Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPR013C31731215970.0
YPR015C247853171e-34
Scas_602.4266683092e-33
CAGL0L05786g348613109e-33
Scas_707.46338643091e-32
CAGL0J01595g3441023082e-32
Scas_602.4d256592996e-32
KLLA0A04609g4231212332e-21
AEL077W336612302e-21
ADL040W330562241e-20
Scas_656.1*102532073e-20
KLLA0F20636g285522141e-19
Scas_710.9505602201e-19
ADR308C278532052e-18
Sklu_2398.2288602025e-18
Kwal_26.8011190541853e-16
Scas_717.18354581906e-16
Sklu_2244.3271871832e-15
Scas_718.36d330671809e-15
ADL042W281521789e-15
Scas_717.17d350511772e-14
KLLA0F11682g374541773e-14
Kwal_14.2206254571717e-14
CAGL0M01870g315561711e-13
AGL207W277561701e-13
Kwal_27.10467302601603e-12
KLLA0F22319g203481563e-12
AGR186C287581577e-12
ADL050W146531508e-12
ADL051W173551492e-11
CAGL0M04323g703521367e-09
AGL197W844571359e-09
CAGL0E01331g689531261e-07
Scas_697.35839541252e-07
YER028C394621232e-07
CAGL0A01628g424801232e-07
ACR264W769531233e-07
CAGL0L03916g642531233e-07
CAGL0K12078g463611206e-07
KLLA0B00605g239571177e-07
Kwal_47.17888786531208e-07
Kwal_14.2543711901199e-07
Kwal_56.23925745531199e-07
AFR471C389571181e-06
CAGL0M06831g645551191e-06
Scas_713.52620511181e-06
Sklu_2389.2767551181e-06
YOR113W (AZF1)914531181e-06
Scas_711.56832551162e-06
YJL056C (ZAP1)880651162e-06
AEL174W661551153e-06
KLLA0F23782g782521135e-06
Kwal_47.19045266521115e-06
YLR131C (ACE2)770541135e-06
Scas_687.33288521108e-06
KLLA0A10373g206581088e-06
Kwal_14.2278463511118e-06
YGL035C (MIG1)504511101e-05
KLLA0D16456g854571101e-05
YGL209W (MIG2)382521081e-05
Scas_712.42*290521081e-05
YNL027W (CRZ1)678551092e-05
CAGL0J05060g713641092e-05
YDR146C (SWI5)709531082e-05
KLLA0F01463g781641073e-05
CAGL0C02519g318521053e-05
CAGL0L07480g314821054e-05
YDR043C (NRG1)231541025e-05
Sklu_2351.6548511055e-05
Scas_575.3455511045e-05
KLLA0E10989g474521045e-05
CAGL0I02816g291551036e-05
Kwal_23.5400429541037e-05
Scas_709.32822561047e-05
Kwal_27.109252641261028e-05
YMR070W (MOT3)4901131038e-05
ABR089C571551039e-05
CAGL0M13189g541551021e-04
KLLA0E18645g431501021e-04
CAGL0K03003g647671021e-04
Scas_718.4426654991e-04
Scas_695.2571551012e-04
Sklu_2289.129150992e-04
ADL198W547551002e-04
CAGL0K09372g39652992e-04
YGL254W (FZF1)29953982e-04
AGR031W14060943e-04
Kwal_27.1146053163983e-04
Scas_712.232754973e-04
Scas_693.3163553984e-04
Kwal_26.835169855974e-04
KLLA0F18524g35753964e-04
CAGL0H04873g45171975e-04
Sklu_2357.715753935e-04
KLLA0F26961g69455975e-04
Scas_569.229355956e-04
CAGL0F05995g59754967e-04
Scas_649.2873055959e-04
YKL062W (MSN4)63055959e-04
CAGL0H07557g47653940.001
KLLA0E08679g59655940.001
Kwal_27.1016728555920.001
Sklu_2206.235861930.001
YPR186C (PZF1)42963930.001
Sklu_2443.2221347900.002
CAGL0M00594g102053920.002
CAGL0K04697g51559910.002
KLLA0F07073g55857910.002
YBR066C (NRG2)22070890.002
YDR216W (ADR1)132364910.003
AER159C119147910.003
KLLA0B03454g47255890.004
YMR037C (MSN2)70467890.004
Scas_717.1752549890.004
Kwal_47.1724140386890.004
AGL071C39650880.004
CAGL0K02145g31752880.005
Sklu_2181.141052870.006
KLLA0B04477g133247880.007
CAGL0H04213g132147870.008
Scas_721.92115247870.009
Kwal_26.802150751860.010
YDL048C (STP4)49068850.011
Scas_707.3128955840.012
Scas_602.954752850.014
Scas_378.120850830.014
Kwal_47.16621117847840.020
YLR375W34364830.021
ACL057W52052830.025
CAGL0L06072g30053820.025
Scas_703.23134147830.026
Scas_670.243556820.031
Scas_683.2587958820.035
Scas_683.3047869810.043
YML081W125147800.070
AEL278W47655790.074
YER130C44352780.085
CAGL0K04631g101356780.092
CAGL0E06116g61346760.15
CAGL0K02343g116265760.17
KLLA0C17072g47452760.17
YPR022C113373760.21
CAGL0G10021g39460750.21
YMR182C (RGM1)21161730.23
KLLA0B07909g92250750.23
YJR127C (ZMS1)138047750.28
Scas_631.743352740.28
KLLA0D11902g28957730.35
AFR580C83853730.40
YPL230W39126720.43
Scas_627.6120762720.62
Scas_719.68135047710.67
KLLA0F13046g137947700.98
Scas_720.3331662690.98
Kwal_47.1657788135691.2
Kwal_26.930030464681.3
Sklu_2359.572258681.5
KLLA0E13519g23056671.6
Kwal_55.2063441938662.3
YGR067C79453672.4
CAGL0E03762g58456662.5
KLLA0C16005g33142653.4
AAR170W60328653.6
AFR588W31954643.7
Sklu_2126.544824644.8
AFR598C63569645.4
AFR190C43286635.6
Scas_604.458538635.7
YDR380W (ARO10)635147635.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR013C
         (312 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putati...   619   0.0  
YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protei...   126   1e-34
Scas_602.4                                                            123   2e-33
CAGL0L05786g complement(636176..637222) some similarities with t...   124   9e-33
Scas_707.46                                                           123   1e-32
CAGL0J01595g 151584..152618 some similarities with tr|Q12531 Sac...   123   2e-32
Scas_602.4d                                                           119   6e-32
KLLA0A04609g complement(411494..412765) some similarities with s...    94   2e-21
AEL077W [2429] [Homologous to NOHBY] complement(483028..484038) ...    93   2e-21
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    91   1e-20
Scas_656.1*                                                            84   3e-20
KLLA0F20636g complement(1914452..1915309) some similarities with...    87   1e-19
Scas_710.9                                                             89   1e-19
ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,...    84   2e-18
Sklu_2398.2 , Contig c2398 2210-3076 reverse complement                82   5e-18
Kwal_26.8011                                                           76   3e-16
Scas_717.18                                                            78   6e-16
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                75   2e-15
Scas_718.36d                                                           74   9e-15
ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....    73   9e-15
Scas_717.17d                                                           73   2e-14
KLLA0F11682g complement(1068992..1070116) some similarities with...    73   3e-14
Kwal_14.2206                                                           70   7e-14
CAGL0M01870g complement(219813..220760) some similarities with t...    70   1e-13
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    70   1e-13
Kwal_27.10467                                                          66   3e-12
KLLA0F22319g complement(2086613..2087224) some similarities with...    65   3e-12
AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,...    65   7e-12
ADL050W [1691] [Homologous to NOHBY] complement(597229..597669) ...    62   8e-12
ADL051W [1690] [Homologous to NOHBY] complement(595496..596017) ...    62   2e-11
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    57   7e-09
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    57   9e-09
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    53   1e-07
Scas_697.35                                                            53   2e-07
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    52   2e-07
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    52   2e-07
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    52   3e-07
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    52   3e-07
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...    51   6e-07
KLLA0B00605g complement(46736..47455) some similarities with sp|...    50   7e-07
Kwal_47.17888                                                          51   8e-07
Kwal_14.2543                                                           50   9e-07
Kwal_56.23925                                                          50   9e-07
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    50   1e-06
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    50   1e-06
Scas_713.52                                                            50   1e-06
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            50   1e-06
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    50   1e-06
Scas_711.56                                                            49   2e-06
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    49   2e-06
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    49   3e-06
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    48   5e-06
Kwal_47.19045                                                          47   5e-06
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    48   5e-06
Scas_687.33                                                            47   8e-06
KLLA0A10373g complement(907244..907864) some similarities with c...    46   8e-06
Kwal_14.2278                                                           47   8e-06
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    47   1e-05
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    47   1e-05
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    46   1e-05
Scas_712.42*                                                           46   1e-05
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    47   2e-05
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    47   2e-05
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    46   2e-05
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    46   3e-05
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    45   3e-05
CAGL0L07480g complement(822240..823184) some similarities with s...    45   4e-05
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...    44   5e-05
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       45   5e-05
Scas_575.3                                                             45   5e-05
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    45   5e-05
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    44   6e-05
Kwal_23.5400                                                           44   7e-05
Scas_709.32                                                            45   7e-05
Kwal_27.10925                                                          44   8e-05
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    44   8e-05
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    44   9e-05
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    44   1e-04
KLLA0E18645g complement(1648263..1649558) some similarities with...    44   1e-04
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    44   1e-04
Scas_718.44                                                            43   1e-04
Scas_695.2                                                             44   2e-04
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          43   2e-04
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    43   2e-04
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    43   2e-04
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    42   2e-04
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...    41   3e-04
Kwal_27.11460                                                          42   3e-04
Scas_712.2                                                             42   3e-04
Scas_693.31                                                            42   4e-04
Kwal_26.8351                                                           42   4e-04
KLLA0F18524g complement(1701498..1702571) some similarities with...    42   4e-04
CAGL0H04873g complement(465069..466424) some similarities with t...    42   5e-04
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement        40   5e-04
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    42   5e-04
Scas_569.2                                                             41   6e-04
CAGL0F05995g complement(598819..600612) some similarities with s...    42   7e-04
Scas_649.28                                                            41   9e-04
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    41   9e-04
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    41   0.001
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    41   0.001
Kwal_27.10167                                                          40   0.001
Sklu_2206.2 YLR375W, Contig c2206 7136-8212                            40   0.001
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    40   0.001
Sklu_2443.22 , Contig c2443 45390-46027                                39   0.002
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    40   0.002
CAGL0K04697g 458366..459913 some similarities with tr|Q07351 Sac...    40   0.002
KLLA0F07073g 675221..676897 some similarities with sgd|S0004367 ...    40   0.002
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...    39   0.002
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    40   0.003
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    40   0.003
KLLA0B03454g complement(314015..315433) some similarities with s...    39   0.004
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    39   0.004
Scas_717.17                                                            39   0.004
Kwal_47.17241                                                          39   0.004
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    39   0.004
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    39   0.005
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            38   0.006
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    39   0.007
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    38   0.008
Scas_721.92                                                            38   0.009
Kwal_26.8021                                                           38   0.010
YDL048C (STP4) [816] chr4 complement(366739..368211) Protein wit...    37   0.011
Scas_707.31                                                            37   0.012
Scas_602.9                                                             37   0.014
Scas_378.1                                                             37   0.014
Kwal_47.16621                                                          37   0.020
YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with str...    37   0.021
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    37   0.025
CAGL0L06072g complement(679924..680826) some similarities with s...    36   0.025
Scas_703.23                                                            37   0.026
Scas_670.2                                                             36   0.031
Scas_683.25                                                            36   0.035
Scas_683.30                                                            36   0.043
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    35   0.070
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    35   0.074
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    35   0.085
CAGL0K04631g complement(440721..443762) some similarities with s...    35   0.092
CAGL0E06116g complement(604708..606549) some similarities with t...    34   0.15 
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    34   0.17 
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    34   0.17 
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    34   0.21 
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    33   0.21 
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    33   0.23 
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    33   0.23 
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    33   0.28 
Scas_631.7                                                             33   0.28 
KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041 S...    33   0.35 
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    33   0.40 
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    32   0.43 
Scas_627.6                                                             32   0.62 
Scas_719.68                                                            32   0.67 
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    32   0.98 
Scas_720.33                                                            31   0.98 
Kwal_47.16577                                                          31   1.2  
Kwal_26.9300                                                           31   1.3  
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          31   1.5  
KLLA0E13519g complement(1190615..1191307) some similarities with...    30   1.6  
Kwal_55.20634                                                          30   2.3  
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    30   2.4  
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    30   2.5  
KLLA0C16005g 1397274..1398269 some similarities with sgd|S000615...    30   3.4  
AAR170W [358] [Homologous to ScYGL125W (MET13) - SH] complement(...    30   3.6  
AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C (...    29   3.7  
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            29   4.8  
AFR598C [3790] [Homologous to ScYBL042C (FUI1) - NSH] (1513045.....    29   5.4  
AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH] (783110.....    29   5.6  
Scas_604.4                                                             29   5.7  
YDR380W (ARO10) [1207] chr4 (1234206..1236113) Minor alpha-ketoi...    29   5.8  

>YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putative
           transcription factor with similarity to mouse REX1
           encoded transcription factor, has two tandem C2H2-type
           zinc fingers [954 bp, 317 aa]
          Length = 317

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/312 (96%), Positives = 300/312 (96%)

Query: 1   MNFXXXXXXXXXXXXYTDKSRSPNIGMCTVNYKSNLPLQVSAVDQLSTGKGTQFYGHNSY 60
           MNF            YTDKSRSPNIGMCTVNYKSNLPLQVSAVDQLSTGKGTQFYGHNSY
Sbjct: 1   MNFSLSKQSSEKQSSYTDKSRSPNIGMCTVNYKSNLPLQVSAVDQLSTGKGTQFYGHNSY 60

Query: 61  KNERECYNSTKINLPPISSLLPNFENNTPPNVDSRVQFPPQQVYQSMNVVPIVNEIYTPI 120
           KNERECYNSTKINLPPISSLLPNFENNTPPNVDSRVQFPPQQVYQSMNVVPIVNEIYTPI
Sbjct: 61  KNERECYNSTKINLPPISSLLPNFENNTPPNVDSRVQFPPQQVYQSMNVVPIVNEIYTPI 120

Query: 121 SMNATSDQYPIYYTESQQPIPHSQSPHLTSSAPLMMPVMVPTVYKPLTPYDKEPITIASE 180
           SMNATSDQYPIYYTESQQPIPHSQSPHLTSSAPLMMPVMVPTVYKPLTPYDKEPITIASE
Sbjct: 121 SMNATSDQYPIYYTESQQPIPHSQSPHLTSSAPLMMPVMVPTVYKPLTPYDKEPITIASE 180

Query: 181 PNFTAISMASHPNAALELCHDRPKSVPPGYGVLPTMQEASNGRTKSEPGAVLNGSATFSD 240
           PNFTAISMASHPNAALELCHDRPKSVPPGYGVLPTMQEASNGRTKSEPGAVLNGSATFSD
Sbjct: 181 PNFTAISMASHPNAALELCHDRPKSVPPGYGVLPTMQEASNGRTKSEPGAVLNGSATFSD 240

Query: 241 WKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNML 300
           WKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNML
Sbjct: 241 WKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNML 300

Query: 301 RHLKSHERKRNK 312
           RHLKSHERKRNK
Sbjct: 301 RHLKSHERKRNK 312

>YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protein
           with similarity to human GT box-binding protein
           (SP:B44489), has two tandem C2H2-type zinc fingers [744
           bp, 247 aa]
          Length = 247

 Score =  126 bits (317), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 56/85 (65%), Positives = 67/85 (78%)

Query: 228 PGAVLNGSATFSDWKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWE 287
           PG +L+ + T  D       +  KLRKQCP+CGK+CSRPSTL+THYLIHTGDTPFKCTWE
Sbjct: 159 PGTLLSQTQTDLDLIQKQLRAVVKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWE 218

Query: 288 GCTKSFNVKSNMLRHLKSHERKRNK 312
            C KSFNVKSNMLRHL++H++K  K
Sbjct: 219 HCNKSFNVKSNMLRHLRTHQKKIAK 243

>Scas_602.4
          Length = 266

 Score =  123 bits (309), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 53/68 (77%), Positives = 57/68 (83%)

Query: 242 KTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLR 301
           K   R   +KLRKQCP CGKICSRPSTLK HYLIHTGDTPFKCTW  C K+FNVKSNMLR
Sbjct: 188 KRANRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLR 247

Query: 302 HLKSHERK 309
           HLK+HE+K
Sbjct: 248 HLKAHEKK 255

>CAGL0L05786g complement(636176..637222) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 348

 Score =  124 bits (310), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 57/61 (93%)

Query: 250 TKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           +KLRKQCPVCGK+CSRPSTLKTHYLIHTGDTPFKC W+ C K+FNVKSNMLRHLK HERK
Sbjct: 281 SKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERK 340

Query: 310 R 310
           +
Sbjct: 341 K 341

>Scas_707.46
          Length = 338

 Score =  123 bits (309), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 59/64 (92%)

Query: 249 STKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           +++LRKQCPVCGKICSRPSTLKTHYLIHTGDTPF+C W+ C KSFNVKSNMLRHLKSH++
Sbjct: 265 ASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324

Query: 309 KRNK 312
           K  K
Sbjct: 325 KGAK 328

>CAGL0J01595g 151584..152618 some similarities with tr|Q12531
           Saccharomyces cerevisiae YPR015c or tr|Q12145
           Saccharomyces cerevisiae YPR013c, hypothetical start
          Length = 344

 Score =  123 bits (308), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 59/102 (57%), Positives = 71/102 (69%), Gaps = 12/102 (11%)

Query: 209 GYGVLPTMQE--ASNGRTKSEPGAVLNGSATFSDWKTDTRISSTKLRKQCPVCGKICSRP 266
           G  + PT+ E   ++  TK E              K   + ++T+LRKQCPVCGKICSRP
Sbjct: 247 GVSIPPTLMEHQLTDAMTKQE----------IKLTKRQLKKATTRLRKQCPVCGKICSRP 296

Query: 267 STLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           STLKTH LIHTGDTPFKCTW+ C K+FNVKSN+LRHLKSHE+
Sbjct: 297 STLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLKSHEK 338

>Scas_602.4d
          Length = 256

 Score =  119 bits (299), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 50/59 (84%), Positives = 55/59 (93%)

Query: 254 KQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRNK 312
           K+CPVCGK+CSRPSTLKTH+LIHTGDTPFKCT+ GC KSFNVKSNM RHLK HERK+NK
Sbjct: 195 KECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNK 253

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 94.4 bits (233), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 69/121 (57%), Gaps = 24/121 (19%)

Query: 212 VLPTMQEASNGRTKSEPGAVLN-----GSATFSDWKTDTRISSTKL-------------- 252
           V+P+   AS  + + + G+V+N      S + ++ +T  RIS T+L              
Sbjct: 277 VIPSTANASQIQ-EEQDGSVVNDKDDHSSGSTTERETTLRISKTELDGSITNAMPINDSS 335

Query: 253 ----RKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
               + QC +CG+ICSRPSTL+TH  IHTGD P+KC    C K FNVKSNMLRH K HE 
Sbjct: 336 LPLKKNQCHICGRICSRPSTLQTHLSIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKRHEF 395

Query: 309 K 309
           K
Sbjct: 396 K 396

>AEL077W [2429] [Homologous to NOHBY] complement(483028..484038)
           [1011 bp, 336 aa]
          Length = 336

 Score = 93.2 bits (230), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 45/61 (73%)

Query: 252 LRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRN 311
           +R QCPVCGK+C RPS+L+ H  IHTG  PF C W GC K FNVKSNM+RH + H+ +R 
Sbjct: 272 VRNQCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQLQRG 331

Query: 312 K 312
           K
Sbjct: 332 K 332

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 90.9 bits (224), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 47/56 (83%)

Query: 254 KQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           K C VCG+ C+RPSTLKTH LIHTG+ PF+C+W GC+K FNV+SNM RH+ SH+R+
Sbjct: 258 KTCLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRSNMNRHVNSHKRR 313

>Scas_656.1*
          Length = 102

 Score = 84.3 bits (207), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%)

Query: 254 KQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           +QCP+CGKI +R S+L+TH L+HTGD PFKC W  C K+FNVKSNM RH K H
Sbjct: 40  RQCPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYKLH 92

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 87.0 bits (214), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 42/52 (80%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHE 307
           C  CGK  +RPS L+TH L+H+GD PF+CTWEGC K FNVKSN++RHLK H+
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKLHK 285

>Scas_710.9
          Length = 505

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 37/60 (61%), Positives = 46/60 (76%)

Query: 247 ISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           + + K +KQC +CGK+ +R S+L+TH LIHTG  PF CTW GC K+FNVKSNM RHLK H
Sbjct: 440 LQTRKRKKQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKLH 499

>ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,
           278 aa]
          Length = 278

 Score = 83.6 bits (205), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 39/53 (73%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           C VCG+ C RPSTLKTH L HTG  PF C   GC+KSFNV+SNMLRH + H R
Sbjct: 206 CKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLHSR 258

>Sklu_2398.2 , Contig c2398 2210-3076 reverse complement
          Length = 288

 Score = 82.4 bits (202), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 34/60 (56%), Positives = 43/60 (71%)

Query: 251 KLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310
           KL+  CP CGK   RPS LKTH +IH G +P+ CTW GC+K FNVK N+LRH + H +K+
Sbjct: 215 KLQHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRIHTKKK 274

>Kwal_26.8011
          Length = 190

 Score = 75.9 bits (185), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (75%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           QC +C KI SR S L+ H L HTG  PF+C +  C+K+FNVKSNM+RHLK+H++
Sbjct: 129 QCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTHKQ 182

>Scas_717.18
          Length = 354

 Score = 77.8 bits (190), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 44/58 (75%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRNK 312
           +CP+C KI +R ++L++H LIHTG+ P+KCTW  C  S +VKSN+ RH KSH + +N+
Sbjct: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQNQ 354

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 75.1 bits (183), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 48/87 (55%), Gaps = 7/87 (8%)

Query: 230 AVLNGSATFSDWKTDTRISSTKLRKQ-------CPVCGKICSRPSTLKTHYLIHTGDTPF 282
            +  G+    DWK +   +    RK+       CP C K   RPS L+TH +IH G  PF
Sbjct: 185 CITEGTFLDQDWKLNKECNRFPPRKKRVSYTYCCPKCKKEFKRPSGLRTHMVIHYGRNPF 244

Query: 283 KCTWEGCTKSFNVKSNMLRHLKSHERK 309
            C W  C+K FNVKSN+LRH +SH R+
Sbjct: 245 FCKWPNCSKKFNVKSNLLRHYRSHNRE 271

>Scas_718.36d
          Length = 330

 Score = 73.9 bits (180), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 43/67 (64%)

Query: 242 KTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLR 301
           + +T     KL   C VCGK   RPS+L+TH  I +G+ P+KC +  CTKSFN KSNMLR
Sbjct: 227 EVETSAFDEKLGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLR 286

Query: 302 HLKSHER 308
           H K H R
Sbjct: 287 HYKLHFR 293

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score = 73.2 bits (178), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 36/52 (69%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHE 307
           C +CGK   RPS L+TH ++H  D P+ C   GC K FNVKSNMLRH++ H+
Sbjct: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRKHK 278

>Scas_717.17d
          Length = 350

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 37/51 (72%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           C VCGK  +R ++L+TH LIHTG  PFKC+W  C  S +VKSN+ RH KSH
Sbjct: 287 CVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFKSH 337

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 72.8 bits (177), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (68%)

Query: 253 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           + +C  CGK  +RPS+L TH  IHTGD P+KC +  C K FN KSNMLRH K H
Sbjct: 303 KYRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLH 356

>Kwal_14.2206
          Length = 254

 Score = 70.5 bits (171), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 38/57 (66%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRN 311
           +C +CGK  SRPS L TH LIHTG  P+ C    C K FNVKSN++RH K H + R+
Sbjct: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRD 251

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 38/56 (67%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRN 311
           C VC K   RPS+L TH  IHTG+ P+ C ++ CTKSFN KSNMLRH K H +  N
Sbjct: 175 CKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLHFKLSN 230

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 70.1 bits (170), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 38/56 (67%)

Query: 253 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           R  C  CGK  +R S+L+TH  IHTGD PF C ++ C KSFN +SNMLRH K H R
Sbjct: 182 RYVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLHFR 237

>Kwal_27.10467
          Length = 302

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 4/60 (6%)

Query: 251 KLRKQ----CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           +LR Q    C  CGK+ +RPS+L TH   HTGD P+ C ++ C K FN +SNM RH K H
Sbjct: 191 RLRNQPRYTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYKLH 250

>KLLA0F22319g complement(2086613..2087224) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 203

 Score = 64.7 bits (156), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 36/48 (75%)

Query: 260 GKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHE 307
           GK  SRPSTLKTH ++H+   PFKCT+  C KS+NVKSN+ RH K H+
Sbjct: 152 GKEFSRPSTLKTHIVVHSQAKPFKCTYLDCNKSYNVKSNLRRHEKKHK 199

>AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,
           287 aa]
          Length = 287

 Score = 65.1 bits (157), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (68%), Gaps = 2/58 (3%)

Query: 252 LRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           + K CP+CGK  +R STL+ H LIHT   PFKC++  C K FNVKSN+ RH + H +K
Sbjct: 165 VSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CDKEFNVKSNLNRHERIHRQK 220

>ADL050W [1691] [Homologous to NOHBY] complement(597229..597669)
           [441 bp, 146 aa]
          Length = 146

 Score = 62.4 bits (150), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 35/53 (66%)

Query: 254 KQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           K CPVC K  +R ++L TH LIH    P+ C +  C KSFNVKSN+ RHL+ H
Sbjct: 76  KTCPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIH 128

>ADL051W [1690] [Homologous to NOHBY] complement(595496..596017)
           [522 bp, 173 aa]
          Length = 173

 Score = 62.0 bits (149), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%)

Query: 254 KQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           K C +C K  +R ++L+TH LIHT   P++C +  C K+FNVKSN+ RH + H+R
Sbjct: 116 KTCAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERIHKR 170

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 57.0 bits (136), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%)

Query: 257 PVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           P CGK   R   +K+H   H  D P+KC +EGCTK+F    ++ RH K+H++
Sbjct: 528 PNCGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKKTHDK 579

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 56.6 bits (135), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 255 QC--PVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           QC  P CGK+ +R   +++H   H  D PF+C  EGCTK+F    +++RH K+H  K
Sbjct: 675 QCLYPECGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKAFVRNHDLIRHKKTHAEK 731

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 20/39 (51%)

Query: 272 HYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310
            Y+    D  F+C +  C K FN + N+  H+++H   R
Sbjct: 664 QYIKKLQDKTFQCLYPECGKLFNRRYNIRSHIQTHLEDR 702

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%)

Query: 257 PVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           P CGK   R   +++H   H  D P++C ++GC K+F    +++RH K+H+ K
Sbjct: 561 PQCGKTFKRRYNIRSHIQTHLEDRPYRCDYDGCDKAFVRNHDLVRHKKTHQEK 613

>Scas_697.35
          Length = 839

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           QC  CGK  ++   L+TH  +HTG+ P++C  E C K F+ K N+  HL +H++
Sbjct: 544 QCGYCGKRFTQGGNLRTHQRLHTGEKPYEC--ELCDKKFSRKGNLAAHLLTHQK 595

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 29/63 (46%)

Query: 240 DWKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNM 299
           + +T  R+ + +   +C +C K  SR   L  H L H    PF C  + C +SF    NM
Sbjct: 557 NLRTHQRLHTGEKPYECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNM 616

Query: 300 LRH 302
             H
Sbjct: 617 KAH 619

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           +CP C ++ ++ + L+ H   H G  P++C +  C K F    N+  H + H
Sbjct: 516 KCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGY--CGKRFTQGGNLRTHQRLH 565

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 4/62 (6%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH----ERKR 310
           +C +C +   R    K H   HTG+ P KCT +GC KSF+    + RHL++H    +R+R
Sbjct: 18  RCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTKGVQRRR 77

Query: 311 NK 312
            K
Sbjct: 78  IK 79

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query: 228 PGAVLNGSATFSDWKTDTRISSTKLRKQ-CPVCGKICSRPSTLKTHYLIHTGDTPFKCTW 286
           P +V NGS+T +  K+         R   CP+CG+   R      H   HTG+ P  C +
Sbjct: 16  PSSVTNGSSTPNSGKSKAGKGDDAPRPHVCPICGRAFHRLEHQTRHMRTHTGEKPHACDF 75

Query: 287 EGCTKSFNVKSNMLRHLKSH 306
            GC K F+    + RH + H
Sbjct: 76  PGCVKRFSRSDELTRHRRIH 95

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHE 307
           QC  CGK  ++   L+TH  +HTG+ P++C  + C K F+ K N+  H+ +HE
Sbjct: 516 QCEYCGKRFTQGGNLRTHVRLHTGERPYEC--DKCGKRFSRKGNLAAHMLTHE 566

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%)

Query: 239 SDWKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSN 298
            + +T  R+ + +   +C  CGK  SR   L  H L H    PF+C  + C KSF    N
Sbjct: 528 GNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGN 587

Query: 299 MLRH 302
           M  H
Sbjct: 588 MKAH 591

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310
           +CP C K  ++ + L+ H   H G  PF+C +  C K F    N+  H++ H  +R
Sbjct: 488 KCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLHTGER 541

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHE 307
           +C  CGK  ++   L+TH  +HTG+ PFKC  + C K+F  + N+  H  +HE
Sbjct: 509 ECEFCGKRFTQAGNLRTHRRLHTGERPFKC--DKCDKTFARRGNLTAHEFTHE 559

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310
           QC  C K+ S+ + L  H   H G  PF+C +  C K F    N+  H + H  +R
Sbjct: 481 QCAYCSKMFSQSTHLDVHIKAHMGYKPFECEF--CGKRFTQAGNLRTHRRLHTGER 534

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 4/71 (5%)

Query: 239 SDWKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSN 298
            + +T  R+ + +   +C  C K  +R   L  H   H    P+ C  + C K F+   N
Sbjct: 521 GNLRTHRRLHTGERPFKCDKCDKTFARRGNLTAHEFTHESIKPYICRLDNCFKRFSQLGN 580

Query: 299 MLRHLKSHERK 309
           M    KSH+ K
Sbjct: 581 M----KSHQNK 587

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 251 KLRKQ--CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           +LR++  C VCGK  +    L  H  IHTG+    C +EGC + FN   N L+H K+H +
Sbjct: 397 ELRRKYLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYKTHLK 456

Query: 309 K 309
           +
Sbjct: 457 R 457

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 49.7 bits (117), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRNK 312
           C +CG    R      H   HTG+ PF CT  GC K F+    + RH+K+H + R +
Sbjct: 14  CEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTHFKSRKR 70

>Kwal_47.17888
          Length = 786

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHE 307
           QC  CGK  ++   L+TH  +HTG+ P++C  E C + F+ K N+  H  +HE
Sbjct: 532 QCEYCGKRFTQGGNLRTHVRLHTGEKPYEC--EKCGRRFSRKGNLAAHRLTHE 582

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%)

Query: 239 SDWKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSN 298
            + +T  R+ + +   +C  CG+  SR   L  H L H    PF C  +GC KSF    N
Sbjct: 544 GNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGN 603

Query: 299 MLRH 302
           M  H
Sbjct: 604 MKAH 607

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           +CP C K  ++ + L+ H   H G  PF+C +  C K F    N+  H++ H
Sbjct: 504 ECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 553

>Kwal_14.2543
          Length = 711

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 5/90 (5%)

Query: 223 RTKSEPGAVLNGSATFSD---WKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGD 279
            T+ +P   ++   TFS     +   R  S +   +C  CGK  +  S+L+ H   HTG+
Sbjct: 600 HTRYKPCKCVHCLKTFSTQDILQQHMRTHSGEKPYKCSHCGKGFATSSSLRIHIRTHTGE 659

Query: 280 TPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
            P +C  + C K FN  SN+ +H+++HERK
Sbjct: 660 KPLEC--KVCGKRFNESSNLSKHMRTHERK 687

 Score = 32.7 bits (73), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 17/31 (54%)

Query: 278 GDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           G + + C WE C +    +  +LRHL+ H R
Sbjct: 572 GKSSYVCGWENCGRVITQRQKLLRHLRVHTR 602

 Score = 32.3 bits (72), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 4/69 (5%)

Query: 234 GSATFSDWKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSF 293
           G AT S  +   R  + +   +C VCGK  +  S L  H   H  +  +KC  + C +SF
Sbjct: 642 GFATSSSLRIHIRTHTGEKPLECKVCGKRFNESSNLSKHMRTH--ERKYKC--QKCKRSF 697

Query: 294 NVKSNMLRH 302
           + K  +  H
Sbjct: 698 DFKEQLEVH 706

 Score = 32.3 bits (72), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 259 CGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310
           CG++ ++   L  H  +HT   P KC    C K+F+ +  + +H+++H  ++
Sbjct: 583 CGRVITQRQKLLRHLRVHTRYKPCKCVH--CLKTFSTQDILQQHMRTHSGEK 632

>Kwal_56.23925
          Length = 745

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%)

Query: 257 PVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           P CGK   R   +++H   H  D P+ C +EGC K+F    +++RH K+H  K
Sbjct: 590 PDCGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFVRNHDLIRHKKTHAEK 642

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 4/67 (5%)

Query: 248 SSTKLRKQCPVCGKICSRPSTLK----THYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHL 303
           SS  L    P   KI  +P+TL       ++    D  F+C    C K+F  + N+  H+
Sbjct: 547 SSPSLEHHYPSPLKITKKPTTLPPGEIDKFVKELPDKTFECLHPDCGKTFRRRYNIRSHI 606

Query: 304 KSHERKR 310
           ++H   R
Sbjct: 607 QTHLEDR 613

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRNK 312
           CP+C +   R      H   HTG+ P  C + GC K F+ +  + RH + HE  R K
Sbjct: 24  CPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRHRRIHESDRPK 80

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310
           C VCGK+ SRP  LK+H   HT + P++C+   C K+F  + +  RH   H  K+
Sbjct: 523 CEVCGKVFSRPYNLKSHLRTHTDEKPYQCSI--CGKAFARQHDKKRHEDLHTGKK 575

>Scas_713.52
          Length = 620

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%)

Query: 259 CGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           CGKI  R   +++H   H  D P+ C + GC K+F    +++RH KSH  +
Sbjct: 487 CGKIFKRRYNVRSHIQTHLEDKPYACDFPGCEKAFVRNHDLVRHKKSHANR 537

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 55/115 (47%), Gaps = 11/115 (9%)

Query: 200 HDRPKSVPPGYGVLPTMQEAS-NGRTKSEPGAVLNGSATFSDWKTDTRISSTKLRKQCPV 258
           +D P    P + +LPT+  +S N   KS P    +       ++ +T +   K +++ P+
Sbjct: 393 NDTPSPEQPHFNILPTIPGSSENTPQKSNPTTTNHYLPQKHTFQHNTPV---KQQQRTPI 449

Query: 259 CG---KICSRPSTLKTH----YLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
                +I ++PSTL       Y+    D  F+C +E C K F  + N+  H+++H
Sbjct: 450 KTSPTRITNKPSTLPRGTIDLYVKELPDKLFECLYEDCGKIFKRRYNVRSHIQTH 504

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           +C  C K  +  S+L+ H   HTG+ P KC    C K FN  SN+ +H+K+HERK
Sbjct: 687 KCTYCTKQFATSSSLRIHIRTHTGEKPLKCKI--CGKRFNESSNLSKHMKTHERK 739

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 259 CGKICSRPSTLKTHY---LIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           C ++   P  L  H     I  G + ++C+W+ C+KSF  +  +LRHLK H
Sbjct: 602 CSQVFPNPEALNNHIESQHIPRGQSSYQCSWDTCSKSFTQRQKLLRHLKVH 652

 Score = 35.0 bits (79), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 258 VCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310
            C K  ++   L  H  +H+G  PFKC    CTK F+ +  + +H+++H  +R
Sbjct: 634 TCSKSFTQRQKLLRHLKVHSGYKPFKCP--HCTKKFSTEDILQQHIRTHSGER 684

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 8/74 (10%)

Query: 236 ATFSDWKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNV 295
           AT S  +   R  + +   +C +CGK  +  S L  H   H  +  +KC  E C +SF  
Sbjct: 696 ATSSSLRIHIRTHTGEKPLKCKICGKRFNESSNLSKHMKTH--ERKYKC--EKCKRSF-- 749

Query: 296 KSNMLRHLKSHERK 309
             N L  L+ H+ +
Sbjct: 750 --NQLEQLRLHQNR 761

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           C  CGK  ++   L+TH  +HTG+ P+ C    C K F+ K N+  HL +H++
Sbjct: 623 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 673

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 28/63 (44%)

Query: 240 DWKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNM 299
           + +T  R+ + +    C +C K  SR   L  H + H    PF C  E C K+F    NM
Sbjct: 635 NLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNM 694

Query: 300 LRH 302
             H
Sbjct: 695 KAH 697

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 253 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           + +CP C ++ S+ + L+ H   H G  PF C +  C K F    N+  H + H
Sbjct: 592 KHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 643

>Scas_711.56
          Length = 832

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           +C +CGK  +  S+LK H   HTG+ P  C  + C K+FN  SN+ +H+K+H ++
Sbjct: 755 KCDICGKRFAISSSLKIHIRTHTGEKPLHC--KICGKAFNESSNLSKHMKTHLKR 807

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           QC +C K  S   TLK H   H+G+ PFKC  + C K F + S++  H+++H
Sbjct: 727 QCSICKKHFSNEETLKQHERTHSGEKPFKC--DICGKRFAISSSLKIHIRTH 776

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 259 CGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310
           C KI S+   L  H  +H+G  PF+C+   C K F+ +  + +H ++H  ++
Sbjct: 703 CHKIFSQRQRLVRHMRVHSGYKPFQCSI--CKKHFSNEETLKQHERTHSGEK 752

 Score = 31.6 bits (70), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 9/29 (31%), Positives = 18/29 (62%)

Query: 278 GDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           G + ++C W  C K F+ +  ++RH++ H
Sbjct: 692 GQSQYECHWANCHKIFSQRQRLVRHMRVH 720

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 27/67 (40%), Gaps = 4/67 (5%)

Query: 236 ATFSDWKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNV 295
           A  S  K   R  + +    C +CGK  +  S L  H   H     FKC  E C  SFN 
Sbjct: 764 AISSSLKIHIRTHTGEKPLHCKICGKAFNESSNLSKHMKTHL--KRFKC--EKCEASFNT 819

Query: 296 KSNMLRH 302
            S +  H
Sbjct: 820 VSKLRSH 826

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 13/22 (59%)

Query: 282 FKCTWEGCTKSFNVKSNMLRHL 303
            KC W  CTKSFN    + +H+
Sbjct: 536 LKCKWASCTKSFNTLLELQKHI 557

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 2/65 (3%)

Query: 245 TRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLK 304
           TR  S +   +C +C K  +  S+LK H   HTG+ P +C  + C K FN  SN+ +H+K
Sbjct: 787 TRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQC--KICGKRFNESSNLSKHIK 844

Query: 305 SHERK 309
           +H++K
Sbjct: 845 THQKK 849

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           +C  C +  S   TL  H   H+G+ P+KC    C K F + S++  H+++H
Sbjct: 769 KCKTCKRCFSSEETLVQHTRTHSGEKPYKC--HICNKKFAISSSLKIHIRTH 818

 Score = 33.5 bits (75), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 259 CGKICSRPSTLKTHY-LIH--TGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           C K  S    L  H   +H   G + ++C W  C ++F  +  ++RHLK H +
Sbjct: 712 CNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSK 764

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 4/40 (10%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFN 294
           QC +CGK  +  S L  H  I T    +KC+   C+KSF+
Sbjct: 825 QCKICGKRFNESSNLSKH--IKTHQKKYKCS--DCSKSFD 860

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
            C  C K  S  S+L+ H   HTG+ P  CT   C K FN  SN+ +H+K HERK
Sbjct: 573 HCHYCRKQFSTSSSLRVHIRTHTGEKPLSCTV--CGKRFNESSNLSKHMKIHERK 625

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           CP C K  S    L  H   H+G+ PF C +  C K F+  S++  H+++H
Sbjct: 546 CPHCPKTFSTDDILAQHIRTHSGERPFHCHY--CRKQFSTSSSLRVHIRTH 594

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 277 TGDTPFKCTWEGCTKSFNVKSNMLR-HLKSHERK 309
           +G + ++C W GCTK F  +  +   H  +H  K
Sbjct: 509 SGRSAYQCNWAGCTKHFTQRQKLFAPHQGTHRHK 542

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHE 307
           C  CGK  ++   L+TH  +HTG+ P++C  E C + F+ K N+  H  +H+
Sbjct: 553 CEFCGKRFTQGGNLRTHIRLHTGEKPYEC--ERCGRKFSRKGNLAAHKLTHD 602

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%)

Query: 239 SDWKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSN 298
            + +T  R+ + +   +C  CG+  SR   L  H L H    PF+C  + C K+F    N
Sbjct: 564 GNLRTHIRLHTGEKPYECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGN 623

Query: 299 MLRH 302
           M  H
Sbjct: 624 MKAH 627

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           QCP C K  ++ + L+ H   H G  PF C +  C K F    N+  H++ H
Sbjct: 524 QCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEF--CGKRFTQGGNLRTHIRLH 573

>Kwal_47.19045
          Length = 266

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           +C +CGK   R    + H   HTG+ P  C + GC K F+    + RH+++H
Sbjct: 15  KCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTH 66

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%)

Query: 257 PVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310
           P C K+  R   +++H   H  D P+ C + GCTK+F    +++RH  SH  K+
Sbjct: 608 PNCNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISHNAKK 661

 Score = 32.0 bits (71), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query: 261 KICSRPSTLK----THYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310
           KI  +P+TL       Y+    D  F+C +  C K F  + N+  H+++H + R
Sbjct: 578 KITKKPTTLPPGTIDQYVKELPDKLFECLYPNCNKVFKRRYNIRSHIQTHLQDR 631

>Scas_687.33
          Length = 288

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           +CP+C +   R    K H   HTG+ P  CT+  C KSF+    + RH++ H
Sbjct: 18  RCPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDELKRHIRIH 69

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 253 RKQCPV--CGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           R  CP+  CGK  SRP  L+ H   HT + PF C   GC K+F   S++  H+ SH +
Sbjct: 7   RYVCPIESCGKKYSRPCLLRQHVRSHTNEKPFHCPEPGCDKAFLRPSHLRVHMLSHSK 64

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 257 PVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRN 311
           P C K   RPS L+ H L H+   P+ C+   C K F  K    RH ++H + ++
Sbjct: 43  PGCDKAFLRPSHLRVHMLSHSKVKPYNCSV--CGKGFATKQQFQRHQQTHTQNQD 95

>Kwal_14.2278
          Length = 463

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           CP+C +   R      H   HTG+ P  C + GCTK F+    + RH + H
Sbjct: 25  CPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRHKRIH 75

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           CP+C +   R      H  IHTG+ P  C + GC K F+    + RH + H
Sbjct: 40  CPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 90

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 255 QCPV--CGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           QC    C K  +R    +TH   H  D P+KC + GC K+F    ++LRH KSH  K
Sbjct: 694 QCKFKDCQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFVRNHDLLRHKKSHLEK 750

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 20/34 (58%)

Query: 273 YLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           Y++  G   F+C ++ C K FN + N   H+++H
Sbjct: 684 YILEIGPKQFQCKFKDCQKRFNRRYNARTHIQTH 717

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           +C  C +   R    K H   HTG+ P  C + GC KSF+    + RH+++H
Sbjct: 18  RCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTH 69

>Scas_712.42*
          Length = 290

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           +C  C +   R    K H   HTG+ P  C + GC K F+    + RHL++H
Sbjct: 19  RCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRTH 70

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310
           C VCGK  +RP  LK+H   HT + PF C+   C K+F  + +  RH   H  K+
Sbjct: 571 CDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHTGKK 623

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 9/63 (14%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCT--------WEGCTKSFNVKSNMLRHLKSHE 307
           C +CGK  +R    K H  +HTG   + C         W GC K F     + RH K+  
Sbjct: 599 CSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPW-GCGKKFARSDALGRHFKTES 657

Query: 308 RKR 310
            +R
Sbjct: 658 GRR 660

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 246 RISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKS 305
           R+ S +   +C +C K  +  ++LK H   HTG+ P KC  + C + FN  SN+ +H+K+
Sbjct: 617 RVHSGEKPYECHICHKRFAISNSLKIHIRTHTGEKPLKC--KVCGRCFNESSNLSKHMKT 674

Query: 306 HERK 309
           H +K
Sbjct: 675 HMKK 678

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           QCP C K  S   TL  H  +H+G+ P++C    C K F + +++  H+++H
Sbjct: 598 QCPQCQKCFSTEDTLNQHKRVHSGEKPYECHI--CHKRFAISNSLKIHIRTH 647

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 278 GDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           G + + C WEGC K+F+ +  ++RHLK H +
Sbjct: 563 GKSQYTCEWEGCNKTFSQRQKLVRHLKVHSK 593

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%)

Query: 257 PVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           P C K   R   +++H   H  D P+ C   GC K+F    +++RH KSH+ K
Sbjct: 555 PGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKKSHQEK 607

 Score = 35.4 bits (80), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 27/53 (50%)

Query: 258 VCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310
           +  K+ + P      Y+    D  F+C + GCTK+F  + N+  H+++H   R
Sbjct: 526 ITRKLTTLPRGSIDKYVKEMPDKTFECLFPGCTKTFKRRYNIRSHIQTHLEDR 578

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 246 RISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKS 305
           R+ S +   +C +C K  S  S+L+ H   HTG+ P  C    C K FN  SN+ +H+++
Sbjct: 712 RVHSGERPFKCHLCPKSYSTSSSLRIHIRTHTGEKPLSCPI--CNKRFNESSNLAKHIRT 769

Query: 306 HERK 309
           H+R+
Sbjct: 770 HKRE 773

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 259 CGKICSRPSTLKTH---YLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           C K      +L  H   + + +G + +KC WEGC K F  K  ++RHLK H +
Sbjct: 636 CNKEFDSAKSLNEHIENFHVPSGLSSYKCEWEGCNKVFVQKQKLIRHLKVHSK 688

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 259 CGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310
           C K+  +   L  H  +H+   PF+C    C K FN +  + +HL+ H  +R
Sbjct: 669 CNKVFVQKQKLIRHLKVHSKYKPFRCA--ECGKCFNTQDILTQHLRVHSGER 718

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           +C +C +   R    K H+  HTG+ P KC +  C KSF+    + RH ++H
Sbjct: 21  RCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHSRTH 72

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%)

Query: 231 VLNGSATFSDWKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCT 290
           V +  ++    K +T+    + +  C +C    +    L  H  IHTG+    C  EGC 
Sbjct: 229 VYSNRSSVIKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCN 288

Query: 291 KSFNVKSNMLRHLKSHERKRNK 312
           +SF+   N L+H ++H +K+ +
Sbjct: 289 QSFSRHDNCLQHYRTHSKKKEQ 310

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           C +C +  +    L  H  IHTG+    C ++GCT+ F+   N L+H ++H +K
Sbjct: 176 CKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLKK 229

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           CP+C +   R      H   HTG+ P  C + GC K F+    + RH + H
Sbjct: 36  CPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRIH 86

>Scas_575.3
          Length = 455

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           CP+C +   R      H   HTG+ P +C + GC K F+    + RH + H
Sbjct: 70  CPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHKRIH 120

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHE 307
           CP+C +   R      H   HTG+ P  C + GC+K F+    + RH + H+
Sbjct: 28  CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD 79

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           +C +C K  SR   L  H + H    PF C  + C KSF    + L ++KSH+ K
Sbjct: 12  ECDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSF----SQLGNMKSHQNK 62

>Kwal_23.5400
          Length = 429

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           QC VC +  SR + L+ H   H+ D PFKC++  C K    K  + RH  +H R
Sbjct: 82  QCTVCARQFSRKTHLERHMFSHSEDKPFKCSY--CGKGVTTKQQLRRHEITHTR 133

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 259 CGKICSRPSTLKTHY-LIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           C K  SRPS L  H  ++H G  PF+CT   C + F+ K+++ RH+ SH
Sbjct: 57  CSKAFSRPSQLTEHQEVVHQGIKPFQCTV--CARQFSRKTHLERHMFSH 103

 Score = 32.0 bits (71), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTG---DTPFKCTWEGCTKSFNVKSNMLRHLK 304
           C +CGK   RP  LK H   H        ++C+   C ++F   S + +H+K
Sbjct: 166 CEICGKRFQRPYRLKNHIAKHHNPDVVQKYQCSQGSCIEAFKTWSALQQHMK 217

 Score = 32.0 bits (71), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 3/81 (3%)

Query: 229 GAVLNGSATFSDWKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEG 288
           G+ +    T+S  +   + +  KL  QCP CGK C     L+ H  IH+         E 
Sbjct: 200 GSCIEAFKTWSALQQHMKETHPKL--QCPECGKACVGEQGLQMHMKIHSNAVIKNWKCET 257

Query: 289 CTK-SFNVKSNMLRHLKSHER 308
           C    F  K +++ H   H +
Sbjct: 258 CNDLYFAKKIDLMAHYMEHHK 278

>Scas_709.32
          Length = 822

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 255 QCPVCGKICSRPSTLKTHYL-IHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           +C  CGK   R   LK H   +H+ + PF C    C K F+   N+ +H+K+H+++
Sbjct: 766 KCETCGKAFRRSEHLKRHIRSVHSSERPFAC--PTCDKKFSRSDNLAQHIKTHKKR 819

>Kwal_27.10925
          Length = 264

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 50/126 (39%), Gaps = 22/126 (17%)

Query: 184 TAISMASHPNAALELCHDRPKSVPPGYGVLPTMQEASNGRTKSEPGAVLNGSATFSDWKT 243
            A S+AS P+A L+    +P  V    G   T   + NG+    P               
Sbjct: 153 AAPSVASVPSAVLQ---RQPARVSAHAGAAATTLRSGNGKRTRSP--------------- 194

Query: 244 DTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHL 303
                  + R  C +C K  +    L  H  IHTG+    C  EGC + F+   N ++H 
Sbjct: 195 ----VEQRRRYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHY 250

Query: 304 KSHERK 309
           K+H R+
Sbjct: 251 KTHLRR 256

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 47/113 (41%), Gaps = 3/113 (2%)

Query: 192 PNAALELCHDRPKSVPPGYGVLPTMQEASNGRTKSEPGAVLNGSATFSDWKTDTRISSTK 251
           PN  L +   +P  +PPG+ +  TM +       + P A +  S   +        S  K
Sbjct: 285 PNLNLNINPAQPLHLPPGWKI-NTMPQPRPTTAPNHPPAPVPSSNPVASNLVPAPSSDHK 343

Query: 252 LRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLK 304
              QC  C K   R S LK H L H+    F C W  C      K N+L+H+K
Sbjct: 344 YIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 394

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 255 QCPVCGKICSRPSTLKTHYL-IHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           +C  C K   R   LK H   +H+ D PF CT+  C K F+   N+ +HLK+H +
Sbjct: 505 KCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTY--CDKKFSRSDNLSQHLKTHRK 557

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 255 QCPVCGKICSRPSTLKTHYL-IHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           QC  C K   R   LK H   +H+ + PF C +  C K F+   N+ +HLK+H+R
Sbjct: 485 QCADCDKAFRRSEHLKRHVRSVHSTERPFPCMF--CEKKFSRSDNLSQHLKTHKR 537

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLK 304
           QC +C K   R S LK H L H+    F C W  C+ +   K N+L+HLK
Sbjct: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 2/67 (2%)

Query: 238 FSDWKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKS 297
           F +      +SS     +C +C K+  R S LK H L H+    F C W  C      + 
Sbjct: 518 FGNQGEKIEVSSLAFPHRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPW--CNSRHKRRD 575

Query: 298 NMLRHLK 304
           N+L+H+K
Sbjct: 576 NLLQHMK 582

>Scas_718.44
          Length = 266

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           C +C    +    L  H  IHTG+    C +EGC + F+   N L+H ++H +K
Sbjct: 212 CKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDNCLQHYRTHLKK 265

>Scas_695.2
          Length = 571

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310
           C +C K  +RP  LK+H   HT + PF C    C K+F  + +  RH   H  K+
Sbjct: 454 CELCDKTFTRPYNLKSHLRTHTNEXPFVCNI--CGKAFARQHDRKRHEDLHTGKK 506

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 9/63 (14%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCT--------WEGCTKSFNVKSNMLRHLKSHE 307
           C +CGK  +R    K H  +HTG   + C         W GC K F     + RH K+  
Sbjct: 482 CNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPW-GCHKKFARSDALGRHFKTDS 540

Query: 308 RKR 310
            ++
Sbjct: 541 GRK 543

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%)

Query: 259 CGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           CGK+ SRP  L+ H   HT + PF C   GC K F   S++  H  SH +
Sbjct: 15  CGKMYSRPCLLEQHRRSHTNERPFVCEEPGCGKGFLRASHLKVHKWSHSQ 64

 Score = 34.3 bits (77), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 257 PVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHE 307
           P CGK   R S LK H   H+   P  C    C+K F     + RH K+H+
Sbjct: 43  PGCGKGFLRASHLKVHKWSHSQVKPLACPV--CSKGFTTNQQLSRHKKTHK 91

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310
           C +C K  +RP  LK+H   HT + PF C+   C K+F  + +  RH   H  K+
Sbjct: 428 CNLCDKKFTRPYNLKSHLRTHTDERPFSCSV--CGKAFARQHDRKRHEDLHSGKK 480

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 9/63 (14%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKC--------TWEGCTKSFNVKSNMLRHLKSHE 307
           C VCGK  +R    K H  +H+G   + C        TW GC K F     + RH K+  
Sbjct: 456 CSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATW-GCGKKFARSDALGRHFKTES 514

Query: 308 RKR 310
            +R
Sbjct: 515 GRR 517

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           +C  C +   R    K H   HTG+ P  C++ GC KSF+    + RH ++H
Sbjct: 18  KCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHNRTH 69

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 257 PVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           P CGK   RP  L+ H   H+   P  CT   C K F     + RHL SHERK
Sbjct: 47  PGCGKKFIRPCHLRVHKWTHSQIKPKACTL--CQKRFVTNQQLRRHLNSHERK 97

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 251 KLRKQ-CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           K RK  C  CGK  +    L  H  IHTG+    C + GC + F+   N L+H ++H ++
Sbjct: 76  KRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135

>Kwal_27.11460
          Length = 531

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 9/63 (14%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKC--------TWEGCTKSFNVKSNMLRHLKSHE 307
           C +CGK  +R    K H  +HTG   + C         W GC K F     + RH K+  
Sbjct: 443 CAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEW-GCGKKFARSDALGRHFKTEG 501

Query: 308 RKR 310
            KR
Sbjct: 502 GKR 504

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           C +C K  +RP  LK+H   HT + PF C    C K+F  + +  RH   H
Sbjct: 415 CELCDKKFTRPYNLKSHLRTHTDERPFSCAI--CGKAFARQHDRKRHEDLH 463

>Scas_712.2
          Length = 327

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 259 CGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRNK 312
           CGK   RP  LK H   H+   P KC +  C K F     + RHL +H +K  K
Sbjct: 50  CGKRFMRPCHLKVHKWTHSKVKPLKCAF--CEKGFITNQQLKRHLNTHAKKSRK 101

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 30/66 (45%)

Query: 243 TDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRH 302
           T+ R      + Q   C +  +RP  L+ H   HT + P+ C  EGC K F    ++  H
Sbjct: 4   TEKRSKKKVYKCQFEGCHREFTRPCLLQQHRYSHTNERPYICDVEGCGKRFMRPCHLKVH 63

Query: 303 LKSHER 308
             +H +
Sbjct: 64  KWTHSK 69

>Scas_693.31
          Length = 635

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 257 PVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           P CGK   R    ++H   H  D P+ C +  C K+F    +++RH K H  K
Sbjct: 494 PNCGKHFKRRYNTRSHIQTHLEDRPYACDFPNCDKAFVRNHDLVRHKKVHSEK 546

>Kwal_26.8351
          Length = 698

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 255 QCPVCGKICSRPSTLKTHYL-IHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           +C  C K   R   LK H   +H+ + PF C++  C K F+   N+ +HLK+H++
Sbjct: 642 KCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY--CDKKFSRSDNLSQHLKTHKK 694

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 5/53 (9%)

Query: 258 VCGKICSRPST----LKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           +C KICSR  T    L  H  IHTG+   +C + GC + F+   N ++H ++H
Sbjct: 285 IC-KICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336

>CAGL0H04873g complement(465069..466424) some similarities with
           tr|Q05937 Saccharomyces cerevisiae YLR375w STP3 or
           tr|Q07351 Saccharomyces cerevisiae YDL048c STP4,
           hypothetical start
          Length = 451

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 7/71 (9%)

Query: 242 KTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHT--GDTPFKCTWEGCTKSFNVKSNM 299
           KTD +++  + RKQCP+C       + L TH  IH      PF C+   C + F  ++++
Sbjct: 252 KTDMKVTKKRRRKQCPICHGFF---ANLTTHKAIHLEPDIKPFVCSV--CQRGFVRQNDV 306

Query: 300 LRHLKSHERKR 310
           +RH K H + +
Sbjct: 307 MRHEKMHWKDK 317

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score = 40.4 bits (93), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 5/53 (9%)

Query: 258 VCGKICSRPST----LKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           VC KICSR  T    L  H  IHTG+    C +EGC + F+   N ++H ++H
Sbjct: 101 VC-KICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 255 QCPVCGKICSRPSTLKTHYL-IHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           +C  C K   R   LK H   +H+ + PF C +  C K F+   N+ +HLK+H++
Sbjct: 622 KCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF--CDKKFSRSDNLSQHLKTHKK 674

>Scas_569.2
          Length = 293

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310
           C VC K  +    L  H  IHTG+    C++ GC   F+   N ++H ++H + R
Sbjct: 230 CKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFKVR 284

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 256 CPVCGKICSRPSTLKTHYL-IHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           C +C K   R   LK H   +H+ D PF C    C K F+   N+ +H+K+H++
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHL--CEKKFSRSDNLSQHIKTHKK 588

>Scas_649.28
          Length = 730

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 255 QCPVCGKICSRPSTLKTHYL-IHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           +C  C K   R   LK H   +H+ + PF C +  C K F+   N+ +HLK+H++
Sbjct: 674 KCSECIKAFRRSEHLKRHIRSVHSSERPFACMF--CEKKFSRSDNLSQHLKTHKK 726

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 255 QCPVCGKICSRPSTLKTHYL-IHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           +C  C K   R   LK H   +H+ + PF C +  C K F+   N+ +HLK+H++
Sbjct: 574 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKK 626

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 257 PVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           P CGK   RP  L+ H   H    P KC++  C + F     + RH  +HER+
Sbjct: 92  PNCGKRFLRPCHLRVHKWTHAQVKPLKCSY--CERRFITNQQLKRHTNTHERR 142

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKR 310
           C +C K  +RP  LK+H   HT + P+ C+   C K+F    +  RH   H  KR
Sbjct: 471 CDICDKKFTRPYNLKSHLRSHTDERPYVCSV--CGKAFARMHDKNRHEDLHTGKR 523

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 9/63 (14%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKC--------TWEGCTKSFNVKSNMLRHLKSHE 307
           C VCGK  +R      H  +HTG   + C        +W GC K F     + RH K+  
Sbjct: 499 CSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSW-GCGKKFARSDALGRHFKTEL 557

Query: 308 RKR 310
            K+
Sbjct: 558 GKK 560

>Kwal_27.10167
          Length = 285

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 257 PVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRN 311
           P CGK   R   +  H   H+   P KC  E C+K F  K  + RHL +H +KRN
Sbjct: 70  PNCGKRFLRVCHMNVHRWTHSKIKPLKC--EECSKGFTTKQQLSRHLATH-KKRN 121

>Sklu_2206.2 YLR375W, Contig c2206 7136-8212
          Length = 358

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 3/61 (4%)

Query: 246 RISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKS 305
           R+S  + +K+CPVC    +  ST K+ +L    D P KC+   C++ F   +++LRH K 
Sbjct: 153 RVSKPRRKKECPVCHNFYANLSTHKSTHLT-PEDRPHKCSV--CSRGFARSNDLLRHKKR 209

Query: 306 H 306
           H
Sbjct: 210 H 210

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 247 ISSTKLRK-QCPVCGKICSRPSTLKTHYLIHTG---DTPFKCTWEGCTKSFNVKSNMLRH 302
           I S  L K  CP C K   RP  L+ H   H     + P++CT+ GC K F + S +  H
Sbjct: 155 ILSVHLHKLTCPHCNKSFQRPYRLRNHISKHHDPEVENPYQCTFAGCCKEFRIWSQLQSH 214

Query: 303 LKS 305
           +K+
Sbjct: 215 IKN 217

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           QC  C K   + S L+ H   H+   PF+C++  C K    +  + RH  +H
Sbjct: 81  QCDKCAKSFVKKSHLERHLYTHSDTKPFQCSY--CGKGVTTRQQLKRHEVTH 130

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRH 302
           CP+C +  +R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 50  CPICTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 94

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           CP+C +   R   LK H   HT + PF C    C K F  K  +LRHL+   R
Sbjct: 29  CPICSRGFVRQEHLKRHQNSHTHEKPFLCL--ICGKCFARKDLVLRHLQKLHR 79

>CAGL0K04697g 458366..459913 some similarities with tr|Q07351
           Saccharomyces cerevisiae YDL048c STP4 or tr|Q05937
           Saccharomyces cerevisiae YLR375w STP3, hypothetical
           start
          Length = 515

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 248 SSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           S TK ++QCP+C K  +  ST K+ +L  + D P KC    C   F   ++++RH K H
Sbjct: 318 SKTKKKRQCPICHKYFANLSTHKSTHLT-SQDRPHKCII--CQSGFARNNDLIRHRKRH 373

>KLLA0F07073g 675221..676897 some similarities with sgd|S0004367
           Saccharomyces cerevisiae YLR375w STP3 involved in
           pre-tRNA splicing and in uptake of branched-chain amino
           acids, hypothetical start
          Length = 558

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 5/57 (8%)

Query: 251 KLRKQCPVCGKICSRPSTLKTHYLIHTGDT-PFKCTWEGCTKSFNVKSNMLRHLKSH 306
           + +KQCP+CG   S  ST K+ +L  + +T PFKC  E C++ F   ++++RH K H
Sbjct: 381 RKKKQCPLCGLFFSNLSTHKSTHL--SPETRPFKC--EVCSRGFARSNDLIRHKKLH 433

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 32/70 (45%)

Query: 243 TDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRH 302
           T T  +  + R  C +C    +    L  H  IHTG+    C  EGC + F+   N  +H
Sbjct: 142 TKTNTAGQRTRHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQH 201

Query: 303 LKSHERKRNK 312
            ++H  K+ +
Sbjct: 202 YRTHANKKKR 211

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 3/64 (4%)

Query: 240 DWKTDTRISSTKLRK-QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSN 298
           + + + R  S KLR   C VC +  +R   LK HY  HT + P+ C    C + F  +  
Sbjct: 89  NLRLNGRTPSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGL--CNRCFTRRDL 146

Query: 299 MLRH 302
           ++RH
Sbjct: 147 LIRH 150

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRH 302
           CPVC +  +R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 82  CPVCTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 126

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKS-HERK 309
           C +CGK  +    LK H + HT    F C++EGC +SF     +  H+ S HE+K
Sbjct: 167 CSICGKGVTTRQQLKRHEITHTK--SFHCSYEGCNESFYKHPQLRSHILSVHEKK 219

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           +C  CGK  ++ S L  H   HT D PF C+   C K    +  + RH  +H +
Sbjct: 138 KCDTCGKEFAKKSHLNRHMFSHTDDKPFTCSI--CGKGVTTRQQLKRHEITHTK 189

 Score = 32.0 bits (71), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 7/76 (9%)

Query: 232 LNGSATFSDWKT-DTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCT 290
           L+ +  FS W +    I     +  CP+CGK C   S L+ H +IH      K  W+ C+
Sbjct: 256 LSCTDVFSTWSSLQQHIKQCHPKLPCPICGKPCVAESGLRNHMMIHDESLVTK-NWK-CS 313

Query: 291 K----SFNVKSNMLRH 302
                SF  K+ +++H
Sbjct: 314 SCPDTSFAKKTQLVQH 329

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 7/54 (12%)

Query: 256 CPVCGKICSRPSTLKTHYLIH-----TGDTPFKCTWEGCTKSFNVKSNMLRHLK 304
           CP C K   RP  LK H   H     TG   ++C +  CT  F+  S++ +H+K
Sbjct: 222 CPHCNKTFQRPYRLKNHIDKHHNPESTG--MYQCDFLSCTDVFSTWSSLQQHIK 273

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 7/67 (10%)

Query: 247 ISSTKLRKQ----CPVCGKICSRPSTLKTHYL-IHTGDTPFKCTWEGCTKSFNVKSNMLR 301
           I STK  ++    C +C K   R   LK H   +H+ + PF C    C K F+   N+ +
Sbjct: 636 IESTKELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQ 693

Query: 302 HLKSHER 308
           H+K+H++
Sbjct: 694 HIKTHKK 700

>Scas_717.17
          Length = 525

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLK 304
           C +C K   R S LK H L H+ +  + C W  C      + N+L+H+K
Sbjct: 390 CHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMK 436

>Kwal_47.17241
          Length = 403

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 37/86 (43%), Gaps = 9/86 (10%)

Query: 226 SEPGAVLNGSATFSDWKTDTR----ISSTKLRKQCPVCGKICSRPSTLKTHYL-IHTGDT 280
           +EPG V      F   KT  R    I     +  C  C +   R   LK H   +H G+ 
Sbjct: 316 AEPGVVKKKRLGFP--KTRGRKPSPILDASKQFACDFCDRRFKRQEHLKRHVRSLHMGEK 373

Query: 281 PFKCTWEGCTKSFNVKSNMLRHLKSH 306
           PF C    C K F+   N+ +H+K+H
Sbjct: 374 PFDCHI--CGKKFSRSDNLNQHIKTH 397

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLK 304
           +C  C K   R S LK H L H+   P+ C W  C      K N+ +HLK
Sbjct: 186 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLK 233

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 256 CPVCGKICSRPSTLKTHYL-IHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           C  C +   R   LK H   +H G+ P++C    C K F+   N+ +H+K+H
Sbjct: 266 CEFCDRRFKRQEHLKRHIRSLHMGEKPYEC--HICNKKFSRSDNLNQHIKTH 315

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 256 CPVCGKICSRPSTLKTHYL-IHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           C  C +   R   LK H   +H G+ P+ C  E C K F+   N+ +H+K+H
Sbjct: 356 CEFCDRRFKRQEHLKRHVRSLHMGEKPYGC--EICGKKFSRSDNLNQHIKTH 405

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 12/24 (50%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGD 279
           C +CGK  SR   L  H   H GD
Sbjct: 385 CEICGKKFSRSDNLNQHIKTHGGD 408

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRH 302
           CP+C +  +R   L+ H   HT + PF C +  C + F  +  +LRH
Sbjct: 85  CPICTRGFARQEHLRRHERSHTNEKPFLCAF--CGRCFARRDLVLRH 129

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRH 302
           CP+C +   R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 35  CPICTRGFVRLEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRH 79

>Scas_721.92
          Length = 1152

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRH 302
           C VC +  +R   L  H   HT + P++C    CTK F  +  +LRH
Sbjct: 80  CDVCSRAFARQEHLDRHARSHTNEKPYQCGI--CTKKFTRRDLLLRH 124

>Kwal_26.8021
          Length = 507

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKS 305
           +C +C K   R S  K H L H+   P+ C W  C      + N+ +H+K+
Sbjct: 390 RCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW--CQSRHKRRDNLFQHMKT 438

>YDL048C (STP4) [816] chr4 complement(366739..368211) Protein with
           strong similarity to Stp1p, which is involved in tRNA
           splicing and branched-chain amino acid uptake [1473 bp,
           490 aa]
          Length = 490

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 239 SDWKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSN 298
           S  K   +I+  + +K+CP+C    +  ST K+ +L    D P KC    C + F   ++
Sbjct: 262 SSLKDSAKITKQRKKKECPICHNFYANLSTHKSTHLT-PEDRPHKCPI--CQRGFARNND 318

Query: 299 MLRHLKSH 306
           ++RH K H
Sbjct: 319 LIRHKKRH 326

>Scas_707.31
          Length = 289

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 256 CPVCGKICSRPSTLKTHY-LIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERK 309
           C +C K   R   LK H+  IH    PF+C+   C K F+   N+ +H++ HE++
Sbjct: 225 CHLCKKRFKRHEHLKRHFRTIHLRVRPFECS--VCHKRFSRNDNLNQHVRIHEQQ 277

>Scas_602.9
          Length = 547

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 256 CPVCGKICSRPSTLKTHYL-IHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           C  C +   R   LK H   +H G+ P+ C    C K+F+   N+ +H+K+H
Sbjct: 497 CDYCERRFKRQEHLKRHVRSLHIGEKPYACHI--CNKNFSRSDNLTQHIKTH 546

>Scas_378.1
          Length = 208

 Score = 36.6 bits (83), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLK 304
           QC +C K   R S LK H L H+    + C    C      K N+L+HLK
Sbjct: 85  QCHMCVKSFRRHSWLKRHLLAHSSQRHYSCP--KCVSKHKRKDNLLQHLK 132

>Kwal_47.16621
          Length = 1178

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRH 302
           C +C +  +R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 80  CSICTRGFARQEHLKRHQRAHTNEKPFLCAF--CGRCFARRDLVLRH 124

>YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with strong
           similarity to Stp1p, which is involved in tRNA splicing
           and branched-chain amino acid uptake [1032 bp, 343 aa]
          Length = 343

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 245 TRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLK 304
           T+I+  + +KQCP+C    +  +T K  +L    D P KC    C + F   +++LRH K
Sbjct: 133 TKINKPRKKKQCPICRNFYANLTTHKATHLT-PEDRPHKCPI--CHRGFARNNDLLRHKK 189

Query: 305 SHER 308
            H +
Sbjct: 190 RHWK 193

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 256 CPVCGKICSRPSTLKTHYL-IHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           C  C +   R   LK H   +H G+ P+ C  + C K F+   N+ +H+K+H
Sbjct: 462 CEYCERRFKRQEHLKRHIRSLHMGEKPYGC--DICGKKFSRSDNLNQHIKTH 511

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 255 QCPVCGKICSRPSTLKTHYL-IHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           +C +C +   R   LK H   +H G+ P+ C  + C KSF+   N+ +H ++H
Sbjct: 219 KCDMCERRFKRQEHLKRHVSSLHMGERPYSC--DICLKSFSRSDNLNQHKRTH 269

>Scas_703.23
          Length = 1341

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRH 302
           CP C +   R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 74  CPTCTRGFVRQEHLKRHQRSHTNEKPFLCVF--CGRCFARRDLVLRH 118

>Scas_670.2
          Length = 435

 Score = 36.2 bits (82), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 251 KLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           + +KQCP+C    +  +T K  +L+   D P KC    C + F   ++++RH K H
Sbjct: 249 RRKKQCPICSGYYANLTTHKATHLV-PEDRPHKCPI--CQRGFGRNNDLIRHQKRH 301

>Scas_683.25
          Length = 879

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 253 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNM-LRHLKSHERK 309
           R  C  C K  SR      H   HTG  P+KC  + CT  F V+S++ LRH+K+  +K
Sbjct: 14  RFICSFCAKGFSRAEHKIRHERSHTGLKPYKC--KVCTHCF-VRSDLALRHIKTVHKK 68

>Scas_683.30
          Length = 478

 Score = 35.8 bits (81), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 6/69 (8%)

Query: 247 ISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           ++ T+ +KQCP C    +  ST K+ +L    D P KC    C + F   ++++RH K H
Sbjct: 280 VTKTRRKKQCPTCLNYYANLSTHKSTHLT-PEDRPHKCPI--CERGFARNNDLIRHKKRH 336

Query: 307 ---ERKRNK 312
              E K++K
Sbjct: 337 WKDEFKKDK 345

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 35.4 bits (80), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRH 302
           C +C +   R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRH 107

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 35.0 bits (79), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRH-LKSHERK 309
           C VCGK  +    L+ H + HT    FKC  EGC ++F     +  H L  HE+K
Sbjct: 180 CTVCGKGVTTRQQLRRHEITHT--KSFKCPHEGCGEAFYKHPQLRSHVLAVHEQK 232

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           QC  CG+  ++ S L+ H   H+   PF CT   C K    +  + RH  +H
Sbjct: 151 QCEQCGRGFTKKSHLERHLFSHSETKPFSCTV--CGKGVTTRQQLRRHEITH 200

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 3/51 (5%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTG---DTPFKCTWEGCTKSFNVKSNMLRHL 303
           C  C K   RP  LKTH   H G      ++CT  GC + F   S + +HL
Sbjct: 235 CTHCDKRFQRPYRLKTHIAKHHGPASQFRYQCTNAGCVQCFETWSALQQHL 285

 Score = 32.7 bits (73), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 3/49 (6%)

Query: 259 CGKICSRPSTLKTHY-LIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           C K  +RPS L  H    H G   ++C  E C + F  KS++ RHL SH
Sbjct: 126 CYKAFTRPSLLTEHQQTAHQGIRAYQC--EQCGRGFTKKSHLERHLFSH 172

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 34.7 bits (78), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 256 CPVCGKICSRPSTLKTHYL-IHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           C  C +   R   LK H   +H  + PF C    C K+F+   N+ +H+K+H
Sbjct: 391 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHI--CNKNFSRSDNLNQHVKTH 440

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 34.7 bits (78), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 253 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           R  C  C K  SR      H   H G  PF+C  + C+ SF  +  + RH+++  R
Sbjct: 11  RHFCSFCNKAFSRSEHKTRHERSHAGVKPFEC--QVCSHSFVRRDLLQRHIRTVHR 64

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 2/46 (4%)

Query: 257 PVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRH 302
           P C    SR   L  H   HTG+ PFKC    C K F+   N+ +H
Sbjct: 31  PGCEMSFSRAEHLARHIRRHTGEKPFKCDI--CLKYFSRIDNLKQH 74

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 29/65 (44%), Gaps = 8/65 (12%)

Query: 253 RKQCP--VCGKICSRPSTLKTHYLIHTGDTPFKCTW------EGCTKSFNVKSNMLRHLK 304
           R +CP   C K  SR   L  H L H     FKC +      + C K+F  +  + RH K
Sbjct: 44  RYKCPHPTCDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSGQPCGKTFVRRDLLNRHEK 103

Query: 305 SHERK 309
            HE K
Sbjct: 104 RHENK 108

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 256 CPVCGKICSRPSTLKTHYL-IHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           C  C +   R   LK H   +H  + P+ C    C K F+   N+ +HLK+H
Sbjct: 420 CEYCDRRFKRQEHLKRHIRSLHICEKPYGCHL--CGKKFSRSDNLSQHLKTH 469

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 8/73 (10%)

Query: 248 SSTKLRKQCP--VCGKICSRPSTLKTHYLIHTGDTPFKCTW------EGCTKSFNVKSNM 299
           SS   R +CP   C K  SR   L  H L H     + C++        C K+F  K  +
Sbjct: 25  SSPAERFRCPHPECNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTFVRKDLL 84

Query: 300 LRHLKSHERKRNK 312
           +RH K H + +N+
Sbjct: 85  IRHEKRHSKVKNR 97

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 10/60 (16%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSF--------NVKSNMLRHLKSHE 307
           C  CGK       LK H + HT    F C +EGC +SF        ++ +  L+ LK HE
Sbjct: 97  CSFCGKGLITRQQLKRHEVTHTK--SFNCEYEGCNESFYKHPQLRAHILAVHLQSLKCHE 154

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 3/54 (5%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTG---DTPFKCTWEGCTKSFNVKSNMLRHLKS 305
           +C  C K   RP  LK H   H        ++CT+  C+KSF   S +  H+K+
Sbjct: 151 KCHECNKSFQRPYRLKNHIAKHHNPDVVNAYQCTFSVCSKSFKTWSALRLHVKN 204

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 32.7 bits (73), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 5/61 (8%)

Query: 248 SSTKLRKQC---PVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLK 304
           +S K   +C   P C    +R   L  H   HTG+ PF+C    C K F+   N+ +H  
Sbjct: 13  ASVKRNYRCVGYPDCNMSFNRTEHLARHIRKHTGEKPFQCNI--CLKFFSRIDNLRQHQS 70

Query: 305 S 305
           S
Sbjct: 71  S 71

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKS 305
           C  C K  SR      H   HTG  PF C+   C+ SF  +  + RH+++
Sbjct: 10  CSFCAKPFSRSEHKARHERSHTGSKPFSCS--ICSHSFVRRDLLQRHIRT 57

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 33.5 bits (75), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRH 302
           CP C +   R   LK H   HT + P+ C +  C + F  +  +LRH
Sbjct: 153 CPTCTRGFVRQEHLKRHQHSHTREKPYLCIF--CGRCFARRDLVLRH 197

>Scas_631.7
          Length = 433

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTG---DTPFKCTWEGCTKSFNVKSNMLRHLK 304
           C  CGK   RP  L+ H   H      TP++CT+  C +SF   +    H+K
Sbjct: 173 CKHCGKKFQRPYRLQNHIAKHHNPDVKTPYQCTFANCHRSFRTWTLYQSHVK 224

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 2/52 (3%)

Query: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           +C  C K  SR + L+ H + H+   PF C    C K    +  + RH  +H
Sbjct: 89  KCEQCDKQFSRKTHLERHLISHSDSKPFCCL--HCGKGVTTRQQLKRHEVTH 138

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 40/90 (44%), Gaps = 18/90 (20%)

Query: 233 NGSATFSDW---KTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGC 289
           N   +F  W   ++  ++   KL+  C +C K+C   + LK H  +H  D   K  W+ C
Sbjct: 208 NCHRSFRTWTLYQSHVKMDHPKLK--CSICDKLCVGENGLKMHMSVHDEDLVIK-NWK-C 263

Query: 290 T---------KSFNVKSNMLRHL--KSHER 308
           T          SF  KS +L H   K HE+
Sbjct: 264 TICAEDADTFVSFPKKSELLNHYRDKHHEK 293

 Score = 28.5 bits (62), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSF 293
           C  CGK  +    LK H + HT    FKC +E C +++
Sbjct: 118 CLHCGKGVTTRQQLKRHEVTHT--KSFKCPYENCDEAY 153

>KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 289

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 2/57 (3%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRNK 312
           C  C  +  R S L+ H   H    P  CT   C K F  K  + RH  +   KRN+
Sbjct: 206 CEKCHMVFRRSSDLRRHERQHLPILPNICTL--CGKGFARKDALKRHFDTQTCKRNR 260

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 32.7 bits (73), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           C  C +  SR      H   HTG  PF C  + C  SF  +  + RH+++  R
Sbjct: 10  CSFCAQAFSRSEHKTRHERSHTGVKPFSC--KVCNHSFVRRDLLQRHIRTVHR 60

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 1/26 (3%)

Query: 282 FKCT-WEGCTKSFNVKSNMLRHLKSH 306
           FKCT ++GCT SF    ++ RH++ H
Sbjct: 41  FKCTGYDGCTMSFTRAEHLARHIRKH 66

 Score = 32.0 bits (71), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 259 CGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRN 311
           C    +R   L  H   HTG+ PF+C    C K F+   N+ +H +S    +N
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQC--PACLKFFSRVDNLKQHRESVHAHKN 99

>Scas_627.6
          Length = 1207

 Score = 32.3 bits (72), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 6/62 (9%)

Query: 257 PVCGKICSRPSTLKTHYLIHTGDTPFKC------TWEGCTKSFNVKSNMLRHLKSHERKR 310
           P C K  +R   L  H L H     F C      T   C K+F  K  ++RH K H + +
Sbjct: 47  PDCNKSFTRQEHLSRHKLNHWPKEIFVCPFIFPNTNITCNKTFVRKDLLIRHQKRHTKSK 106

Query: 311 NK 312
           N+
Sbjct: 107 NR 108

>Scas_719.68
          Length = 1350

 Score = 32.0 bits (71), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRH 302
           CP    IC+R   LK H   HT + PF C +  C + F  +  +LR+
Sbjct: 43  CP----ICTRTEHLKRHQRSHTREKPFVCVF--CGRCFARRDLVLRY 83

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 31.6 bits (70), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRH 302
           C VC +  +R   L  H   HT + P+ C    C + F  +  ++RH
Sbjct: 127 CKVCTRAFARQEHLTRHERSHTKEKPYVCGI--CERRFTRRDLLIRH 171

>Scas_720.33
          Length = 316

 Score = 31.2 bits (69), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 246 RISSTKLRKQCPVCG-KIC----SRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNML 300
           RI + K RK     G K C    +R   L  H   HTG+ PF+C    C + F+   N+ 
Sbjct: 5   RIGTQKERKTFACQGYKDCHMTFTREEHLARHIRKHTGEKPFQCYI--CFRFFSRMDNLK 62

Query: 301 RH 302
           +H
Sbjct: 63  QH 64

>Kwal_47.16577
          Length = 881

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 278 GDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRNK 312
           G  PF C + GC+KSF+   ++ RH  +H  ++ K
Sbjct: 9   GSGPFFCPFPGCSKSFSRSDHLGRHKANHSSEKYK 43

>Kwal_26.9300
          Length = 304

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 248 SSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHE 307
           S  + +K+CP+C    +  ST ++ +L    + P KC    C + F   +++LRH K H 
Sbjct: 140 SKPRRKKECPICHNFYANLSTHRSSHL-QPENKPHKCPV--CGRGFTRHNDLLRHRKRHW 196

Query: 308 RKRN 311
           +  +
Sbjct: 197 KDED 200

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 25/58 (43%), Gaps = 6/58 (10%)

Query: 257 PVCGKICSRPSTLKTHYLIHTGDTPFKCTW------EGCTKSFNVKSNMLRHLKSHER 308
           P C K  +R   L  H L H     F+C +        C ++F  +  ++RH K H R
Sbjct: 21  PNCSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVRRDLLVRHEKRHSR 78

>KLLA0E13519g complement(1190615..1191307) some similarities with
           sgd|S0006226 Saccharomyces cerevisiae YPR022c,
           hypothetical start
          Length = 230

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 6/56 (10%)

Query: 257 PVCGKICSRPSTLKTHYLIHTGDTPFKCTW----EG--CTKSFNVKSNMLRHLKSH 306
           P C K  SR   L+ H L H     F+C +    +G  C ++F  K  ++RH + H
Sbjct: 23  PDCEKTFSRYEHLQRHKLNHWPKQIFRCEYVYPDDGIVCNRTFVRKDLLVRHQRRH 78

>Kwal_55.20634
          Length = 419

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 269 LKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           + +H  +H    PF C+   CTK+F    ++ +HLK H
Sbjct: 109 ITSHLRVHVPLKPFACS--TCTKTFKRPQDLKKHLKVH 144

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308
           C  C K  SR      H   H G  PF+C  + C  SF  +  + RH+++  R
Sbjct: 10  CSFCLKPFSRSEHKIRHERSHAGVKPFQC--QVCKHSFVRRDLLQRHIRTVHR 60

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 251 KLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           +L+ Q   C     +   + +H  +H    PF C+   C+K F    ++ +HLK H
Sbjct: 188 QLKCQWDNCTSKTEKRDHMTSHLRVHVPLKPFACS--TCSKRFKRPQDLKKHLKIH 241

>KLLA0C16005g 1397274..1398269 some similarities with sgd|S0006151
           Saccharomyces cerevisiae YPL230w USV1, hypothetical
           start
          Length = 331

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 264 SRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKS 305
           +R   L  H   HTG+ PF+C    C + F+   N+ +H++S
Sbjct: 33  TRQEHLARHIRKHTGEQPFQCHL--CLRFFSRLDNLKQHVES 72

>AAR170W [358] [Homologous to ScYGL125W (MET13) - SH]
           complement(647776..649587) [1812 bp, 603 aa]
          Length = 603

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 9/28 (32%), Positives = 16/28 (57%)

Query: 278 GDTPFKCTWEGCTKSFNVKSNMLRHLKS 305
           GD P + TWE C   F    +++ H+++
Sbjct: 117 GDPPLQGTWEPCAGGFRYAKDLVAHIRA 144

>AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C
           (STP4) - SH] complement(1496510..1497469) [960 bp, 319
           aa]
          Length = 319

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 253 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           +K+CPVC    +  ST K+ +L      P KC  + C++ F   +++ RH K H
Sbjct: 126 KKECPVCHNFYANLSTHKSTHLDPEA-RPHKC--DICSRGFARSNDLQRHKKRH 176

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 29.3 bits (64), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 12/24 (50%)

Query: 256 CPVCGKICSRPSTLKTHYLIHTGD 279
           C  CGK   RP  LK H  +H  D
Sbjct: 120 CSTCGKKFKRPQDLKKHLRVHLDD 143

>AFR598C [3790] [Homologous to ScYBL042C (FUI1) - NSH]
           (1513045..1514952) [1908 bp, 635 aa]
          Length = 635

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 29/69 (42%), Gaps = 2/69 (2%)

Query: 74  LPPISSLLPNFENNT--PPNVDSRVQFPPQQVYQSMNVVPIVNEIYTPISMNATSDQYPI 131
           +  + S L NF       P+     + P   +Y  + ++PIV    + I +  T+  Y I
Sbjct: 326 IRALMSALDNFSTLVLNAPDFSRFAKSPKSSIYSQLIILPIVFSTISLIGILVTASTYTI 385

Query: 132 YYTESQQPI 140
           Y+     P+
Sbjct: 386 YHVNEWDPL 394

>AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH]
           (783110..784408) [1299 bp, 432 aa]
          Length = 432

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 34/86 (39%), Gaps = 9/86 (10%)

Query: 228 PGAVLNGSATFSDWKTDTRISS-TKLRKQCPVCGKICSRPSTLKTHYL-IHTG-----DT 280
           PG+ L  S   SD  TDT      +L  Q   CG   S+P  L  H    H G     + 
Sbjct: 47  PGSTLPTSP--SDVSTDTENDEHQRLLCQWDACGSEFSQPELLYHHLCQDHVGRKSQRNL 104

Query: 281 PFKCTWEGCTKSFNVKSNMLRHLKSH 306
              C W  CT     + ++  HL+ H
Sbjct: 105 QLNCHWGSCTTKTVKRDHITSHLRVH 130

>Scas_604.4
          Length = 585

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 269 LKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306
           + +H  +H    PF C  + CTK F    ++ +HL++H
Sbjct: 234 ITSHLRVHVPLKPFAC--KKCTKKFKRPQDLKKHLRTH 269

>YDR380W (ARO10) [1207] chr4 (1234206..1236113) Minor
           alpha-ketoisocaproate carboxylase, putative
           indole-3-pyruvate decarboxylase [1908 bp, 635 aa]
          Length = 635

 Score = 28.9 bits (63), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 60/147 (40%), Gaps = 16/147 (10%)

Query: 101 QQVYQSMNVVPIVNEIYTPISMNATSDQYPIYYTESQQPIPHSQSPHLTSSAPLMMPVMV 160
           +Q+++ +N  PI+ E+Y  I ++  S QY    T+        + P    S+ +    + 
Sbjct: 368 EQMFKGINFAPILKELYKRIDVSKLSLQYDSNVTQYTNETMRLEDPTNGQSSIITQVHLQ 427

Query: 161 PTVYKPLTPYDKEPITIASEPNFT-AISMASHPNAALELCHDRPKSV----PPGYGVLPT 215
            T+ K L P D   + +    +F  ++   + P+    +      S+    P   GV   
Sbjct: 428 KTMPKFLNPGD---VVVCETGSFQFSVRDFAFPSQLKYISQGFFLSIGMALPAALGVGIA 484

Query: 216 MQEASNGRTKSEPGAVLNGSATFSDWK 242
           MQ+ SN        A +NG     D+K
Sbjct: 485 MQDHSN--------AHINGGNVKEDYK 503

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.129    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,797,033
Number of extensions: 489816
Number of successful extensions: 1663
Number of sequences better than 10.0: 215
Number of HSP's gapped: 1586
Number of HSP's successfully gapped: 292
Length of query: 312
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 211
Effective length of database: 13,099,691
Effective search space: 2764034801
Effective search space used: 2764034801
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 61 (28.1 bits)