 
Scas_707.31                                                            33   0.13 
Kwal_47.16621                                                          34   0.13 
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    33   0.18 
CAGL0H04873g complement(465069..466424) some similarities with t...    33   0.22 
Sklu_2206.2 YLR375W, Contig c2206 7136-8212                            33   0.23 
Scas_721.92                                                            33   0.26 
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    33   0.26 
KLLA0E13519g complement(1190615..1191307) some similarities with...    32   0.27 
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    32   0.37 
Scas_717.17                                                            32   0.39 
Scas_683.25                                                            32   0.39 
CAGL0K04631g complement(440721..443762) some similarities with s...    32   0.42 
Scas_703.23                                                            32   0.43 
YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with str...    32   0.44 
Kwal_26.9300                                                           32   0.57 
Scas_627.6                                                             32   0.71 
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    31   0.78 
YDL048C (STP4) [816] chr4 complement(366739..368211) Protein wit...    31   0.93 
Scas_683.30                                                            31   1.0  
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    30   1.2  
CAGL0E06116g complement(604708..606549) some similarities with t...    30   1.3  
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    30   1.3  
AAR170W [358] [Homologous to ScYGL125W (MET13) - SH] complement(...    30   1.6  
Kwal_47.16577                                                          30   1.7  
Scas_378.1                                                             30   1.7  
Sklu_1527.1 YPL038W, Contig c1527 389-1006                             29   2.1  
KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyce...    30   2.3  
YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protei...    29   2.5  
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    30   2.6  
CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041 S...    29   3.0  
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    29   3.9  
Scas_719.68                                                            29   4.3  
YNL278W (CAF120) [4332] chr14 (113269..116451) Protein containin...    29   4.4  
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    29   4.7  
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    28   5.6  
KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041 S...    28   6.0  
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            28   7.0  
Scas_587.7                                                             28   7.2  
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    28   8.3  
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          28   9.6  

>YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protein
           with similarity to human GT box-binding protein
           (SP:B44489), has two tandem C2H2-type zinc fingers [744
           bp, 247 aa]
          Length = 247

 Score =  420 bits (1080), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 207/244 (84%), Positives = 207/244 (84%)

Query: 1   MWRTKTLESMLCSPMKCSSSNIGGSYAQSSKEVSNTTKREVHLPPCSSIMHAPLTPEINQ 60
           MWRTKTLESMLCSPMKCSSSNIGGSYAQSSKEVSNTTKREVHLPPCSSIMHAPLTPEINQ
Sbjct: 1   MWRTKTLESMLCSPMKCSSSNIGGSYAQSSKEVSNTTKREVHLPPCSSIMHAPLTPEINQ 60

Query: 61  XXXXXXXXXXXXXXXHQTEDPVWRSSPNSIIFSPVIATPQPFPLTFVERQSCCPIXXXXX 120
                          HQTEDPVWRSSPNSIIFSPVIATPQPFPLTFVERQSCCPI     
Sbjct: 61  AALPPPAYHYAPSSLHQTEDPVWRSSPNSIIFSPVIATPQPFPLTFVERQSCCPIYSTAA 120

Query: 121 XXXXXQSVPPSMQHFQEENHRAVSNEQYSLPNVHIGQNPGXXXXXXXXXXXXIQKQLRAV 180
                QSVPPSMQHFQEENHRAVSNEQYSLPNVHIGQNPG            IQKQLRAV
Sbjct: 121 SSYTAQSVPPSMQHFQEENHRAVSNEQYSLPNVHIGQNPGTLLSQTQTDLDLIQKQLRAV 180

Query: 181 VKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           VKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK
Sbjct: 181 VKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240

Query: 241 IAKK 244
           IAKK
Sbjct: 241 IAKK 244

>Scas_707.46
          Length = 338

 Score =  132 bits (333), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 71/98 (72%)

Query: 146 EQYSLPNVHIGQNPGXXXXXXXXXXXXIQKQLRAVVKLRKQCPICGKVCSRPSTLRTHYL 205
           + +  PN +I  N G            IQK L    +LRKQCP+CGK+CSRPSTL+THYL
Sbjct: 231 DPHQFPNYNILMNDGVVDYLQPPSRSAIQKNLNLASRLRKQCPVCGKICSRPSTLKTHYL 290

Query: 206 IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIAK 243
           IHTGDTPF+C W+ CNKSFNVKSNMLRHL++HQKK AK
Sbjct: 291 IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAK 328

>Scas_602.4
          Length = 266

 Score =  123 bits (308), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 51/63 (80%), Positives = 58/63 (92%)

Query: 182 KLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKI 241
           KLRKQCP CGK+CSRPSTL+ HYLIHTGDTPFKCTW +CNK+FNVKSNMLRHL+ H+KK+
Sbjct: 197 KLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKV 256

Query: 242 AKK 244
            KK
Sbjct: 257 IKK 259

>YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putative
           transcription factor with similarity to mouse REX1
           encoded transcription factor, has two tandem C2H2-type
           zinc fingers [954 bp, 317 aa]
          Length = 317

 Score =  120 bits (302), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 51/63 (80%), Positives = 58/63 (92%)

Query: 181 VKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
            KLRKQCP+CGK+CSRPSTL+THYLIHTGDTPFKCTWE C KSFNVKSNMLRHL++H++K
Sbjct: 250 TKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309

Query: 241 IAK 243
             K
Sbjct: 310 RNK 312

>CAGL0L05786g complement(636176..637222) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 348

 Score =  115 bits (289), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 58/68 (85%)

Query: 177 LRAVVKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRT 236
           +  + KLRKQCP+CGKVCSRPSTL+THYLIHTGDTPFKC W+ C K+FNVKSNMLRHL+ 
Sbjct: 277 IDELSKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKC 336

Query: 237 HQKKIAKK 244
           H++K   K
Sbjct: 337 HERKKQAK 344

>CAGL0J01595g 151584..152618 some similarities with tr|Q12531
           Saccharomyces cerevisiae YPR015c or tr|Q12145
           Saccharomyces cerevisiae YPR013c, hypothetical start
          Length = 344

 Score =  115 bits (287), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 57/62 (91%)

Query: 178 RAVVKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           +A  +LRKQCP+CGK+CSRPSTL+TH LIHTGDTPFKCTW+ C K+FNVKSN+LRHL++H
Sbjct: 277 KATTRLRKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLKSH 336

Query: 238 QK 239
           +K
Sbjct: 337 EK 338

>Scas_602.4d
          Length = 256

 Score =  106 bits (265), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%)

Query: 178 RAVVKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           + ++K  K+CP+CGK+CSRPSTL+TH+LIHTGDTPFKCT+  C KSFNVKSNM RHL+ H
Sbjct: 188 QQLMKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCH 247

Query: 238 QKKIAKK 244
           ++K  KK
Sbjct: 248 ERKKNKK 254

>AEL077W [2429] [Homologous to NOHBY] complement(483028..484038)
           [1011 bp, 336 aa]
          Length = 336

 Score = 89.0 bits (219), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (70%)

Query: 183 LRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIA 242
           +R QCP+CGKVC RPS+LR H  IHTG  PF C W  C K FNVKSNM+RH R HQ +  
Sbjct: 272 VRNQCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQLQRG 331

Query: 243 KK 244
           K+
Sbjct: 332 KE 333

>Scas_656.1*
          Length = 102

 Score = 83.6 bits (205), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 35/55 (63%), Positives = 44/55 (80%)

Query: 185 KQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           +QCPICGK+ +R S+L+TH L+HTGD PFKC W +C K+FNVKSNM RH + H K
Sbjct: 40  RQCPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYKLHLK 94

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 84.7 bits (208), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 42/52 (80%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQ 238
           C  CGK  +RPS LRTH L+H+GD PF+CTWE CNK FNVKSN++RHL+ H+
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKLHK 285

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 85.1 bits (209), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 45/57 (78%)

Query: 184 RKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           + QC ICG++CSRPSTL+TH  IHTGD P+KC   +C+K FNVKSNMLRH + H+ K
Sbjct: 340 KNQCHICGRICSRPSTLQTHLSIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKRHEFK 396

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 82.8 bits (203), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 47/57 (82%)

Query: 185 KQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKI 241
           K C +CG+ C+RPSTL+TH LIHTG+ PF+C+W  C+K FNV+SNM RH+ +H++++
Sbjct: 258 KTCLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRSNMNRHVNSHKRRL 314

>Scas_710.9
          Length = 505

 Score = 82.8 bits (203), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 43/56 (76%)

Query: 182 KLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           K +KQC +CGKV +R S+L+TH LIHTG  PF CTW  C K+FNVKSNM RHL+ H
Sbjct: 444 KRKKQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKLH 499

>Sklu_2398.2 , Contig c2398 2210-3076 reverse complement
          Length = 288

 Score = 79.0 bits (193), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 34/59 (57%), Positives = 41/59 (69%)

Query: 182 KLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           KL+  CP CGK   RPS L+TH +IH G +P+ CTW  C+K FNVK N+LRH R H KK
Sbjct: 215 KLQHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRIHTKK 273

>ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,
           278 aa]
          Length = 278

 Score = 76.3 bits (186), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (71%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           C +CG+ C RPSTL+TH L HTG  PF C    C+KSFNV+SNMLRH R H +
Sbjct: 206 CKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLHSR 258

>Kwal_26.8011
          Length = 190

 Score = 73.2 bits (178), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 31/60 (51%), Positives = 43/60 (71%)

Query: 180 VVKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
            V  + QC +C K+ SR S L+ H L HTG  PF+C +  C+K+FNVKSNM+RHL+TH++
Sbjct: 123 AVHPKYQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTHKQ 182

>Scas_717.18
          Length = 354

 Score = 74.7 bits (182), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 43/54 (79%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           +CPIC K+ +R ++LR+H LIHTG+ P+KCTW +C+ S +VKSN+ RH ++H K
Sbjct: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 73.2 bits (178), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (69%)

Query: 184 RKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           + +C  CGK  +RPS+L TH  IHTGD P+KC + +C K FN KSNMLRH + H K
Sbjct: 303 KYRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLK 358

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score = 71.6 bits (174), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 36/53 (67%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           C ICGK   RPS LRTH ++H  D P+ C    C K FNVKSNMLRH+R H++
Sbjct: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRKHKE 279

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 71.6 bits (174), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           CP C K   RPS LRTH +IH G  PF C W +C+K FNVKSN+LRH R+H ++
Sbjct: 218 CPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHYRSHNRE 271

>Scas_718.36d
          Length = 330

 Score = 71.6 bits (174), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (69%)

Query: 182 KLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           KL   C +CGK   RPS+LRTH  I +G+ P+KC + +C KSFN KSNMLRH + H
Sbjct: 236 KLGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKLH 291

>AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,
           287 aa]
          Length = 287

 Score = 71.2 bits (173), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 46/65 (70%), Gaps = 2/65 (3%)

Query: 178 RAVVKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           R ++ + K CP+CGK  +R STL+ H LIHT   PFKC++  C+K FNVKSN+ RH R H
Sbjct: 160 RGLIFVSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CDKEFNVKSNLNRHERIH 217

Query: 238 QKKIA 242
           ++K +
Sbjct: 218 RQKAS 222

>Scas_717.17d
          Length = 350

 Score = 70.9 bits (172), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 39/53 (73%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           C +CGK  +R ++LRTH LIHTG  PFKC+W +C  S +VKSN+ RH ++H K
Sbjct: 287 CVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFKSHLK 339

>Kwal_14.2206
          Length = 254

 Score = 70.1 bits (170), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (68%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           +C ICGK  SRPS L TH LIHTG  P+ C   +C K FNVKSN++RH + H K
Sbjct: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 69.3 bits (168), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 38/54 (70%)

Query: 184 RKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           R  C  CGK  +R S+LRTH  IHTGD PF C +++C KSFN +SNMLRH + H
Sbjct: 182 RYVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLH 235

>ADL050W [1691] [Homologous to NOHBY] complement(597229..597669)
           [441 bp, 146 aa]
          Length = 146

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 38/54 (70%)

Query: 185 KQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQ 238
           K CP+C K  +R ++L TH LIH    P+ C + +CNKSFNVKSN+ RHLR H+
Sbjct: 76  KTCPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIHR 129

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 67.8 bits (164), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 37/53 (69%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           C +C K   RPS+L TH  IHTG+ P+ C +++C KSFN KSNMLRH + H K
Sbjct: 175 CKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLHFK 227

>ADL051W [1690] [Homologous to NOHBY] complement(595496..596017)
           [522 bp, 173 aa]
          Length = 173

 Score = 65.1 bits (157), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 39/55 (70%)

Query: 185 KQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           K C IC K  +R ++L+TH LIHT   P++C +  CNK+FNVKSN+ RH R H++
Sbjct: 116 KTCAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERIHKR 170

>Kwal_27.10467
          Length = 302

 Score = 66.6 bits (161), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 38/56 (67%)

Query: 184 RKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           R  C  CGKV +RPS+L TH   HTGD P+ C +++C+K FN +SNM RH + H K
Sbjct: 197 RYTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYKLHFK 252

>KLLA0F22319g complement(2086613..2087224) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 203

 Score = 64.7 bits (156), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%)

Query: 191 GKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQ 238
           GK  SRPSTL+TH ++H+   PFKCT+  CNKS+NVKSN+ RH + H+
Sbjct: 152 GKEFSRPSTLKTHIVVHSQAKPFKCTYLDCNKSYNVKSNLRRHEKKHK 199

>Scas_697.35
          Length = 839

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (64%), Gaps = 2/54 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           QC  CGK  ++   LRTH  +HTG+ P++C  E C+K F+ K N+  HL THQK
Sbjct: 544 QCGYCGKRFTQGGNLRTHQRLHTGEKPYEC--ELCDKKFSRKGNLAAHLLTHQK 595

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 24/48 (50%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRH 233
           +C +C K  SR   L  H L H    PF C  ++CN+SF    NM  H
Sbjct: 572 ECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMKAH 619

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           C  CGK  ++   LRTH  +HTG+ P+ C    C+K F+ K N+  HL THQK
Sbjct: 623 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 673

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIAKK 244
           C IC K  SR   L  H + H    PF C  E+CNK+F      L +++ HQ +  K+
Sbjct: 651 CDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTF----TQLGNMKAHQNRFHKE 704

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 33/53 (62%)

Query: 188 PICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           P CGK   R   +R+H   H  D P++C ++ C+K+F    +++RH +THQ+K
Sbjct: 561 PQCGKTFKRRYNIRSHIQTHLEDRPYRCDYDGCDKAFVRNHDLVRHKKTHQEK 613

 Score = 28.5 bits (62), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 24/49 (48%)

Query: 189 ICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           I  K+ + P      Y+    D  ++C +  C K+F  + N+  H++TH
Sbjct: 532 ITRKLTTLPRGSIDVYVKELPDRMYECLYPQCGKTFKRRYNIRSHIQTH 580

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQ 238
           QC  CGK  ++   LRTH  +HTG+ P++C  + C K F+ K N+  H+ TH+
Sbjct: 516 QCEYCGKRFTQGGNLRTHVRLHTGERPYEC--DKCGKRFSRKGNLAAHMLTHE 566

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 24/48 (50%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRH 233
           +C  CGK  SR   L  H L H    PF+C  + CNKSF    NM  H
Sbjct: 544 ECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAH 591

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           +CP C K  ++ + L  H   H G  PF+C  E+C K F    N+  H+R H
Sbjct: 488 KCPYCHKCFTQSTHLEVHVRSHIGYKPFQC--EYCGKRFTQGGNLRTHVRLH 537

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQ 238
           +C  CGK  ++   LRTH  +HTG+ PFKC  + C+K+F  + N+  H  TH+
Sbjct: 509 ECEFCGKRFTQAGNLRTHRRLHTGERPFKC--DKCDKTFARRGNLTAHEFTHE 559

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           QC  C K+ S+ + L  H   H G  PF+C  E C K F    N+  H R H
Sbjct: 481 QCAYCSKMFSQSTHLDVHIKAHMGYKPFEC--EFCGKRFTQAGNLRTHRRLH 530

>Kwal_14.2543
          Length = 711

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           +C  CGK  +  S+LR H   HTG+ P +C    C K FN  SN+ +H+RTH++K
Sbjct: 635 KCSHCGKGFATSSSLRIHIRTHTGEKPLECKV--CGKRFNESSNLSKHMRTHERK 687

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 173 IQKQLRAVVKLRK-QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNML 231
           + + LR   + +  +C  C K  S    L+ H   H+G+ P+KC+  HC K F   S++ 
Sbjct: 593 LLRHLRVHTRYKPCKCVHCLKTFSTQDILQQHMRTHSGEKPYKCS--HCGKGFATSSSLR 650

Query: 232 RHLRTH 237
            H+RTH
Sbjct: 651 IHIRTH 656

 Score = 35.8 bits (81), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 190 CGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           CG+V ++   L  H  +HT   P KC   HC K+F+ +  + +H+RTH
Sbjct: 583 CGRVITQRQKLLRHLRVHTRYKPCKCV--HCLKTFSTQDILQQHMRTH 628

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 18/31 (58%)

Query: 209 GDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           G + + C WE+C +    +  +LRHLR H +
Sbjct: 572 GKSSYVCGWENCGRVITQRQKLLRHLRVHTR 602

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 186 QC--PICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           QC  P CGK+ +R   +R+H   H  D PF+C  E C K+F    +++RH +TH +K
Sbjct: 675 QCLYPECGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKAFVRNHDLIRHKKTHAEK 731

 Score = 32.7 bits (73), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 22/46 (47%)

Query: 192 KVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           K  + P      Y+    D  F+C +  C K FN + N+  H++TH
Sbjct: 653 KASNLPQGEIDQYIKKLQDKTFQCLYPECGKLFNRRYNIRSHIQTH 698

>Kwal_47.17888
          Length = 786

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQ 238
           QC  CGK  ++   LRTH  +HTG+ P++C  E C + F+ K N+  H  TH+
Sbjct: 532 QCEYCGKRFTQGGNLRTHVRLHTGEKPYEC--EKCGRRFSRKGNLAAHRLTHE 582

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 28/62 (45%), Gaps = 5/62 (8%)

Query: 177 LRAVVKLRK-----QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNML 231
           LR  V+L       +C  CG+  SR   L  H L H    PF C  + CNKSF    NM 
Sbjct: 546 LRTHVRLHTGEKPYECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMK 605

Query: 232 RH 233
            H
Sbjct: 606 AH 607

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           +CP C K  ++ + L  H   H G  PF+C  E+C K F    N+  H+R H
Sbjct: 504 ECPYCHKCFTQSTHLEVHVRSHIGYKPFQC--EYCGKRFTQGGNLRTHVRLH 553

>Scas_687.33
          Length = 288

 Score = 49.7 bits (117), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH----QKKI 241
           +CPIC +   R    + H   HTG+ P  CT+ HC KSF+    + RH+R H     ++I
Sbjct: 18  RCPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDELKRHIRIHLGLPSRRI 77

Query: 242 AKK 244
            KK
Sbjct: 78  RKK 80

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 49.7 bits (117), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 33/59 (55%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIAKK 244
           +C IC +   R    + H   HTG+ P KCT + C KSF+    + RHLRTH K + ++
Sbjct: 18  RCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTKGVQRR 76

>Scas_711.56
          Length = 832

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKI 241
           +C ICGK  +  S+L+ H   HTG+ P  C    C K+FN  SN+ +H++TH K+ 
Sbjct: 755 KCDICGKRFAISSSLKIHIRTHTGEKPLHCKI--CGKAFNESSNLSKHMKTHLKRF 808

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           QC IC K  S   TL+ H   H+G+ PFKC    C K F + S++  H+RTH
Sbjct: 727 QCSICKKHFSNEETLKQHERTHSGEKPFKCDI--CGKRFAISSSLKIHIRTH 776

 Score = 33.1 bits (74), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 190 CGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           C K+ S+   L  H  +H+G  PF+C+   C K F+ +  + +H RTH
Sbjct: 703 CHKIFSQRQRLVRHMRVHSGYKPFQCSI--CKKHFSNEETLKQHERTH 748

 Score = 31.6 bits (70), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 20/29 (68%)

Query: 209 GDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           G + ++C W +C+K F+ +  ++RH+R H
Sbjct: 692 GQSQYECHWANCHKIFSQRQRLVRHMRVH 720

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           +C +C K  S  S+LR H   HTG+ P  C    CNK FN  SN+ +H+RTH+++
Sbjct: 721 KCHLCPKSYSTSSSLRIHIRTHTGEKPLSCPI--CNKRFNESSNLAKHIRTHKRE 773

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 190 CGKVCSRPSTLRTH---YLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           C K      +L  H   + + +G + +KC WE CNK F  K  ++RHL+ H K
Sbjct: 636 CNKEFDSAKSLNEHIENFHVPSGLSSYKCEWEGCNKVFVQKQKLIRHLKVHSK 688

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 190 CGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           C KV  +   L  H  +H+   PF+C    C K FN +  + +HLR H
Sbjct: 669 CNKVFVQKQKLIRHLKVHSKYKPFRCA--ECGKCFNTQDILTQHLRVH 714

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQ 238
           C  CGK  ++   LRTH  +HTG+ P++C  E C + F+ K N+  H  TH 
Sbjct: 553 CEFCGKRFTQGGNLRTHIRLHTGEKPYEC--ERCGRKFSRKGNLAAHKLTHD 602

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 24/48 (50%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRH 233
           +C  CG+  SR   L  H L H    PF+C  + CNK+F    NM  H
Sbjct: 580 ECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNMKAH 627

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           QCP C K  ++ + L  H   H G  PF C  E C K F    N+  H+R H
Sbjct: 524 QCPYCHKYFTQSTHLEVHVRSHIGYKPFSC--EFCGKRFTQGGNLRTHIRLH 573

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%)

Query: 188 PICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIA 242
           P CGK   R   +++H   H  D P+KC +E C K+F    ++ RH +TH K  +
Sbjct: 528 PNCGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKKTHDKHFS 582

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           +C IC K  +  S+L+ H   HTG+ P +C    C K FN  SN+ +H++THQKK
Sbjct: 797 KCHICNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTHQKK 849

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           +C  C +  S   TL  H   H+G+ P+KC    CNK F + S++  H+RTH
Sbjct: 769 KCKTCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTH 818

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 190 CGKVCSRPSTLRTHY-LIHT--GDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           C K  S    L  H   +H   G + ++C W  C+++F  +  ++RHL+ H K
Sbjct: 712 CNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSK 764

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           +C  C K  +  S+LR H   HTG+ P KC    C K FN  SN+ +H++TH++K
Sbjct: 687 KCTYCTKQFATSSSLRIHIRTHTGEKPLKCKI--CGKRFNESSNLSKHMKTHERK 739

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           +CP C K  S    L+ H   H+G+ PFKCT+  C K F   S++  H+RTH
Sbjct: 659 KCPHCTKKFSTEDILQQHIRTHSGERPFKCTY--CTKQFATSSSLRIHIRTH 708

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 190 CGKVCSRPSTLRTHYL---IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           C +V   P  L  H     I  G + ++C+W+ C+KSF  +  +LRHL+ H
Sbjct: 602 CSQVFPNPEALNNHIESQHIPRGQSSYQCSWDTCSKSFTQRQKLLRHLKVH 652

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 190 CGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           C K  ++   L  H  +H+G  PFKC   HC K F+ +  + +H+RTH
Sbjct: 635 CSKSFTQRQKLLRHLKVHSGYKPFKCP--HCTKKFSTEDILQQHIRTH 680

 Score = 31.6 bits (70), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 8/57 (14%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIA 242
           +C ICGK  +  S L  H   H  +  +KC  E C +SF    N L  LR HQ + +
Sbjct: 715 KCKICGKRFNESSNLSKHMKTH--ERKYKC--EKCKRSF----NQLEQLRLHQNRCS 763

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 181 VKLRKQ--CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQ 238
           ++LR++  C +CGK  +    L  H  IHTG+    C +E C + FN   N L+H +TH 
Sbjct: 396 IELRRKYLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYKTHL 455

Query: 239 KKI 241
           K++
Sbjct: 456 KRL 458

>Kwal_56.23925
          Length = 745

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%)

Query: 188 PICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           P CGK   R   +R+H   H  D P+ C +E C+K+F    +++RH +TH +K
Sbjct: 590 PDCGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFVRNHDLIRHKKTHAEK 642

 Score = 28.5 bits (62), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 4/50 (8%)

Query: 192 KVCSRPSTLR----THYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           K+  +P+TL       ++    D  F+C    C K+F  + N+  H++TH
Sbjct: 560 KITKKPTTLPPGEIDKFVKELPDKTFECLHPDCGKTFRRRYNIRSHIQTH 609

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           C  C K  S  S+LR H   HTG+ P  CT   C K FN  SN+ +H++ H++K
Sbjct: 574 CHYCRKQFSTSSSLRVHIRTHTGEKPLSCTV--CGKRFNESSNLSKHMKIHERK 625

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           CP C K  S    L  H   H+G+ PF C +  C K F+  S++  H+RTH
Sbjct: 546 CPHCPKTFSTDDILAQHIRTHSGERPFHCHY--CRKQFSTSSSLRVHIRTH 594

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           C +CGKV SRP  L++H   HT + P++C+   C K+F  + +  RH   H  K
Sbjct: 523 CEVCGKVFSRPYNLKSHLRTHTDEKPYQCSI--CGKAFARQHDKKRHEDLHTGK 574

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 7/58 (12%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKC-------TWEHCNKSFNVKSNMLRHLRT 236
           QC ICGK  +R    + H  +HTG   + C       T+  C K F     + RH +T
Sbjct: 550 QCSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHFKT 607

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           +C IC K  +  ++L+ H   HTG+ P KC    C + FN  SN+ +H++TH KK
Sbjct: 626 ECHICHKRFAISNSLKIHIRTHTGEKPLKCKV--CGRCFNESSNLSKHMKTHMKK 678

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           QCP C K  S   TL  H  +H+G+ P++C    C+K F + +++  H+RTH
Sbjct: 598 QCPQCQKCFSTEDTLNQHKRVHSGEKPYECHI--CHKRFAISNSLKIHIRTH 647

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 209 GDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           G + + C WE CNK+F+ +  ++RHL+ H K
Sbjct: 563 GKSQYTCEWEGCNKTFSQRQKLVRHLKVHSK 593

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 184 RKQCPI--CGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           R  CPI  CGK  SRP  LR H   HT + PF C    C+K+F   S++  H+ +H K
Sbjct: 7   RYVCPIESCGKKYSRPCLLRQHVRSHTNEKPFHCPEPGCDKAFLRPSHLRVHMLSHSK 64

 Score = 40.0 bits (92), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 188 PICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           P C K   RPS LR H L H+   P+ C+   C K F  K    RH +TH
Sbjct: 43  PGCDKAFLRPSHLRVHMLSHSKVKPYNCSV--CGKGFATKQQFQRHQQTH 90

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKI 241
           +C IC K  SR   L  H + H    PF C  ++CNKSF    + L ++++HQ K 
Sbjct: 12  ECDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSF----SQLGNMKSHQNKF 63

>Kwal_47.19045
          Length = 266

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           +C +CGK   R    R H   HTG+ P  C +  C K F+    + RH+RTH
Sbjct: 15  KCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTH 66

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score = 42.7 bits (99), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 32/64 (50%), Gaps = 1/64 (1%)

Query: 180 VVKLRKQ-CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQ 238
           V K RK  C  CGK  +    L  H  IHTG+    C +  C + F+   N L+H RTH 
Sbjct: 74  VEKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHL 133

Query: 239 KKIA 242
           K+ A
Sbjct: 134 KRTA 137

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 28/58 (48%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIAKK 244
           C ICG    R      H   HTG+ PF CT   C K F+    + RH++TH K   +K
Sbjct: 14  CEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTHFKSRKRK 71

>Scas_718.44
          Length = 266

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 28/54 (51%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           C IC    +    L  H  IHTG+    C +E CN+ F+   N L+H RTH KK
Sbjct: 212 CKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDNCLQHYRTHLKK 265

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQ 238
           CPIC +   R      H   HTG+ P  C +  C K F+ +  + RH R H+
Sbjct: 24  CPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRHRRIHE 75

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           +C IC +   R    + H+  HTG+ P KC +  C KSF+    + RH RTH
Sbjct: 21  RCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHSRTH 72

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score = 43.1 bits (100), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 28/54 (51%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           C IC    +    L  H  IHTG+    C  E CN+SF+   N L+H RTH KK
Sbjct: 254 CQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHSKK 307

>Kwal_23.5400
          Length = 429

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           QC +C +  SR + L  H   H+ D PFKC++  C K    K  + RH  TH +
Sbjct: 82  QCTVCARQFSRKTHLERHMFSHSEDKPFKCSY--CGKGVTTKQQLRRHEITHTR 133

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 190 CGKVCSRPSTLRTHY-LIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           C K  SRPS L  H  ++H G  PF+CT   C + F+ K+++ RH+ +H
Sbjct: 57  CSKAFSRPSQLTEHQEVVHQGIKPFQCTV--CARQFSRKTHLERHMFSH 103

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 1/58 (1%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNK-SFNVKSNMLRHLRTHQKKIA 242
           QCP CGK C     L+ H  IH+         E CN   F  K +++ H   H K + 
Sbjct: 224 QCPECGKACVGEQGLQMHMKIHSNAVIKNWKCETCNDLYFAKKIDLMAHYMEHHKDLV 281

 Score = 29.3 bits (64), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 7/67 (10%)

Query: 176 QLRA---VVKLRK-QCPICGKVCSRPSTLRTHYLIHTGDT---PFKCTWEHCNKSFNVKS 228
           QLRA      L+K  C ICGK   RP  L+ H   H        ++C+   C ++F   S
Sbjct: 151 QLRAHILAFHLQKLNCEICGKRFQRPYRLKNHIAKHHNPDVVQKYQCSQGSCIEAFKTWS 210

Query: 229 NMLRHLR 235
            + +H++
Sbjct: 211 ALQQHMK 217

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 7/71 (9%)

Query: 175 KQLRAVVKLRKQ-----CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSN 229
           ++L +V   RK      C +CGK  +RP  L++H   HT + PF C+   C K+F  + +
Sbjct: 554 EKLDSVTNNRKNPANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHD 611

Query: 230 MLRHLRTHQKK 240
             RH   H  K
Sbjct: 612 RKRHEDLHTGK 622

 Score = 32.7 bits (73), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 25/61 (40%), Gaps = 7/61 (11%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWE-------HCNKSFNVKSNMLRHLRTHQK 239
           C ICGK  +R    + H  +HTG   + C  +        C K F     + RH +T   
Sbjct: 599 CSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTESG 658

Query: 240 K 240
           +
Sbjct: 659 R 659

>Scas_713.52
          Length = 620

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%)

Query: 190 CGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIA 242
           CGK+  R   +R+H   H  D P+ C +  C K+F    +++RH ++H  + +
Sbjct: 487 CGKIFKRRYNVRSHIQTHLEDKPYACDFPGCEKAFVRNHDLVRHKKSHANRTS 539

 Score = 34.3 bits (77), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 7/64 (10%)

Query: 181 VKLRKQCPICG---KVCSRPSTLRTH----YLIHTGDTPFKCTWEHCNKSFNVKSNMLRH 233
           VK +++ PI     ++ ++PSTL       Y+    D  F+C +E C K F  + N+  H
Sbjct: 441 VKQQQRTPIKTSPTRITNKPSTLPRGTIDLYVKELPDKLFECLYEDCGKIFKRRYNVRSH 500

Query: 234 LRTH 237
           ++TH
Sbjct: 501 IQTH 504

>Scas_693.31
          Length = 635

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%)

Query: 188 PICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           P CGK   R    R+H   H  D P+ C + +C+K+F    +++RH + H +K
Sbjct: 494 PNCGKHFKRRYNTRSHIQTHLEDRPYACDFPNCDKAFVRNHDLVRHKKVHSEK 546

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 186 QCPICGKVCSRPSTLRTHYL-IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           +C  C K   R   L+ H   +H+ D PF CT+  C+K F+   N+ +HL+TH+K
Sbjct: 505 KCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTY--CDKKFSRSDNLSQHLKTHRK 557

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%)

Query: 188 PICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           P C K   R   +R+H   H  D P+ C    C+K+F    +++RH ++HQ+K
Sbjct: 555 PGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKKSHQEK 607

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 189 ICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           I  K+ + P      Y+    D  F+C +  C K+F  + N+  H++TH
Sbjct: 526 ITRKLTTLPRGSIDKYVKEMPDKTFECLFPGCTKTFKRRYNIRSHIQTH 574

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           CPICG+   R      H   HTG+ P  C +  C K F+    + RH R H
Sbjct: 45  CPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 95

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%)

Query: 175 KQLRAVVKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHL 234
           K L    + +  C IC +  +    L  H  IHTG+   +C +  CN+ F+   N ++H 
Sbjct: 274 KDLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHY 333

Query: 235 RTHQK 239
           RTH K
Sbjct: 334 RTHFK 338

>Scas_712.42*
          Length = 290

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           +C  C +   R    + H   HTG+ P  C +  C K F+    + RHLRTH
Sbjct: 19  RCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRTH 70

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           +C  C +   R    + H   HTG+ P  C +  C KSF+    + RH+RTH
Sbjct: 18  RCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTH 69

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           CPIC +   R      H  IHTG+ P  C +  C K F+    + RH R H
Sbjct: 40  CPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 90

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query: 173 IQKQLRAVVKLRKQCPI--CGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNM 230
           I K +  +   + QC    C K  +R    RTH   H  D P+KC +  C K+F    ++
Sbjct: 681 IDKYILEIGPKQFQCKFKDCQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFVRNHDL 740

Query: 231 LRHLRTHQKK 240
           LRH ++H +K
Sbjct: 741 LRHKKSHLEK 750

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 23/51 (45%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           CPIC +   R      H   HTG+ P  C +  C K F+    + RH R H
Sbjct: 36  CPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRIH 86

>Kwal_14.2278
          Length = 463

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 23/51 (45%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           CPIC +   R      H   HTG+ P  C +  C K F+    + RH R H
Sbjct: 25  CPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRHKRIH 75

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%)

Query: 188 PICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           P C KV  R   +R+H   H  D P+ C +  C K+F    +++RH  +H  K
Sbjct: 608 PNCNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISHNAK 660

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 192 KVCSRPSTL----RTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           K+  +P+TL       Y+    D  F+C + +CNK F  + N+  H++TH
Sbjct: 578 KITKKPTTLPPGTIDQYVKELPDKLFECLYPNCNKVFKRRYNIRSHIQTH 627

>Scas_709.32
          Length = 822

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 186 QCPICGKVCSRPSTLRTHYL-IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           +C  CGK   R   L+ H   +H+ + PF C    C+K F+   N+ +H++TH+K+
Sbjct: 766 KCETCGKAFRRSEHLKRHIRSVHSSERPFACPT--CDKKFSRSDNLAQHIKTHKKR 819

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score = 40.0 bits (92), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           C IC +  +    L  H  IHTG+    C ++ C + F+   N L+H RTH KK
Sbjct: 176 CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLKK 229

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score = 39.3 bits (90), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%)

Query: 182 KLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           + R  C IC +  +    L  H  IHTG+    C +E C + F+   N ++H RTH K
Sbjct: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154

>Scas_712.2
          Length = 327

 Score = 40.4 bits (93), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 190 CGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIAK 243
           CGK   RP  L+ H   H+   P KC +  C K F     + RHL TH KK  K
Sbjct: 50  CGKRFMRPCHLKVHKWTHSKVKPLKCAF--CEKGFITNQQLKRHLNTHAKKSRK 101

 Score = 32.0 bits (71), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%)

Query: 190 CGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           C +  +RP  L+ H   HT + P+ C  E C K F    ++  H  TH K
Sbjct: 20  CHREFTRPCLLQQHRYSHTNERPYICDVEGCGKRFMRPCHLKVHKWTHSK 69

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 40.4 bits (93), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 188 PICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIA 242
           P CGK   RP  LR H   H    P KC++  C + F     + RH  TH+++IA
Sbjct: 92  PNCGKRFLRPCHLRVHKWTHAQVKPLKCSY--CERRFITNQQLKRHTNTHERRIA 144

 Score = 30.0 bits (66), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 8/55 (14%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLR--HLRTHQ 238
           Q   C +  S PS L  H   HT + P+ C   +C K F      LR  HLR H+
Sbjct: 60  QIDGCKREFSVPSLLAQHRNAHTDERPYVCDEPNCGKRF------LRPCHLRVHK 108

>Kwal_27.10167
          Length = 285

 Score = 40.0 bits (92), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 188 PICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIA 242
           P CGK   R   +  H   H+   P KC  E C+K F  K  + RHL TH+K+ A
Sbjct: 70  PNCGKRFLRVCHMNVHRWTHSKIKPLKC--EECSKGFTTKQQLSRHLATHKKRNA 122

>Kwal_27.11460
          Length = 531

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRH--LRTHQKK 240
           C +C K  +RP  L++H   HT + PF C    C K+F  + +  RH  L T QK+
Sbjct: 415 CELCDKKFTRPYNLKSHLRTHTDERPFSCAI--CGKAFARQHDRKRHEDLHTGQKR 468

 Score = 35.4 bits (80), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 25/62 (40%), Gaps = 9/62 (14%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKC--------TWEHCNKSFNVKSNMLRHLRTHQ 238
           C ICGK  +R    + H  +HTG   + C         W  C K F     + RH +T  
Sbjct: 443 CAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEW-GCGKKFARSDALGRHFKTEG 501

Query: 239 KK 240
            K
Sbjct: 502 GK 503

>Scas_695.2
          Length = 571

 Score = 40.4 bits (93), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           C +C K  +RP  L++H   HT + PF C    C K+F  + +  RH   H  K
Sbjct: 454 CELCDKTFTRPYNLKSHLRTHTNEXPFVCNI--CGKAFARQHDRKRHEDLHTGK 505

 Score = 32.0 bits (71), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 9/62 (14%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCT--------WEHCNKSFNVKSNMLRHLRTHQ 238
           C ICGK  +R    + H  +HTG   + C         W  C+K F     + RH +T  
Sbjct: 482 CNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPW-GCHKKFARSDALGRHFKTDS 540

Query: 239 KK 240
            +
Sbjct: 541 GR 542

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           C +C K  +RP  L++H   HT + PF C+   C K+F  + +  RH   H  K
Sbjct: 428 CNLCDKKFTRPYNLKSHLRTHTDERPFSCSV--CGKAFARQHDRKRHEDLHSGK 479

 Score = 33.1 bits (74), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 26/62 (41%), Gaps = 9/62 (14%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKC--------TWEHCNKSFNVKSNMLRHLRTHQ 238
           C +CGK  +R    + H  +H+G   + C        TW  C K F     + RH +T  
Sbjct: 456 CSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATW-GCGKKFARSDALGRHFKTES 514

Query: 239 KK 240
            +
Sbjct: 515 GR 516

>Kwal_26.8351
          Length = 698

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 186 QCPICGKVCSRPSTLRTHYL-IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           +C  C K   R   L+ H   +H+ + PF C++  C+K F+   N+ +HL+TH+K
Sbjct: 642 KCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY--CDKKFSRSDNLSQHLKTHKK 694

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQ 238
           CPIC +   R      H   HTG+ P  C +  C+K F+    + RH R H 
Sbjct: 28  CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD 79

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           +C  CGK  ++ S L  H   HT D PF C+   C K    +  + RH  TH K
Sbjct: 138 KCDTCGKEFAKKSHLNRHMFSHTDDKPFTCSI--CGKGVTTRQQLKRHEITHTK 189

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRH-LRTHQKKIA 242
           C ICGK  +    L+ H + HT    F C++E CN+SF     +  H L  H+KK+ 
Sbjct: 167 CSICGKGVTTRQQLKRHEITHT--KSFHCSYEGCNESFYKHPQLRSHILSVHEKKLT 221

 Score = 33.5 bits (75), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 6/59 (10%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHC----NKSFNVKSNMLRHLRTHQKKI 241
           CPICGK C   S LR H +IH      K  W+ C    + SF  K+ +++H     K +
Sbjct: 281 CPICGKPCVAESGLRNHMMIHDESLVTK-NWK-CSSCPDTSFAKKTQLVQHYEESHKDV 337

>Scas_575.3
          Length = 455

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           CPIC +   R      H   HTG+ P +C +  C K F+    + RH R H
Sbjct: 70  CPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHKRIH 120

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 186 QCPICGKVCSRPSTLRTHYL-IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           QC  C K   R   L+ H   +H+ + PF C +  C K F+   N+ +HL+TH++
Sbjct: 485 QCADCDKAFRRSEHLKRHVRSVHSTERPFPCMF--CEKKFSRSDNLSQHLKTHKR 537

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 186 QCPICGKVCSRPSTLRTHYL-IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           +C  C K   R   L+ H   +H+ + PF C +  C+K F+   N+ +HL+TH+K
Sbjct: 622 KCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF--CDKKFSRSDNLSQHLKTHKK 674

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 187 CPICGKVCSRPSTLRTHYL-IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           C +C K   R   L+ H   +H+ D PF C    C K F+   N+ +H++TH+K
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHL--CEKKFSRSDNLSQHIKTHKK 588

>Kwal_27.10925
          Length = 264

 Score = 38.1 bits (87), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 2/68 (2%)

Query: 175 KQLRAVVKLRKQ--CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLR 232
           K+ R+ V+ R++  C IC K  +    L  H  IHTG+    C  E C + F+   N ++
Sbjct: 189 KRTRSPVEQRRRYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQ 248

Query: 233 HLRTHQKK 240
           H +TH ++
Sbjct: 249 HYKTHLRR 256

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           +C  C +   R    + H   HTG+ P  C++  C KSF+    + RH RTH
Sbjct: 18  KCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHNRTH 69

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 188 PICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           P CGK   RP  LR H   H+   P  CT   C K F     + RHL +H++K
Sbjct: 47  PGCGKKFIRPCHLRVHKWTHSQIKPKACTL--CQKRFVTNQQLRRHLNSHERK 97

 Score = 32.0 bits (71), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 8/51 (15%)

Query: 190 CGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLR--HLRTHQ 238
           C KV +RPS L+ H   HT   P+ C    C K F      +R  HLR H+
Sbjct: 19  CEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKF------IRPCHLRVHK 63

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 186 QCPICGKVCSRPSTLRTHYL-IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           +C  C K   R   L+ H   +H+ + PF C +  C K F+   N+ +HL+TH+K
Sbjct: 574 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKK 626

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLR 235
           QC +C K   R S L+ H L H+    F C W  C+ +   K N+L+HL+
Sbjct: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 37.0 bits (84), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRH 233
           CPIC +  +R   L+ H   HT + PF C +  C + F  +  +LRH
Sbjct: 50  CPICTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 94

>Scas_649.28
          Length = 730

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 186 QCPICGKVCSRPSTLRTHYL-IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           +C  C K   R   L+ H   +H+ + PF C +  C K F+   N+ +HL+TH+K
Sbjct: 674 KCSECIKAFRRSEHLKRHIRSVHSSERPFACMF--CEKKFSRSDNLSQHLKTHKK 726

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRH 233
           CPIC +  +R   LR H   HT + PF C +  C + F  +  +LRH
Sbjct: 85  CPICTRGFARQEHLRRHERSHTNEKPFLCAF--CGRCFARRDLVLRH 129

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 36.6 bits (83), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%)

Query: 190 CGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           CGK+ SRP  L  H   HT + PF C    C K F   S++  H  +H +
Sbjct: 15  CGKMYSRPCLLEQHRRSHTNERPFVCEEPGCGKGFLRASHLKVHKWSHSQ 64

>Scas_569.2
          Length = 293

 Score = 36.6 bits (83), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 174 QKQLRAVVKLRKQ-CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLR 232
           +K    + K RK  C +C K  +    L  H  IHTG+    C++  C   F+   N ++
Sbjct: 216 RKHEEELEKRRKYICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQ 275

Query: 233 HLRTHQK 239
           H RTH K
Sbjct: 276 HYRTHFK 282

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           C IC K  +RP  L++H   HT + P+ C+   C K+F    +  RH   H  K
Sbjct: 471 CDICDKKFTRPYNLKSHLRSHTDERPYVCSV--CGKAFARMHDKNRHEDLHTGK 522

 Score = 31.6 bits (70), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 25/62 (40%), Gaps = 9/62 (14%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKC--------TWEHCNKSFNVKSNMLRHLRTHQ 238
           C +CGK  +R      H  +HTG   + C        +W  C K F     + RH +T  
Sbjct: 499 CSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSW-GCGKKFARSDALGRHFKTEL 557

Query: 239 KK 240
            K
Sbjct: 558 GK 559

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 36.6 bits (83), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 5/61 (8%)

Query: 180 VVKLRKQ--CPICGKVCSRPSTLRTHYL-IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRT 236
           V  L KQ  C  C +   R   L+ H   +H G+ P++C    CNK F+   N+ +H++T
Sbjct: 257 VPDLSKQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHI--CNKKFSRSDNLNQHIKT 314

Query: 237 H 237
           H
Sbjct: 315 H 315

>KLLA0F07073g 675221..676897 some similarities with sgd|S0004367
           Saccharomyces cerevisiae YLR375w STP3 involved in
           pre-tRNA splicing and in uptake of branched-chain amino
           acids, hypothetical start
          Length = 558

 Score = 36.6 bits (83), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 36/58 (62%), Gaps = 5/58 (8%)

Query: 184 RKQCPICGKVCSRPSTLRTHYLIHTGDT-PFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           +KQCP+CG   S  ST ++ +L  + +T PFKC  E C++ F   ++++RH + H K 
Sbjct: 383 KKQCPLCGLFFSNLSTHKSTHL--SPETRPFKC--EVCSRGFARSNDLIRHKKLHWKD 436

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 36.2 bits (82), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 7/73 (9%)

Query: 176 QLRA---VVKLRK-QCPICGKVCSRPSTLRTHYLIHTG---DTPFKCTWEHCNKSFNVKS 228
           QLRA    V L K  CP C K   RP  LR H   H     + P++CT+  C K F + S
Sbjct: 150 QLRAHILSVHLHKLTCPHCNKSFQRPYRLRNHISKHHDPEVENPYQCTFAGCCKEFRIWS 209

Query: 229 NMLRHLRTHQKKI 241
            +  H++    K+
Sbjct: 210 QLQSHIKNDHPKL 222

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 7/67 (10%)

Query: 173 IQKQLRAVVKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLR 232
           + + LRA      QC  C K   + S L  H   H+   PF+C++  C K    +  + R
Sbjct: 73  VHQGLRAF-----QCDKCAKSFVKKSHLERHLYTHSDTKPFQCSY--CGKGVTTRQQLKR 125

Query: 233 HLRTHQK 239
           H  TH K
Sbjct: 126 HEVTHTK 132

 Score = 28.5 bits (62), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 6/52 (11%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHC----NKSFNVKSNMLRH 233
           +CPIC K C   + L+ H +IH  D+     W+ C    + SF+ K ++L H
Sbjct: 223 KCPICSKPCVGENGLQMHMIIH-DDSLVTKNWK-CHICPDMSFSRKHDLLTH 272

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 36.2 bits (82), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 187 CPICGKVCSRPSTLRTHYL-IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           C IC K   R   L+ H   +H+ + PF C    C+K F+   N+ +H++TH+K
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQHIKTHKK 700

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 7/58 (12%)

Query: 176 QLRAVVKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRH 233
           +LR+ V     C +C +  +R   L+ HY  HT + P+ C    CN+ F  +  ++RH
Sbjct: 100 KLRSFV-----CEVCTRAFARQEHLKRHYRSHTNEKPYPCGL--CNRCFTRRDLLIRH 150

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 35.8 bits (81), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           QC  CG+  ++ S L  H   H+   PF CT   C K    +  + RH  TH K
Sbjct: 151 QCEQCGRGFTKKSHLERHLFSHSETKPFSCTV--CGKGVTTRQQLRRHEITHTK 202

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 3/72 (4%)

Query: 173 IQKQLRAVVKLRKQCPICGKVCSRPSTLRTHYLIHTGDTP---FKCTWEHCNKSFNVKSN 229
           ++  + AV + +  C  C K   RP  L+TH   H G      ++CT   C + F   S 
Sbjct: 221 LRSHVLAVHEQKLTCTHCDKRFQRPYRLKTHIAKHHGPASQFRYQCTNAGCVQCFETWSA 280

Query: 230 MLRHLRTHQKKI 241
           + +HL T   K+
Sbjct: 281 LQQHLHTDHPKL 292

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 35.4 bits (80), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 187 CPICGKVCSRPSTLRTHYL-IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           C  C +   R   L+ H   +H G+ P+ C  E C K F+   N+ +H++TH
Sbjct: 356 CEFCDRRFKRQEHLKRHVRSLHMGEKPYGC--EICGKKFSRSDNLNQHIKTH 405

 Score = 28.9 bits (63), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 12/24 (50%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGD 210
           C ICGK  SR   L  H   H GD
Sbjct: 385 CEICGKKFSRSDNLNQHIKTHGGD 408

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 35.4 bits (80), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLR 235
           +C +C K+  R S L+ H L H+    F C W  CN     + N+L+H++
Sbjct: 535 RCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPW--CNSRHKRRDNLLQHMK 582

>Kwal_47.17241
          Length = 403

 Score = 35.4 bits (80), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 187 CPICGKVCSRPSTLRTHYL-IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           C  C +   R   L+ H   +H G+ PF C    C K F+   N+ +H++TH
Sbjct: 348 CDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHI--CGKKFSRSDNLNQHIKTH 397

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score = 34.7 bits (78), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 27/62 (43%)

Query: 179 AVVKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQ 238
           A  + R  C IC    +    L  H  IHTG+    C  E C + F+   N  +H RTH 
Sbjct: 147 AGQRTRHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYRTHA 206

Query: 239 KK 240
            K
Sbjct: 207 NK 208

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRH 233
           CP+C +  +R   L+ H   HT + PF C +  C + F  +  +LRH
Sbjct: 82  CPVCTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 126

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 35.0 bits (79), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLR 235
           +C  C K   R S L+ H L H+   P+ C W  C+     K N+ +HL+
Sbjct: 186 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLK 233

>Scas_602.9
          Length = 547

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 187 CPICGKVCSRPSTLRTHYL-IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           C  C +   R   L+ H   +H G+ P+ C    CNK+F+   N+ +H++TH
Sbjct: 497 CDYCERRFKRQEHLKRHVRSLHIGEKPYACHI--CNKNFSRSDNLTQHIKTH 546

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 35.0 bits (79), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLR 235
           CPIC +   R   L+ H   HT + PF C    C K F  K  +LRHL+
Sbjct: 29  CPICSRGFVRQEHLKRHQNSHTHEKPFLCLI--CGKCFARKDLVLRHLQ 75

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 34.7 bits (78), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRT 236
           C  C +  SR      H   HTG  PF C  + CN SF  +  + RH+RT
Sbjct: 10  CSFCAQAFSRSEHKTRHERSHTGVKPFSC--KVCNHSFVRRDLLQRHIRT 57

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 34.3 bits (77), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRH 233
           CPIC +   R   L+ H   HT + PF C +  C + F  +  +LRH
Sbjct: 35  CPICTRGFVRLEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRH 79

>Kwal_26.8021
          Length = 507

 Score = 34.3 bits (77), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRT 236
           +C +C K   R S  + H L H+   P+ C W  C      + N+ +H++T
Sbjct: 390 RCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKT 438

>Scas_631.7
          Length = 433

 Score = 34.3 bits (77), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           +C  C K  SR + L  H + H+   PF C   HC K    +  + RH  TH K
Sbjct: 89  KCEQCDKQFSRKTHLERHLISHSDSKPFCCL--HCGKGVTTRQQLKRHEVTHTK 140

 Score = 32.7 bits (73), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTG---DTPFKCTWEHCNKSF 224
           C  CGK   RP  L+ H   H      TP++CT+ +C++SF
Sbjct: 173 CKHCGKKFQRPYRLQNHIAKHHNPDVKTPYQCTFANCHRSF 213

 Score = 28.9 bits (63), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 9/65 (13%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGD---TPFKCT--WEHCNK--SFNVKSNMLRHLRT-- 236
           +C IC K+C   + L+ H  +H  D     +KCT   E  +   SF  KS +L H R   
Sbjct: 231 KCSICDKLCVGENGLKMHMSVHDEDLVIKNWKCTICAEDADTFVSFPKKSELLNHYRDKH 290

Query: 237 HQKKI 241
           H+K I
Sbjct: 291 HEKDI 295

 Score = 28.5 bits (62), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 2/38 (5%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSF 224
           C  CGK  +    L+ H + HT    FKC +E+C++++
Sbjct: 118 CLHCGKGVTTRQQLKRHEVTHT--KSFKCPYENCDEAY 153

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 33.9 bits (76), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 186 QCPICGKVCSRPSTLRTHYL-IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           +C +C +   R   L+ H   +H G+ P+ C    C KSF+   N+ +H RTH
Sbjct: 219 KCDMCERRFKRQEHLKRHVSSLHMGERPYSCDI--CLKSFSRSDNLNQHKRTH 269

>CAGL0K04697g 458366..459913 some similarities with tr|Q07351
           Saccharomyces cerevisiae YDL048c STP4 or tr|Q05937
           Saccharomyces cerevisiae YLR375w STP3, hypothetical
           start
          Length = 515

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 181 VKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
            K ++QCPIC K  +  ST ++ +L  + D P KC    C   F   ++++RH + H K
Sbjct: 320 TKKKRQCPICHKYFANLSTHKSTHLT-SQDRPHKCII--CQSGFARNNDLIRHRKRHWK 375

>Scas_670.2
          Length = 435

 Score = 33.5 bits (75), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 184 RKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           +KQCPIC    +  +T +  +L+   D P KC    C + F   ++++RH + H K
Sbjct: 251 KKQCPICSGYYANLTTHKATHLVPE-DRPHKCPI--CQRGFGRNNDLIRHQKRHWK 303

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 187 CPICGKVCSRPSTLRTHYL-IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           C  C +   R   L+ H   +H G+ P+ C  + C K F+   N+ +H++TH
Sbjct: 462 CEYCERRFKRQEHLKRHIRSLHMGEKPYGC--DICGKKFSRSDNLNQHIKTH 511

>Scas_707.31
          Length = 289

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 187 CPICGKVCSRPSTLRTHY-LIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           C +C K   R   L+ H+  IH    PF+C+   C+K F+   N+ +H+R H+++
Sbjct: 225 CHLCKKRFKRHEHLKRHFRTIHLRVRPFECSV--CHKRFSRNDNLNQHVRIHEQQ 277

>Kwal_47.16621
          Length = 1178

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRH 233
           C IC +  +R   L+ H   HT + PF C +  C + F  +  +LRH
Sbjct: 80  CSICTRGFARQEHLKRHQRAHTNEKPFLCAF--CGRCFARRDLVLRH 124

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           C  C K  SR      H   HTG  PF C+   C+ SF  +  + RH+RT  K
Sbjct: 10  CSFCAKPFSRSEHKARHERSHTGSKPFSCSI--CSHSFVRRDLLQRHIRTVHK 60

>CAGL0H04873g complement(465069..466424) some similarities with
           tr|Q05937 Saccharomyces cerevisiae YLR375w STP3 or
           tr|Q07351 Saccharomyces cerevisiae YDL048c STP4,
           hypothetical start
          Length = 451

 Score = 32.7 bits (73), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 7/58 (12%)

Query: 184 RKQCPICGKVCSRPSTLRTHYLIHT--GDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           RKQCPIC       + L TH  IH      PF C+   C + F  +++++RH + H K
Sbjct: 263 RKQCPICHGFF---ANLTTHKAIHLEPDIKPFVCSV--CQRGFVRQNDVMRHEKMHWK 315

>Sklu_2206.2 YLR375W, Contig c2206 7136-8212
          Length = 358

 Score = 32.7 bits (73), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 182 KLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           + +K+CP+C    +  ST ++ +L    D P KC+   C++ F   +++LRH + H K
Sbjct: 158 RRKKECPVCHNFYANLSTHKSTHLT-PEDRPHKCSV--CSRGFARSNDLLRHKKRHWK 212

>Scas_721.92
          Length = 1152

 Score = 32.7 bits (73), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRH 233
           C +C +  +R   L  H   HT + P++C    C K F  +  +LRH
Sbjct: 80  CDVCSRAFARQEHLDRHARSHTNEKPYQCGI--CTKKFTRRDLLLRH 124

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 32.7 bits (73), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 182 KLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLR 235
           K   QC  C K   R S L+ H L H+    F C W  C      K N+L+H++
Sbjct: 343 KYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 394

>KLLA0E13519g complement(1190615..1191307) some similarities with
           sgd|S0006226 Saccharomyces cerevisiae YPR022c,
           hypothetical start
          Length = 230

 Score = 32.3 bits (72), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 6/56 (10%)

Query: 188 PICGKVCSRPSTLRTHYLIHTGDTPFKCTWEH------CNKSFNVKSNMLRHLRTH 237
           P C K  SR   L+ H L H     F+C + +      CN++F  K  ++RH R H
Sbjct: 23  PDCEKTFSRYEHLQRHKLNHWPKQIFRCEYVYPDDGIVCNRTFVRKDLLVRHQRRH 78

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 32.0 bits (71), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 187 CPICGKVCSRPSTLRTHYL-IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           C  C +   R   L+ H   +H  + PF C    CNK+F+   N+ +H++TH
Sbjct: 391 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHI--CNKNFSRSDNLNQHVKTH 440

>Scas_717.17
          Length = 525

 Score = 32.0 bits (71), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240
           C IC K   R S L+ H L H+ +  + C W  C      + N+L+H++    K
Sbjct: 390 CHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKLKHSK 441

>Scas_683.25
          Length = 879

 Score = 32.3 bits (72), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (55%), Gaps = 5/63 (7%)

Query: 184 RKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNM-LRHLRT-HQKKI 241
           R  C  C K  SR      H   HTG  P+KC  + C   F V+S++ LRH++T H+K+I
Sbjct: 14  RFICSFCAKGFSRAEHKIRHERSHTGLKPYKC--KVCTHCF-VRSDLALRHIKTVHKKEI 70

Query: 242 AKK 244
            ++
Sbjct: 71  LQR 73

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 184 RKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRT 236
           R  C  C K  SR      H   H G  PF+C  + C+ SF  +  + RH+RT
Sbjct: 11  RHFCSFCNKAFSRSEHKTRHERSHAGVKPFEC--QVCSHSFVRRDLLQRHIRT 61

>Scas_703.23
          Length = 1341

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRH 233
           CP C +   R   L+ H   HT + PF C +  C + F  +  +LRH
Sbjct: 74  CPTCTRGFVRQEHLKRHQRSHTNEKPFLCVF--CGRCFARRDLVLRH 118

>YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with strong
           similarity to Stp1p, which is involved in tRNA splicing
           and branched-chain amino acid uptake [1032 bp, 343 aa]
          Length = 343

 Score = 32.0 bits (71), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 184 RKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           +KQCPIC    +  +T +  +L    D P KC    C++ F   +++LRH + H K
Sbjct: 141 KKQCPICRNFYANLTTHKATHLT-PEDRPHKCPI--CHRGFARNNDLLRHKKRHWK 193

>Kwal_26.9300
          Length = 304

 Score = 31.6 bits (70), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 182 KLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           + +K+CPIC    +  ST R+ +L    + P KC    C + F   +++LRH + H K
Sbjct: 143 RRKKECPICHNFYANLSTHRSSHL-QPENKPHKCPV--CGRGFTRHNDLLRHRKRHWK 197

>Scas_627.6
          Length = 1207

 Score = 31.6 bits (70), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 32/75 (42%), Gaps = 8/75 (10%)

Query: 173 IQKQLRAVVKLRKQCP--ICGKVCSRPSTLRTHYLIHTGDTPFKC------TWEHCNKSF 224
           +QK  +  V  R  CP   C K  +R   L  H L H     F C      T   CNK+F
Sbjct: 30  VQKSAKLAVTERYICPHPDCNKSFTRQEHLSRHKLNHWPKEIFVCPFIFPNTNITCNKTF 89

Query: 225 NVKSNMLRHLRTHQK 239
             K  ++RH + H K
Sbjct: 90  VRKDLLIRHQKRHTK 104

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 31.2 bits (69), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRH 233
           C IC +   R   L+ H   HT + PF C +  C + F  +  +LRH
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRH 107

>YDL048C (STP4) [816] chr4 complement(366739..368211) Protein with
           strong similarity to Stp1p, which is involved in tRNA
           splicing and branched-chain amino acid uptake [1473 bp,
           490 aa]
          Length = 490

 Score = 30.8 bits (68), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 184 RKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           +K+CPIC    +  ST ++ +L    D P KC    C + F   ++++RH + H K
Sbjct: 276 KKECPICHNFYANLSTHKSTHLT-PEDRPHKCPI--CQRGFARNNDLIRHKKRHWK 328

>Scas_683.30
          Length = 478

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 179 AVVKLR--KQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRT 236
           +V K R  KQCP C    +  ST ++ +L    D P KC    C + F   ++++RH + 
Sbjct: 279 SVTKTRRKKQCPTCLNYYANLSTHKSTHLT-PEDRPHKCPI--CERGFARNNDLIRHKKR 335

Query: 237 HQKKIAKK 244
           H K   KK
Sbjct: 336 HWKDEFKK 343

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 30.0 bits (66), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 29/66 (43%), Gaps = 9/66 (13%)

Query: 179 AVVKLRKQC---PICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLR 235
           A VK   +C   P C    +R   L  H   HTG+ PF+C    C K F+   N    LR
Sbjct: 13  ASVKRNYRCVGYPDCNMSFNRTEHLARHIRKHTGEKPFQCNI--CLKFFSRIDN----LR 66

Query: 236 THQKKI 241
            HQ  +
Sbjct: 67  QHQSSV 72

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 27/57 (47%), Gaps = 3/57 (5%)

Query: 188 PICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRT-HQKKIAK 243
           P C    SR   L  H   HTG+ PFKC  + C K F+   N+ +H  T H K   K
Sbjct: 31  PGCEMSFSRAEHLARHIRRHTGEKPFKC--DICLKYFSRIDNLKQHKDTVHAKDNVK 85

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 2/38 (5%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSF 224
           C  CGK       L+ H + HT    F C +E CN+SF
Sbjct: 97  CSFCGKGLITRQQLKRHEVTHT--KSFNCEYEGCNESF 132

 Score = 29.3 bits (64), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 24/54 (44%), Gaps = 2/54 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239
           +C  C    ++   L  H   HT + PF C++  C K    +  + RH  TH K
Sbjct: 68  KCNQCESSFTKKIHLERHLYTHTDERPFYCSF--CGKGLITRQQLKRHEVTHTK 119

 Score = 28.5 bits (62), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 7/73 (9%)

Query: 176 QLRA---VVKLRK-QCPICGKVCSRPSTLRTHYLIHTG---DTPFKCTWEHCNKSFNVKS 228
           QLRA    V L+  +C  C K   RP  L+ H   H        ++CT+  C+KSF   S
Sbjct: 137 QLRAHILAVHLQSLKCHECNKSFQRPYRLKNHIAKHHNPDVVNAYQCTFSVCSKSFKTWS 196

Query: 229 NMLRHLRTHQKKI 241
            +  H++    K+
Sbjct: 197 ALRLHVKNDHPKL 209

>AAR170W [358] [Homologous to ScYGL125W (MET13) - SH]
           complement(647776..649587) [1812 bp, 603 aa]
          Length = 603

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 15/28 (53%)

Query: 209 GDTPFKCTWEHCNKSFNVKSNMLRHLRT 236
           GD P + TWE C   F    +++ H+R 
Sbjct: 117 GDPPLQGTWEPCAGGFRYAKDLVAHIRA 144

>Kwal_47.16577
          Length = 881

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 5/60 (8%)

Query: 188 PICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFN----VKSNMLRHLRTHQKKIAK 243
           P C K  SR   L  H   H+ +  +KC W  C + F+     K +  RHLR   + +++
Sbjct: 18  PGCSKSFSRSDHLGRHKANHSSEK-YKCEWPACGREFSRLDVKKKHFGRHLRDVDETVSR 76

>Scas_378.1
          Length = 208

 Score = 29.6 bits (65), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLR 235
           QC +C K   R S L+ H L H+    + C    C      K N+L+HL+
Sbjct: 85  QCHMCVKSFRRHSWLKRHLLAHSSQRHYSCP--KCVSKHKRKDNLLQHLK 132

>Sklu_1527.1 YPL038W, Contig c1527 389-1006
          Length = 205

 Score = 29.3 bits (64), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 2/51 (3%)

Query: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRT 236
           QC  C  V  R S LR H   H    P  C+   C K F  K  + RH  T
Sbjct: 126 QCDKCELVFRRSSDLRRHERAHLPILPNICSL--CGKGFARKDALKRHYDT 174

>KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyces
           lactis RIM101 homologue, start by similarity
          Length = 517

 Score = 29.6 bits (65), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 200 LRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIA 242
           + +H  +H    PF C+   CNK F    ++ +HL+ H ++++
Sbjct: 164 ITSHLRVHVQLKPFACST--CNKKFKRPQDLKKHLKVHNEELS 204

>YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protein
           involved in transcriptional regulation of methionine
           metabolism, has two tandem C2H2-type zinc fingers [534
           bp, 177 aa]
          Length = 177

 Score = 28.9 bits (63), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRT 236
           C  C    SR S LR H  +H+   P  C+  +C K F  K  + RH  T
Sbjct: 97  CAKCQLKFSRSSDLRRHEKVHSLVLPHICS--NCGKGFARKDALKRHSNT 144

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 29.6 bits (65), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 187 CPICGKVCSRPSTLRTHYL-IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237
           C  C +   R   L+ H   +H  + P+ C    C K F+   N+ +HL+TH
Sbjct: 420 CEYCDRRFKRQEHLKRHIRSLHICEKPYGCHL--CGKKFSRSDNLSQHLKTH 469

>CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 or tr|Q03081
           Saccharomyces cerevisiae YPL038w MET31, hypothetical
           start
          Length = 223

 Score = 28.9 bits (63), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 2/47 (4%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRH 233
           C  C    +R S LR H   H    P+ CT   C K F  K  + RH
Sbjct: 144 CSQCSLKFNRSSDLRRHERAHLLVLPYICT--QCGKGFARKDALKRH 188

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 6/58 (10%)

Query: 188 PICGKVCSRPSTLRTHYLIHTGDTPFKCTW------EHCNKSFNVKSNMLRHLRTHQK 239
           P C K  SR   L  H L H     + C++        CNK+F  K  ++RH + H K
Sbjct: 36  PECNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTFVRKDLLIRHEKRHSK 93

>Scas_719.68
          Length = 1350

 Score = 28.9 bits (63), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 181 VKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRH 233
           +K  K  P    +C+R   L+ H   HT + PF C +  C + F  +  +LR+
Sbjct: 33  IKTDKPRPFLCPICTRTEHLKRHQRSHTREKPFVCVF--CGRCFARRDLVLRY 83

>YNL278W (CAF120) [4332] chr14 (113269..116451) Protein containing
          a pleckstrin homology (PH) domain, which mediate
          protein-protein and protein-lipid interactions, has
          moderate similarity to uncharacterized S. cerevisiae
          Ylr187p [3183 bp, 1060 aa]
          Length = 1060

 Score = 28.9 bits (63), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 5  KTLESMLCSPMKCSSSNIGGSYAQSSKEVSNTTKREVHL-PPCSSIMHAPLTPEI 58
          K ++S+  +P   S SN GG +  S  +V+ T+K++++   P S +  +P++PE+
Sbjct: 9  KVVDSLASNPGLMSPSNFGGDFG-SRLKVNVTSKKKLNDSSPTSPMESSPVSPEL 62

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 28.9 bits (63), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRH 233
           CP C +   R   L+ H   HT + P+ C +  C + F  +  +LRH
Sbjct: 153 CPTCTRGFVRQEHLKRHQHSHTREKPYLCIF--CGRCFARRDLVLRH 197

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 28.5 bits (62), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 8/67 (11%)

Query: 182 KLRKQCP--ICGKVCSRPSTLRTHYLIHTGDTPFKCTW------EHCNKSFNVKSNMLRH 233
           + R +CP   C K  SR   L  H L H     FKC +      + C K+F  +  + RH
Sbjct: 42  QYRYKCPHPTCDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSGQPCGKTFVRRDLLNRH 101

Query: 234 LRTHQKK 240
            + H+ K
Sbjct: 102 EKRHENK 108

>KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 289

 Score = 28.1 bits (61), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 2/50 (4%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRT 236
           C  C  V  R S LR H   H    P  CT   C K F  K  + RH  T
Sbjct: 206 CEKCHMVFRRSSDLRRHERQHLPILPNICTL--CGKGFARKDALKRHFDT 253

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 28.1 bits (61), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 1/39 (2%)

Query: 173 IQKQLRAVVKLRK-QCPICGKVCSRPSTLRTHYLIHTGD 210
           I   LR  V L+   C  CGK   RP  L+ H  +H  D
Sbjct: 105 ITSHLRVHVPLKPFGCSTCGKKFKRPQDLKKHLRVHLDD 143

>Scas_587.7
          Length = 910

 Score = 28.1 bits (61), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 17 CSSSNIGGSYAQSSKEVSNTTKREVHLPPCSSIMHAPLTPEI 58
           S+++I   ++ S++    T  REV LP  +SI  A L+PE+
Sbjct: 36 SSTASITNFFSSSTESTPKTPSREVFLPQEASINGAELSPEL 77

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 28.1 bits (61), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 187 CPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRT 236
           C  C K  SR      H   H G  PF+C  + C  SF  +  + RH+RT
Sbjct: 10  CSFCLKPFSRSEHKIRHERSHAGVKPFQC--QVCKHSFVRRDLLQRHIRT 57

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 27.7 bits (60), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 188 PICGKVCSRPSTLRTHYLIHTGDTPFKCTWEH------CNKSFNVKSNMLRHLRTHQK 239
           P C K  +R   L  H L H     F+C + +      CN++F  +  ++RH + H +
Sbjct: 21  PNCSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVRRDLLVRHEKRHSR 78

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.129    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,878,775
Number of extensions: 225614
Number of successful extensions: 985
Number of sequences better than 10.0: 177
Number of HSP's gapped: 856
Number of HSP's successfully gapped: 245
Length of query: 244
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 145
Effective length of database: 13,168,927
Effective search space: 1909494415
Effective search space used: 1909494415
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)