Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPR011C32632116040.0
Sklu_2363.232332112611e-176
CAGL0J01661g32732212501e-174
Kwal_14.221031531210641e-146
AGL047C3163159471e-128
KLLA0D04290g1881876816e-90
KLLA0D04312g103903922e-47
YHR002W (LEU5)3573193679e-41
Scas_717.203563253633e-40
CAGL0K02915g3423193607e-40
KLLA0E18788g3813243504e-38
CAGL0J05522g5193183485e-37
Kwal_26.79723583223382e-36
Scas_578.3*5243343382e-35
Kwal_23.30425423223347e-35
Sklu_2374.75133183213e-33
KLLA0C11363g5173343198e-33
YNL083W5453223191e-32
AGL065C3353163101e-32
AER419W4933182942e-29
KLLA0D15015g3173262862e-29
Scas_667.43083092755e-28
ADL049W9123032821e-27
YPR021C (AGC1)9023062778e-27
Scas_718.243373112671e-26
Scas_602.88853022742e-26
Kwal_47.173218813032714e-26
YMR056C (AAC1)3092972624e-26
CAGL0J02002g3613212628e-26
CAGL0F04213g3063012572e-25
YBL030C (PET9)3182962555e-25
YBR085W (AAC3)3073072538e-25
Kwal_27.124813043052521e-24
YEL006W3353062541e-24
CAGL0K02365g9193102601e-24
Sklu_2359.69023032564e-24
AER184W3052952475e-24
Kwal_55.208683803112444e-23
Scas_709.93653142427e-23
KLLA0E13453g9063032441e-22
ADL009W3793112365e-22
YJL133W (MRS3)3143012335e-22
YGR096W (TPC1)3143302311e-21
Sklu_2334.23193262302e-21
KLLA0E12353g3053072264e-21
AAR036W3173282274e-21
Scas_716.293163362249e-21
Kwal_23.39653073252222e-20
Sklu_2037.23103162222e-20
Scas_379.23013012212e-20
YJR095W (SFC1)3223182213e-20
ACR260W3112982204e-20
YIL006W3733012181e-19
KLLA0D14036g4313392191e-19
KLLA0D07073g2973012142e-19
YKR052C (MRS4)3043042133e-19
CAGL0K08250g2972952123e-19
CAGL0G03135g3073262115e-19
Scas_691.43343182101e-18
Scas_632.92923252081e-18
Scas_662.123083102063e-18
Kwal_33.140503143072063e-18
KLLA0E15532g3263122064e-18
YOR130C (ORT1)2923142035e-18
Kwal_23.47313143162021e-17
YIL134W (FLX1)3113152021e-17
Sklu_2431.53703181994e-17
Scas_582.73292991985e-17
AGL311C3623341985e-17
Kwal_47.182163333281951e-16
KLLA0E02772g2843131931e-16
Scas_721.273743211952e-16
CAGL0M09020g3483341932e-16
Kwal_26.86692963011903e-16
CAGL0G08910g2893011886e-16
YGR257C (MTM1)3662781881e-15
KLLA0E23705g3683171871e-15
Scas_667.223063351842e-15
Kwal_27.120813693151853e-15
Scas_640.253063051833e-15
Scas_669.63731581835e-15
CAGL0L05742g3053011815e-15
CAGL0K10362g3013211781e-14
Sklu_1926.23053201745e-14
CAGL0F07711g3681671756e-14
YMR166C3681661748e-14
Sklu_2127.52782971728e-14
Scas_589.103163141738e-14
CAGL0K11616g3202941721e-13
CAGL0D01606g3053261711e-13
KLLA0F03212g3053101702e-13
KLLA0E02750g3042871702e-13
AEL253W3652701702e-13
AFR146W2813181673e-13
YPR058W (YMC1)3072991674e-13
KLLA0B08503g3033061665e-13
KLLA0F04697g3073151666e-13
Scas_645.93912841669e-13
Kwal_33.129883033231641e-12
YKL120W (OAC1)3243111631e-12
YOR222W (ODC2)3073051622e-12
AFL196W3611371623e-12
CAGL0L02079g2973081604e-12
Kwal_23.43543432901604e-12
Sklu_2430.103243141604e-12
Sklu_2398.43093191594e-12
Kwal_55.213353173171595e-12
Scas_718.53242991596e-12
Scas_714.183053211586e-12
Sklu_1275.13113231586e-12
YNL003C (PET8)2843101551e-11
ADL264C3291291543e-11
YPL134C (ODC1)3103111533e-11
KLLA0C13431g3281381533e-11
AFR147C3153071524e-11
AFR131C3442761525e-11
YBR291C (CTP1)2993131515e-11
Scas_489.42973091506e-11
Kwal_26.79672973011498e-11
CAGL0M05225g3812851509e-11
AER366W2932591472e-10
YBR192W (RIM2)3772661482e-10
Scas_697.473283171472e-10
Kwal_26.76533253021472e-10
KLLA0F17864g3073181453e-10
Kwal_0.2322741411434e-10
Kwal_55.213383232791444e-10
ACR109W2993011444e-10
Kwal_27.125993043231445e-10
Sklu_1149.22963091435e-10
KLLA0A09383g3662911446e-10
Scas_721.1293233091436e-10
Kwal_23.35293952991446e-10
CAGL0H10538g2973181426e-10
KLLA0E18810g3773081429e-10
Kwal_56.230113033251419e-10
CAGL0B04543g3171371382e-09
CAGL0K12210g3112991382e-09
CAGL0H03839g2823061364e-09
CAGL0F08305g3742721374e-09
YOR100C (CRC1)3273061365e-09
Kwal_27.114192983141356e-09
Scas_558.22891381339e-09
KLLA0E08877g2943191331e-08
CAGL0J04114g3033041293e-08
YBR104W (YMC2)3293241284e-08
Kwal_23.29133201241276e-08
Scas_673.173143161269e-08
KLLA0B12826g3193091251e-07
AAL014C2712991241e-07
KLLA0D09889g3641401251e-07
CAGL0G01166g2952951241e-07
YJR077C (MIR1)3113071242e-07
AGR383W2931381232e-07
Sklu_2435.23443271232e-07
YLR348C (DIC1)2982951213e-07
Sklu_1119.13073071205e-07
Sklu_2115.42993081205e-07
Scas_687.15*3281931196e-07
Sklu_2432.52881921189e-07
Sklu_2442.82751201161e-06
CAGL0F00231g3072971143e-06
KLLA0B14454g3051271116e-06
Kwal_33.155973051271117e-06
KLLA0D04950g2741331053e-05
Scas_198.17250963e-05
YPR128C (ANT1)3283061054e-05
Sklu_2433.84201171054e-05
Kwal_33.154463053111044e-05
Scas_328.12271171025e-05
Kwal_47.19228281921027e-05
AFR253W3441291028e-05
AGL064W2963021011e-04
Scas_702.10302291973e-04
AER450C308149964e-04
Kwal_55.21106328315965e-04
YDL119C307216965e-04
KLLA0E09680g307309956e-04
Scas_613.24177186936e-04
ADR036C340107930.001
Sklu_2127.4323289930.001
Scas_715.45305167930.001
Sklu_2075.3345133930.001
KLLA0F08547g308152910.002
Kwal_34.15907312132900.003
YER053C300155890.003
Scas_671.1*12381840.004
KLLA0B11319g355255890.004
Kwal_23.5757307295880.004
Sklu_2250.17525810.005
CAGL0D04774g32267880.005
YFR045W285158870.005
CAGL0C02013g329173860.008
Scas_562.12300123860.008
Scas_705.932380860.009
Sklu_2260.5302155850.012
YDL198C (YHM1)300134840.016
CAGL0J09790g300132830.016
AGR191W298133830.017
KLLA0A00979g34389810.037
KLLA0F13464g300133790.054
CAGL0B03883g306135790.060
Sklu_2117.2298132770.094
YMR241W (YHM2)314150750.20
Sklu_2194.3312149750.21
ABL023W309111750.21
Sklu_2436.1849489750.25
Kwal_27.11626299124730.33
CAGL0K07436g307104710.57
AFR242C82364681.8
Scas_433.1116797654.2
Scas_696.9312103627.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR011C
         (321 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...   622   0.0  
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                         490   e-176
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...   486   e-174
Kwal_14.2210                                                          414   e-146
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...   369   e-128
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...   266   6e-90
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...   155   2e-47
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...   145   9e-41
Scas_717.20                                                           144   3e-40
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...   143   7e-40
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...   139   4e-38
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...   138   5e-37
Kwal_26.7972                                                          134   2e-36
Scas_578.3*                                                           134   2e-35
Kwal_23.3042                                                          133   7e-35
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement      128   3e-33
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...   127   8e-33
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...   127   1e-32
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...   124   1e-32
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...   117   2e-29
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...   114   2e-29
Scas_667.4                                                            110   5e-28
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....   113   1e-27
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...   111   8e-27
Scas_718.24                                                           107   1e-26
Scas_602.8                                                            110   2e-26
Kwal_47.17321                                                         108   4e-26
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...   105   4e-26
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...   105   8e-26
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...   103   2e-25
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...   102   5e-25
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...   102   8e-25
Kwal_27.12481                                                         101   1e-24
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...   102   1e-24
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...   104   1e-24
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                         103   4e-24
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...   100   5e-24
Kwal_55.20868                                                          99   4e-23
Scas_709.9                                                             98   7e-23
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    99   1e-22
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    96   5e-22
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    94   5e-22
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    94   1e-21
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         93   2e-21
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    92   4e-21
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    92   4e-21
Scas_716.29                                                            91   9e-21
Kwal_23.3965                                                           90   2e-20
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         90   2e-20
Scas_379.2                                                             90   2e-20
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    90   3e-20
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    89   4e-20
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    89   1e-19
KLLA0D14036g complement(1203522..1204817) some similarities with...    89   1e-19
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    87   2e-19
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    87   3e-19
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    86   3e-19
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    86   5e-19
Scas_691.4                                                             86   1e-18
Scas_632.9                                                             85   1e-18
Scas_662.12                                                            84   3e-18
Kwal_33.14050                                                          84   3e-18
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    84   4e-18
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    83   5e-18
Kwal_23.4731                                                           82   1e-17
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    82   1e-17
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            81   4e-17
Scas_582.7                                                             81   5e-17
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    81   5e-17
Kwal_47.18216                                                          80   1e-16
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    79   1e-16
Scas_721.27                                                            80   2e-16
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    79   2e-16
Kwal_26.8669                                                           78   3e-16
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    77   6e-16
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    77   1e-15
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    77   1e-15
Scas_667.22                                                            75   2e-15
Kwal_27.12081                                                          76   3e-15
Scas_640.25                                                            75   3e-15
Scas_669.6                                                             75   5e-15
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    74   5e-15
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    73   1e-14
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          72   5e-14
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    72   6e-14
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    72   8e-14
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         71   8e-14
Scas_589.10                                                            71   8e-14
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    71   1e-13
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    70   1e-13
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    70   2e-13
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    70   2e-13
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    70   2e-13
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    69   3e-13
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    69   4e-13
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    69   5e-13
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    69   6e-13
Scas_645.9                                                             69   9e-13
Kwal_33.12988                                                          68   1e-12
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    67   1e-12
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    67   2e-12
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    67   3e-12
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    66   4e-12
Kwal_23.4354                                                           66   4e-12
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         66   4e-12
Sklu_2398.4 , Contig c2398 9476-10405                                  66   4e-12
Kwal_55.21335                                                          66   5e-12
Scas_718.5                                                             66   6e-12
Scas_714.18                                                            65   6e-12
Sklu_1275.1 , Contig c1275 314-1249                                    65   6e-12
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    64   1e-11
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    64   3e-11
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    64   3e-11
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    64   3e-11
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    63   4e-11
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    63   5e-11
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    63   5e-11
Scas_489.4                                                             62   6e-11
Kwal_26.7967                                                           62   8e-11
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    62   9e-11
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    61   2e-10
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    62   2e-10
Scas_697.47                                                            61   2e-10
Kwal_26.7653                                                           61   2e-10
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    60   3e-10
Kwal_0.232                                                             60   4e-10
Kwal_55.21338                                                          60   4e-10
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    60   4e-10
Kwal_27.12599                                                          60   5e-10
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         60   5e-10
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    60   6e-10
Scas_721.129                                                           60   6e-10
Kwal_23.3529                                                           60   6e-10
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    59   6e-10
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    59   9e-10
Kwal_56.23011                                                          59   9e-10
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    58   2e-09
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    58   2e-09
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    57   4e-09
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    57   4e-09
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    57   5e-09
Kwal_27.11419                                                          57   6e-09
Scas_558.2                                                             56   9e-09
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    56   1e-08
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    54   3e-08
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    54   4e-08
Kwal_23.2913                                                           54   6e-08
Scas_673.17                                                            53   9e-08
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    53   1e-07
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    52   1e-07
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    53   1e-07
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    52   1e-07
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    52   2e-07
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    52   2e-07
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         52   2e-07
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    51   3e-07
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             51   5e-07
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            51   5e-07
Scas_687.15*                                                           50   6e-07
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       50   9e-07
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          49   1e-06
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    49   3e-06
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    47   6e-06
Kwal_33.15597                                                          47   7e-06
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    45   3e-05
Scas_198.1                                                             42   3e-05
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    45   4e-05
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       45   4e-05
Kwal_33.15446                                                          45   4e-05
Scas_328.1                                                             44   5e-05
Kwal_47.19228                                                          44   7e-05
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    44   8e-05
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    44   1e-04
Scas_702.10                                                            42   3e-04
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    42   4e-04
Kwal_55.21106                                                          42   5e-04
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    42   5e-04
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    41   6e-04
Scas_613.24                                                            40   6e-04
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    40   0.001
Sklu_2127.4 , Contig c2127 6322-7293                                   40   0.001
Scas_715.45                                                            40   0.001
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                40   0.001
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    40   0.002
Kwal_34.15907                                                          39   0.003
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    39   0.003
Scas_671.1*                                                            37   0.004
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    39   0.004
Kwal_23.5757                                                           39   0.004
Sklu_2250.1 YBL030C, Contig c2250 1624-1847                            36   0.005
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    39   0.005
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    38   0.005
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    38   0.008
Scas_562.12                                                            38   0.008
Scas_705.9                                                             38   0.009
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         37   0.012
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    37   0.016
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    37   0.016
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    37   0.017
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    36   0.037
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    35   0.054
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    35   0.060
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            34   0.094
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    33   0.20 
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            33   0.21 
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    33   0.21 
Sklu_2436.18 YDR470C, Contig c2436 37947-39431 reverse complement      33   0.25 
Kwal_27.11626                                                          33   0.33 
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    32   0.57 
AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH] (873480..8...    31   1.8  
Scas_433.1                                                             30   4.2  
Scas_696.9                                                             28   7.9  

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/321 (95%), Positives = 308/321 (95%)

Query: 1   MAEVLTVLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN 60
           MAEVLTVLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN
Sbjct: 1   MAEVLTVLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN 60

Query: 61  RGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQL 120
           RGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQL
Sbjct: 61  RGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQL 120

Query: 121 TNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSE 180
           TNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSE
Sbjct: 121 TNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSE 180

Query: 181 TXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIG 240
           T             VWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIG
Sbjct: 181 TYRLEGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIG 240

Query: 241 AISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAA 300
           AISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAA
Sbjct: 241 AISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAA 300

Query: 301 NLFKVVPSTAVSWLVYEVVCD 321
           NLFKVVPSTAVSWLVYEVVCD
Sbjct: 301 NLFKVVPSTAVSWLVYEVVCD 321

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score =  490 bits (1261), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 237/321 (73%), Positives = 270/321 (84%), Gaps = 3/321 (0%)

Query: 1   MAEVLTVLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN 60
           M+E+  VL QP+ +K  LK DSN+AFLAGG+AGAVSRTVVSPFERVKILLQVQ+STT+YN
Sbjct: 1   MSELAQVLPQPSYVKSILKNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYN 60

Query: 61  RGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQL 120
           +GI  ++RQVY EEGT GLFRGNGLNCIRIFPYSAVQFVVYEACKK  FHV+G+ G+EQL
Sbjct: 61  QGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQL 120

Query: 121 TNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSE 180
            N QRLFSGALCGGCSV+ATYPLDL++TRLSIQTANL+ L++S+A +ISKPPG+W LL  
Sbjct: 121 QNWQRLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCR 180

Query: 181 TXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIG 240
           T             VWPTSLGVVPYVALNFAVYEQ +EF    +D   +  +N YKL+IG
Sbjct: 181 TYKEEGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTD---NTLANFYKLSIG 237

Query: 241 AISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAA 300
           A+SGGVAQT+TYPFDLLRRRFQVLAMGGNELGFRY SV DAL+TIG+ EG  GYYKGL A
Sbjct: 238 ALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTA 297

Query: 301 NLFKVVPSTAVSWLVYEVVCD 321
           NLFKV+PSTAVSWLVYEVVCD
Sbjct: 298 NLFKVIPSTAVSWLVYEVVCD 318

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score =  486 bits (1250), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 232/322 (72%), Positives = 269/322 (83%), Gaps = 1/322 (0%)

Query: 1   MAEV-LTVLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSY 59
           M+EV L  +E+ N +K+FLKQD+N+AFLAGG+AGA+SRTVVSPFERVKILLQVQSSTT+Y
Sbjct: 1   MSEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAY 60

Query: 60  NRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQ 119
           N+G+F +I QVY EE  KGLFRGNGLNCIR+FPYSAVQFVV+E CKK +FHV+     EQ
Sbjct: 61  NKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQ 120

Query: 120 LTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLS 179
           L N QRLFSGALCGGCSVVATYPLDL++TRLS+QTANLS L++S+A  I+KPPG+W+LLS
Sbjct: 121 LNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLS 180

Query: 180 ETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTI 239
           +              VWPTSLG+VPYVALNFAVYEQL+EF  +  +   S + +LYKL++
Sbjct: 181 KAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSM 240

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299
           GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGF Y SVWDALVTIG+ EG  GYYKGL 
Sbjct: 241 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLT 300

Query: 300 ANLFKVVPSTAVSWLVYEVVCD 321
           ANLFKVVPSTAVSWLVYE+  D
Sbjct: 301 ANLFKVVPSTAVSWLVYELTWD 322

>Kwal_14.2210
          Length = 315

 Score =  414 bits (1064), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 215/312 (68%), Positives = 247/312 (79%), Gaps = 6/312 (1%)

Query: 10  QPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQ 69
           Q +S +  LK D+ IAF AGG+AGAVSRTVVSPFERVKILLQVQSST +YN G+F +++Q
Sbjct: 5   QDHSWRCALKSDAGIAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQ 64

Query: 70  VYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSG 129
           VY EEG  GL RGNGLNCIRIFPYSAVQF+VYE CKK+ F  N +     + N  RL SG
Sbjct: 65  VYLEEGVPGLLRGNGLNCIRIFPYSAVQFLVYEFCKKQWFQQNPDT---VVLNWHRLVSG 121

Query: 130 ALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXX 189
           ALCGGCSV+ATYPLDL++TRLSIQTANL+ L+++KA S +KPPG+W+LL +T        
Sbjct: 122 ALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIF 181

Query: 190 XXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQT 249
                VWPTS+GVVPYVALNFAVYEQLRE+   S D      ++LYKL+IGAISGGVAQT
Sbjct: 182 GLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASFDPA---SASLYKLSIGAISGGVAQT 238

Query: 250 ITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPST 309
           ITYPFDLLRRRFQVLAMG +ELGF Y SV DAL+TIGR EG  GYYKGL ANLFKVVPST
Sbjct: 239 ITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPST 298

Query: 310 AVSWLVYEVVCD 321
           AVSW+VYE V D
Sbjct: 299 AVSWVVYETVRD 310

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score =  369 bits (947), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 197/315 (62%), Positives = 236/315 (74%), Gaps = 5/315 (1%)

Query: 8   LEQP-NSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSS 66
           + QP N I+   K D  IAF+AGGV GAVSRTVVSP ERVKILLQVQSSTT+YN G+  +
Sbjct: 1   MGQPENYIQTVYKNDGFIAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHA 60

Query: 67  IRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRL 126
           ++QVY EEG KGLFRGNG+NC+RIFPYSAVQ+ VYE CK ++FHV G +G EQL + +RL
Sbjct: 61  VKQVYKEEGVKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHV-GQSGHEQLRSWERL 119

Query: 127 FSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXX 186
             GAL GG SV+ TYPLDL++TRLSIQTANL+ L+RSKA  I +PPGI +LL        
Sbjct: 120 VGGALGGGASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEG 179

Query: 187 XXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGV 246
                   V+PTSLGVVP+VALNFA+YE+L+    +  DA     +   KL IGA+SGG+
Sbjct: 180 GLRGWYRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAA---KLAIGAVSGGI 236

Query: 247 AQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVV 306
           AQT+ YPFDLLRRRFQVL MG +ELGFRY SV DAL TIGR EG+ GYYKGL ANL KVV
Sbjct: 237 AQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVV 296

Query: 307 PSTAVSWLVYEVVCD 321
           P+ AV W VYE++ +
Sbjct: 297 PAMAVQWFVYELISE 311

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 29  GGVAGAVSRTVVSPFE----RVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNG 84
           G V+G +++TVV PF+    R ++L   QS        +  ++  +  +EG +G ++G  
Sbjct: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289

Query: 85  LNCIRIFPYSAVQFVVYEACKKKL 108
            N +++ P  AVQ+ VYE   + +
Sbjct: 290 ANLVKVVPAMAVQWFVYELISENM 313

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score =  266 bits (681), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 127/187 (67%), Positives = 153/187 (81%)

Query: 13  SIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYH 72
            +K   KQ+S+IAF+AGGVAGAVSRTVVSPFERVKILLQVQSST++YN GI +++ QVY 
Sbjct: 2   DLKQLAKQESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYK 61

Query: 73  EEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALC 132
           EEG  GLFRGNGLNC+RIFPYSAVQFVVYE CKK +FHV+G  G+EQL N QRL +GALC
Sbjct: 62  EEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALC 121

Query: 133 GGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXX 192
           GG SV+ATYPLDL++TRLSIQTANL+ L++SKAK I+KPPG+W+LL +T           
Sbjct: 122 GGMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLY 181

Query: 193 XXVWPTS 199
             ++PTS
Sbjct: 182 RGIYPTS 188

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 53/107 (49%), Gaps = 11/107 (10%)

Query: 202 VVPYVALNFAVYEQLRE--FGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRR 259
           + PY A+ F VYE  ++  F V+ +  +     N  +L+ GA+ GG++   TYP DL+R 
Sbjct: 79  IFPYSAVQFVVYEWCKKHIFHVDGTVGKEQL-LNWQRLSAGALCGGMSVLATYPLDLVRT 137

Query: 260 RFQVLAMGGNELG-------FRYTSVWDALVTIGRAE-GVSGYYKGL 298
           R  +      +L         +   VW+ LV   + E G+ G Y+G+
Sbjct: 138 RLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184

 Score = 40.0 bits (92), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 43/78 (55%), Gaps = 4/78 (5%)

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299
           G ++G V++T+  PF+    R ++L    +        + +A+  + + EGV+G ++G  
Sbjct: 18  GGVAGAVSRTVVSPFE----RVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFRGNG 73

Query: 300 ANLFKVVPSTAVSWLVYE 317
            N  ++ P +AV ++VYE
Sbjct: 74  LNCVRIFPYSAVQFVVYE 91

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score =  155 bits (392), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 81/90 (90%)

Query: 232 SNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGV 291
           +NLYKL +GAISGGVAQT+ YPFDLLRRRFQVLAMGGNELGFRY SV DAL+TIG+ EG 
Sbjct: 9   ANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGP 68

Query: 292 SGYYKGLAANLFKVVPSTAVSWLVYEVVCD 321
            GYYKGL ANLFKV+PSTAVSWLVYEV+ +
Sbjct: 69  KGYYKGLTANLFKVIPSTAVSWLVYEVIRE 98

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 50/96 (52%), Gaps = 8/96 (8%)

Query: 21  DSNIAFL----AGGVAGAVSRTVVSPFE----RVKILLQVQSSTTSYNRGIFSSIRQVYH 72
           D N+A L     G ++G V++T+V PF+    R ++L    +      + +  ++  +  
Sbjct: 5   DPNLANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGK 64

Query: 73  EEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKL 108
            EG KG ++G   N  ++ P +AV ++VYE  ++ +
Sbjct: 65  TEGPKGYYKGLTANLFKVIPSTAVSWLVYEVIREAM 100

 Score = 32.3 bits (72), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 44/110 (40%), Gaps = 28/110 (25%)

Query: 119 QLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISK-------- 170
            L N  +L  GA+ GG +    YP DL++ R  +     + L   + KS+S         
Sbjct: 7   NLANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELG-FRYKSVSDALITIGKT 65

Query: 171 --PPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLRE 218
             P G ++ L+                      V+P  A+++ VYE +RE
Sbjct: 66  EGPKGYYKGLTANL-----------------FKVIPSTAVSWLVYEVIRE 98

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score =  145 bits (367), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 96/319 (30%), Positives = 158/319 (49%), Gaps = 35/319 (10%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNR------GIFSSIRQVYHEEGTKGLF 80
           LAGG++G+ ++T+++P +R+KIL Q  +S   Y +      G+  + + ++  +G +G F
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQ--TSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFF 95

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
           +G+    +RIFPY+AV+FV YE  +  L        +E  ++ +RL SG+L G CSV  T
Sbjct: 96  QGHSATLLRIFPYAAVKFVAYEQIRNTLI-----PSKEFESHWRRLVSGSLAGLCSVFIT 150

Query: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXX--XXXXXVWPT 198
           YPLDL++ RL+ +T +         K I K P    L+                    PT
Sbjct: 151 YPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPT 210

Query: 199 SLGVVPYVALNFAVYEQLRE-----FGVNSSDAQPSWKSNLYK--------------LTI 239
            LG++PY  ++F  ++ L +     F    S  + S    L +              L  
Sbjct: 211 VLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAELIS 270

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNEL-GFRYTSVWDALVTIGRAEGVSGYYKGL 298
           G ++G  +QT  YPF+++RRR QV A+    +   ++ S+ +    I +  GV G++ GL
Sbjct: 271 GGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGFFVGL 330

Query: 299 AANLFKVVPSTAVSWLVYE 317
           +    KV P  A S+ VYE
Sbjct: 331 SIGYIKVTPMVACSFFVYE 349

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/229 (20%), Positives = 90/229 (39%), Gaps = 29/229 (12%)

Query: 110 HVNGNNGQEQLTNTQRL-------FSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNR 162
           H+N N  Q+   +            +G + G C+     PLD IK        + +    
Sbjct: 14  HINKNTTQKTSFDRNSFDYIVRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTG 73

Query: 163 SKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVN 222
           S    +     IW  +++                 T L + PY A+ F  YEQ+R   + 
Sbjct: 74  SLIGLVEAAKHIW--INDGVRGFFQGHSA------TLLRIFPYAAVKFVAYEQIRNTLIP 125

Query: 223 SSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGN-ELGFRYTSVWD- 280
           S + +  W+    +L  G+++G  +  ITYP DL+R R          +LG     ++  
Sbjct: 126 SKEFESHWR----RLVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKE 181

Query: 281 -ALVTIGRAEGVS-------GYYKGLAANLFKVVPSTAVSWLVYEVVCD 321
            A  T+ + + +         +Y+G    +  ++P   VS+  ++++ D
Sbjct: 182 PASATLIKNDYIPNWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHD 230

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 94/230 (40%), Gaps = 44/230 (19%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGL------- 79
           ++G +AG  S  +  P + V++ L  ++       G    I+++Y E  +  L       
Sbjct: 137 VSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLG--RIIKKIYKEPASATLIKNDYIP 194

Query: 80  ---------FRGNGLNCIRIFPYSAVQF----VVYEACKKKLF------HVNGNNGQEQL 120
                    +RG     + + PY+ V F    ++++  K   F       ++ ++  E++
Sbjct: 195 NWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERV 254

Query: 121 TNTQR--------LFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPP 172
              QR        L SG L G  S  A YP ++I+ RL +   +  ++   K +SIS+  
Sbjct: 255 QKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIA 314

Query: 173 GIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLR-EFGV 221
            I  +  E              +      V P VA +F VYE+++  FG+
Sbjct: 315 HI--IFKERGVRGFFVGLSIGYI-----KVTPMVACSFFVYERMKWNFGI 357

>Scas_717.20
          Length = 356

 Score =  144 bits (363), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 99/325 (30%), Positives = 162/325 (49%), Gaps = 47/325 (14%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNR------GIFSSIRQVYHEEGTKGLF 80
           LAGG++G+ ++T+++P +R+KIL Q  +S   Y +      G+  + + ++  +G +G F
Sbjct: 37  LAGGISGSCAKTLIAPLDRIKILFQ--TSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFF 94

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
           +G+ +  +RIFPY+AV+FV YE  +  L        +E  ++ +RL SG+L G CSV  T
Sbjct: 95  QGHSVTLMRIFPYAAVKFVAYEQIRNTLI-----PSKEYESHWRRLMSGSLAGLCSVFTT 149

Query: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVW---- 196
           YPLDLI+ RL+  T +         K+I K P      + T              W    
Sbjct: 150 YPLDLIRVRLAYVTEHKRISLLGLVKTIYKEP------ASTTLEAKGYIPNWFAHWCNFY 203

Query: 197 ----PTSLGVVPYVALNFAVYEQLRE---------FGV----NSSDAQPSWKSNLYKLTI 239
               PT LG++PY  ++F  ++ L +         + V     S   +  +K     L  
Sbjct: 204 RGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRLPLRT 263

Query: 240 GA--ISGGVA----QTITYPFDLLRRRFQVLAMGGNEL-GFRYTSVWDALVTIGRAEGVS 292
            A  +SGG+A    QT  YPF+++RRR QV  +  +++   R+ S+ +    I +  G  
Sbjct: 264 WAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWR 323

Query: 293 GYYKGLAANLFKVVPSTAVSWLVYE 317
           G++ GL+    KV P  A S+ VYE
Sbjct: 324 GFFVGLSIGYIKVTPMVACSFFVYE 348

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 55/115 (47%), Gaps = 11/115 (9%)

Query: 4   VLTVLEQPNSIKDFLKQDSNI----AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTS- 58
           VL + E     + F  Q   +      L+GG+AG  S+T   PFE ++  LQV + + S 
Sbjct: 241 VLALSESEQEERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQ 300

Query: 59  -YNRGIFSSIRQV----YHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKL 108
            Y+   F SI ++    Y E G +G F G  +  I++ P  A  F VYE  K  L
Sbjct: 301 MYDHR-FQSISEIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHL 354

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 88/226 (38%), Gaps = 40/226 (17%)

Query: 114 NNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLN--------RSKA 165
            N  E +T +    +G + G C+     PLD IK  +  QT+N             +  A
Sbjct: 26  KNSLEYITRSG--LAGGISGSCAKTLIAPLDRIK--ILFQTSNPHYTKYAGSLVGLKEAA 81

Query: 166 KSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSD 225
           K I    GI                       T + + PY A+ F  YEQ+R   + S +
Sbjct: 82  KHIWLNDGIRGFFQGHSV--------------TLMRIFPYAAVKFVAYEQIRNTLIPSKE 127

Query: 226 AQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGG--NELGFRYTSVWDALV 283
            +  W+    +L  G+++G  +   TYP DL+R R   +      + LG   T   +   
Sbjct: 128 YESHWR----RLMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPAS 183

Query: 284 TIGRAEGV--------SGYYKGLAANLFKVVPSTAVSWLVYEVVCD 321
           T   A+G           +Y+G    +  ++P   VS+  ++++ D
Sbjct: 184 TTLEAKGYIPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHD 229

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/227 (21%), Positives = 90/227 (39%), Gaps = 45/227 (19%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNR-GIFSSIRQVYHEEGTKGL----- 79
            ++G +AG  S     P + +++ L   +  T + R  +   ++ +Y E  +  L     
Sbjct: 135 LMSGSLAGLCSVFTTYPLDLIRVRL---AYVTEHKRISLLGLVKTIYKEPASTTLEAKGY 191

Query: 80  -----------FRGNGLNCIRIFPYSAVQFVVYEACKKKLFH----------VNGNNGQE 118
                      +RG     + + PY+ V F  ++     L H          ++ +  +E
Sbjct: 192 IPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEE 251

Query: 119 QLTNTQRL--------FSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISK 170
           +    QRL         SG L G  S  A YP ++I+ RL + T ++S +   + +SIS+
Sbjct: 252 RHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISE 311

Query: 171 PPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLR 217
              I  +  E              +      V P VA +F VYE+++
Sbjct: 312 IAKI--IYKERGWRGFFVGLSIGYI-----KVTPMVACSFFVYERMK 351

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score =  143 bits (360), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 96/319 (30%), Positives = 161/319 (50%), Gaps = 35/319 (10%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNR------GIFSSIRQVYHEEGTKGLF 80
           LAGGV+G+ ++T+++P +R+KIL Q  +S   Y++      G++ + + ++  +G +G F
Sbjct: 23  LAGGVSGSCAKTLIAPLDRIKILFQ--TSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFF 80

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
           +G+ +  +RIFPY+AV+FV YE  +  L        +E  ++ +RL SG+L G CSV  T
Sbjct: 81  QGHSVTLLRIFPYAAVKFVAYEQIRSILI-----PSREYESHWRRLASGSLAGLCSVFIT 135

Query: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXX--XXXXXVWPT 198
           YPLDL + RL+  T +     R   K+I   P    L S                   PT
Sbjct: 136 YPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVPT 195

Query: 199 SLGVVPYVALNFAVYEQLREFGVNSSDA-----QPSWKSNLYK--------------LTI 239
            LG++PY  ++F  ++ + +   +S  A     Q S +  L +              L  
Sbjct: 196 VLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTWAELVA 255

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNEL-GFRYTSVWDALVTIGRAEGVSGYYKGL 298
           G +SG ++QT  YP +++RRR QV  +   ++   ++ S+      I + +G  G++ GL
Sbjct: 256 GGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGFFVGL 315

Query: 299 AANLFKVVPSTAVSWLVYE 317
           +    KV P  A S+ VYE
Sbjct: 316 SIGYIKVTPMVACSFFVYE 334

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 80/208 (38%), Gaps = 28/208 (13%)

Query: 127 FSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXX 186
            +G + G C+     PLD IK        + S    S          IW  +++      
Sbjct: 23  LAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIW--INDGIRGFF 80

Query: 187 XXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGV 246
                      T L + PY A+ F  YEQ+R   + S + +  W+    +L  G+++G  
Sbjct: 81  QGHSV------TLLRIFPYAAVKFVAYEQIRSILIPSREYESHWR----RLASGSLAGLC 130

Query: 247 AQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSG------------- 293
           +  ITYP DL R R   LA        +   +   +     +EG++              
Sbjct: 131 SVFITYPLDLTRVR---LAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKWFAHWCN 187

Query: 294 YYKGLAANLFKVVPSTAVSWLVYEVVCD 321
           +Y+G    +  ++P   VS+  ++++ D
Sbjct: 188 FYRGYVPTVLGMIPYAGVSFFAHDLIHD 215

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 5/88 (5%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQ--SSTTSYN---RGIFSSIRQVYHEEGTKGLF 80
            +AGG++G +S+T   P E ++  LQV   S    Y+   + I S  R +Y E+G +G F
Sbjct: 253 LVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGFF 312

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKL 108
            G  +  I++ P  A  F VYE  K  L
Sbjct: 313 VGLSIGYIKVTPMVACSFFVYERMKWHL 340

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 91/225 (40%), Gaps = 45/225 (20%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSI-RQVYHEEGTKGL------- 79
           +G +AG  S  +  P +  ++ L   +  T + R     I + +YHE  ++GL       
Sbjct: 123 SGSLAGLCSVFITYPLDLTRVRL---AYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVP 179

Query: 80  ---------FRGNGLNCIRIFPYSAVQF----VVYEACKKKL---FHVNGNNGQEQLTNT 123
                    +RG     + + PY+ V F    ++++  K  L   + V   + QE+L   
Sbjct: 180 KWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERK 239

Query: 124 Q-----------RLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPP 172
           +            L +G L G  S  A YPL++I+ RL + T +   +   K +SIS   
Sbjct: 240 KLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIA 299

Query: 173 GIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLR 217
            I  +  E              +      V P VA +F VYE+++
Sbjct: 300 RI--IYQEKGWRGFFVGLSIGYI-----KVTPMVACSFFVYERMK 337

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score =  139 bits (350), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 98/324 (30%), Positives = 159/324 (49%), Gaps = 41/324 (12%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNR------GIFSSIRQVYHEEGTKGLF 80
           LAGGVAG+ ++T+++P +R+KIL Q  +S   Y +      G+ ++   ++  +  +G+F
Sbjct: 58  LAGGVAGSCAKTLIAPLDRIKILFQ--TSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVF 115

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
           +G+    +RIFPY+AV+F+ YE  +  +        +E  T+ +RL SG+L G CSV  T
Sbjct: 116 QGHSATLLRIFPYAAVKFIAYEQIRNVII-----PSKEYETHFRRLCSGSLAGLCSVFCT 170

Query: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXX--XXXXXVWPT 198
           YPLDLI+ RL+  T +         K I   P    L S+                  PT
Sbjct: 171 YPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYIPT 230

Query: 199 SLGVVPYVALNF---------------AVYEQLREFGVNSSDAQPSWKS----------N 233
            +G++PY  ++F               A Y  LR   +++ D +   ++           
Sbjct: 231 VIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTRTGKRIPLNT 290

Query: 234 LYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSG 293
             +L  G ++G  +QT  YPF+++RRR QV A+  N L  ++TS+ +    I    G  G
Sbjct: 291 WAELLAGGLAGMASQTAAYPFEIIRRRLQVGAV-TNPLEHKFTSMSEMAKIIFHERGWRG 349

Query: 294 YYKGLAANLFKVVPSTAVSWLVYE 317
           ++ GL+    KV P  A S+ VYE
Sbjct: 350 FFVGLSIGYIKVTPMVACSFFVYE 373

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 45/84 (53%), Gaps = 5/84 (5%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQ----VYHEEGTKGLFR 81
            LAGG+AG  S+T   PFE ++  LQV + T       F+S+ +    ++HE G +G F 
Sbjct: 294 LLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHK-FTSMSEMAKIIFHERGWRGFFV 352

Query: 82  GNGLNCIRIFPYSAVQFVVYEACK 105
           G  +  I++ P  A  F VYE  K
Sbjct: 353 GLSIGYIKVTPMVACSFFVYERMK 376

 Score = 35.8 bits (81), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 88/232 (37%), Gaps = 51/232 (21%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGL-------- 79
           +G +AG  S     P + +++ L     T  +   ++  ++Q+Y E  ++ L        
Sbjct: 158 SGSLAGLCSVFCTYPLDLIRVRLAY--VTEHHKVRVWPLVKQIYSEPASEALSSKAYVPK 215

Query: 80  --------FRGNGLNCIRIFPYSAVQFVVYEACKKKLFH----------VNGNNGQE--- 118
                   +RG     I + PY+ V F  ++     L H          V+  +  +   
Sbjct: 216 WFAQWCNFYRGYIPTVIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKV 275

Query: 119 --QLTNTQR---------LFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKS 167
             Q T T +         L +G L G  S  A YP ++I+ RL  Q   +++    K  S
Sbjct: 276 DVQTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRL--QVGAVTNPLEHKFTS 333

Query: 168 ISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREF 219
           +S+   I  +  E              +      V P VA +F VYE+++ +
Sbjct: 334 MSEMAKI--IFHERGWRGFFVGLSIGYI-----KVTPMVACSFFVYERMKWY 378

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score =  138 bits (348), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 91/318 (28%), Positives = 150/318 (47%), Gaps = 38/318 (11%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTS--------------------YNRGIFS 65
           F+AGG++G +SRT  +PF+R+K+ L  ++  +S                        +  
Sbjct: 204 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVK 263

Query: 66  SIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQR 125
           +I  +Y + G K  + GNGLN +++FP S+++F  +E  KK +  V      + L+    
Sbjct: 264 AIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLST 323

Query: 126 LFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXX 185
             +G L G C+  + YP+D +K R+  Q A L++  + +   I     ++          
Sbjct: 324 FIAGGLAGVCAQFSVYPIDTLKFRM--QCAPLNAELKGRKLMIQTAKEMY--------TE 373

Query: 186 XXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWK------SNLYKLTI 239
                    V    LG+ PY AL+   +  L+++ ++S   + + K      SNL  L +
Sbjct: 374 GGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPM 433

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299
           GA SG    T+ YP +LLR R Q  A G     +RY    D L+   + EG  G +KGL 
Sbjct: 434 GAFSGTFGATVVYPINLLRTRLQ--AQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLV 491

Query: 300 ANLFKVVPSTAVSWLVYE 317
             L KV P+ ++S+L YE
Sbjct: 492 PTLAKVCPAVSISYLCYE 509

 Score = 35.0 bits (79), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 3/88 (3%)

Query: 22  SNIAFLA-GGVAGAVSRTVVSPFERVKILLQVQSSTTSYNR--GIFSSIRQVYHEEGTKG 78
           SN+  L  G  +G    TVV P   ++  LQ Q +     R  G    + +    EG  G
Sbjct: 426 SNLVVLPMGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPG 485

Query: 79  LFRGNGLNCIRIFPYSAVQFVVYEACKK 106
           LF+G      ++ P  ++ ++ YE  KK
Sbjct: 486 LFKGLVPTLAKVCPAVSISYLCYENLKK 513

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 43/96 (44%), Gaps = 16/96 (16%)

Query: 240 GAISGGVAQTITYPFD---------------LLRRRFQVLAMGGNELGFRYTS-VWDALV 283
           G ISG +++T T PFD               LL     VLA   +    +  S +  A++
Sbjct: 207 GGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVKAII 266

Query: 284 TIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVV 319
           ++ R  G+  +Y G   N  KV P +++ +  +E+ 
Sbjct: 267 SLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEIT 302

>Kwal_26.7972
          Length = 358

 Score =  134 bits (338), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 93/322 (28%), Positives = 154/322 (47%), Gaps = 49/322 (15%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSST-TSYNRGIFSSIRQVYH---EEGTKGLFRG 82
           LAGG+AG+ ++T+++P +R+KIL Q  +     Y+      IR   H    +G +G ++G
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQG 91

Query: 83  NGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYP 142
           +    IRIFPY+A++F+ YE  +  +        +E  T+ +RL SG++ G CSV  TYP
Sbjct: 92  HSATLIRIFPYAAIKFIAYEQIRHFMI-----PSKEYETHARRLASGSMAGLCSVFMTYP 146

Query: 143 LDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXX---XXVW--- 196
           LDLI+ RL+  T      +RS+ K +   P I Q+ +E                  W   
Sbjct: 147 LDLIRVRLAYVT------DRSRIKML---PVIKQIYTERASESLTSKSYVPRWFAHWCNF 197

Query: 197 -----PTSLGVVPYVALNFAVYEQ----LREFGVNSSDAQPSWKSNLY------------ 235
                PT LG++PY  ++F  ++     LR   ++     P     L             
Sbjct: 198 YRGFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLK 257

Query: 236 ---KLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVS 292
              +L  G ++G  +QT +YPF+++RRR QV  +    +   + ++ D +  I +  G  
Sbjct: 258 TWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSI-HNFQTIPDMIRIIYKERGWR 316

Query: 293 GYYKGLAANLFKVVPSTAVSWL 314
           G++ GL+    KV P  A S+ 
Sbjct: 317 GFFVGLSIGYIKVTPMVACSFF 338

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 90/219 (41%), Gaps = 50/219 (22%)

Query: 127 FSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKA--------KSISKPPGI---W 175
            +G + G C+     PLD IK  +  QT+N   L  S +          I+   GI   +
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIK--ILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFY 89

Query: 176 QLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLY 235
           Q  S T                  + + PY A+ F  YEQ+R F + S +    ++++  
Sbjct: 90  QGHSATL-----------------IRIFPYAAIKFIAYEQIRHFMIPSKE----YETHAR 128

Query: 236 KLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSG-- 293
           +L  G+++G  +  +TYP DL+R R   LA   +    +   V   + T   +E ++   
Sbjct: 129 RLASGSMAGLCSVFMTYPLDLIRVR---LAYVTDRSRIKMLPVIKQIYTERASESLTSKS 185

Query: 294 -----------YYKGLAANLFKVVPSTAVSWLVYEVVCD 321
                      +Y+G    +  ++P   VS+  +++  D
Sbjct: 186 YVPRWFAHWCNFYRGFTPTVLGMIPYAGVSFFAHDLCGD 224

>Scas_578.3*
          Length = 524

 Score =  134 bits (338), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/334 (29%), Positives = 157/334 (47%), Gaps = 50/334 (14%)

Query: 14  IKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTS--------------- 58
           I DF+K      F+AGG++G +SRT  +P +R+K+ L  ++  +S               
Sbjct: 202 INDFIKGFG--YFIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLN 259

Query: 59  ---YNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNN 115
                  I  +IR +Y + G +  + GNGL+  +I P S+++F  +E  K+ + +++G+ 
Sbjct: 260 LAKIRSPIIKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDK 319

Query: 116 GQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANL------SSLNRSKAKSIS 169
               L+  Q   +G + G  + ++ YP+D +K R  IQ A L      ++L  S AK + 
Sbjct: 320 LVNDLSKLQTYVAGGIAGVMAQISIYPIDTLKFR--IQCAPLEGNLKGNALLISTAKEMY 377

Query: 170 KPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQ-- 227
           K  GI                    V   +LG+ PY AL+   +  L+++ +     +  
Sbjct: 378 KEGGI--------------RVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLN 423

Query: 228 -PSWK---SNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALV 283
            P      S L  L +GA SG V  T  YP +LLR R Q  A G     + YT   D  +
Sbjct: 424 IPEKDVMLSYLLVLPMGAFSGTVGATAVYPINLLRTRLQ--AQGTYAHPYTYTGFRDVFM 481

Query: 284 TIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
              + EGV G+YKGL   L KV P+ ++ +L YE
Sbjct: 482 QTLKREGVPGFYKGLVPTLVKVCPAVSIGYLCYE 515

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 36/82 (43%), Gaps = 8/82 (9%)

Query: 29  GGVAGAVSRTVVSPFERVKILLQVQSS-----TTSYNRGIFSSIRQVYHEEGTKGLFRGN 83
           G  +G V  T V P   ++  LQ Q +     T +  R +F    Q    EG  G ++G 
Sbjct: 440 GAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVF---MQTLKREGVPGFYKGL 496

Query: 84  GLNCIRIFPYSAVQFVVYEACK 105
               +++ P  ++ ++ YE  K
Sbjct: 497 VPTLVKVCPAVSIGYLCYEKFK 518

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 43/94 (45%), Gaps = 16/94 (17%)

Query: 240 GAISGGVAQTITYPFD---------------LLRRRFQVLAMGGNELGFRYTSVWDALVT 284
           G +SG +++T T P D               LL  +  +   G N    R + +  A+ +
Sbjct: 215 GGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIR-SPIIKAIRS 273

Query: 285 IGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318
           + R  G+  +Y G   ++FK+ P +++ +  +E+
Sbjct: 274 LYRQGGLRAFYVGNGLSVFKICPESSIKFGTFEL 307

>Kwal_23.3042
          Length = 542

 Score =  133 bits (334), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 96/322 (29%), Positives = 148/322 (45%), Gaps = 46/322 (14%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQ---SSTTSYNRGI---------FSSIRQ---- 69
           F+AGGV+G VSRT  +PF+R+K+ L  +   SST   ++ I          S I+     
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVK 287

Query: 70  ----VYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQR 125
               +Y + G +  + GNGLN +++FP SA++F  +E  K+ +  + G      L+    
Sbjct: 288 AATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFST 347

Query: 126 LFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNR----SKAKSISKPPGIWQLLSET 181
             +G L G  + ++ YP+D +K R+     N  S  R    S AK + K  G+       
Sbjct: 348 YLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGL------- 400

Query: 182 XXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQL------REFGVNSSDAQPSWKSNLY 235
                        +    +G+ PY A++   +  L      R+  +          SN++
Sbjct: 401 -------RIFYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMF 453

Query: 236 KLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYY 295
            L +GA SG V  T  YP +LLR R Q  A G      RY    D L+   + EG  G +
Sbjct: 454 VLLMGAFSGTVGATAVYPVNLLRTRLQ--AQGTFAHPHRYNGFRDVLLKTVQREGYQGLF 511

Query: 296 KGLAANLFKVVPSTAVSWLVYE 317
           KGL  NL KV P+ ++S+L YE
Sbjct: 512 KGLVPNLAKVCPAVSISYLCYE 533

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 2/85 (2%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNR--GIFSSIRQVYHEEGTKGLFRGN 83
            L G  +G V  T V P   ++  LQ Q +    +R  G    + +    EG +GLF+G 
Sbjct: 455 LLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGL 514

Query: 84  GLNCIRIFPYSAVQFVVYEACKKKL 108
             N  ++ P  ++ ++ YE  K+ +
Sbjct: 515 VPNLAKVCPAVSISYLCYENLKRGM 539

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score =  128 bits (321), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 88/318 (27%), Positives = 144/318 (45%), Gaps = 38/318 (11%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTS--------------------YNRGIFS 65
           F+AGG +G +SRT  +PF+R+K+ L  ++  +S                        +  
Sbjct: 199 FIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIK 258

Query: 66  SIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQR 125
           +   +Y + G +  + GNGLN I++FP SA++F  +E  K+ + H+ G +   +L+    
Sbjct: 259 AATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFST 318

Query: 126 LFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXX 185
             +G + G  +  + YP+D +K R  +Q A L +  +     IS    +++         
Sbjct: 319 YIAGGMGGVVAQFSVYPIDTLKYR--VQCAPLDTALKGNELLISTARQMYR--------D 368

Query: 186 XXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWK------SNLYKLTI 239
                    V    +G+ PY AL+   +  L+++ +                SN   L +
Sbjct: 369 GGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPM 428

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299
           GA SG V  T+ YP +LLR R Q  A G       YT   D L    + EG  G +KGL 
Sbjct: 429 GAFSGTVGATVVYPINLLRTRLQ--AQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLV 486

Query: 300 ANLFKVVPSTAVSWLVYE 317
            NL KV P+ ++S+L YE
Sbjct: 487 PNLAKVCPAVSISYLCYE 504

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 6/87 (6%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVY----HEEGTKGL 79
           I    G  +G V  TVV P   ++  LQ Q   T  +   ++  R V       EG +GL
Sbjct: 424 IVLPMGAFSGTVGATVVYPINLLRTRLQAQG--TYAHPHTYTGFRDVLWKTVQREGYQGL 481

Query: 80  FRGNGLNCIRIFPYSAVQFVVYEACKK 106
           F+G   N  ++ P  ++ ++ YE  K+
Sbjct: 482 FKGLVPNLAKVCPAVSISYLCYENFKR 508

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score =  127 bits (319), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 93/334 (27%), Positives = 147/334 (44%), Gaps = 48/334 (14%)

Query: 14  IKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTS--------------- 58
           I DF+K      F+AGG +G VSRT  +PF+R+K+ L  ++  +S               
Sbjct: 193 INDFIKGFG--FFIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPN 250

Query: 59  -----YNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNG 113
                    +  +   +Y + G +  + GNGLN +++FP SA++F  +E  K+ +  +  
Sbjct: 251 ADLSKIKSPLIKAATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLEN 310

Query: 114 NNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANL----SSLNRSKAKSIS 169
                +L+      +G L G  +  + YP+D +K R+     N     SS+    AK + 
Sbjct: 311 VKDTSELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMY 370

Query: 170 KPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPS 229
           +  GI                    V    +G+ PY AL+   +  L+++ +     +  
Sbjct: 371 QQGGIRLFYR--------------GVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTG 416

Query: 230 WK------SNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALV 283
                   SNL  L +GA SG V  T+ YP +LLR R Q  A G       Y    D L 
Sbjct: 417 LPEDEVIISNLIVLPMGAFSGTVGATLVYPINLLRTRLQ--AQGTYAHPHTYNGFSDVLK 474

Query: 284 TIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
              + EG  G +KGL  NL KV P+ ++S+L YE
Sbjct: 475 KTIQREGYQGLFKGLVPNLAKVCPAVSISYLCYE 508

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 74/156 (47%), Gaps = 11/156 (7%)

Query: 7   VLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRG--IF 64
           ++ +  ++KD  +      ++AGG+ G  ++  V P + +K  +Q     T+  +   + 
Sbjct: 304 IMARLENVKDTSELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILL 363

Query: 65  SSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQ 124
            + +++Y + G +  +RG  +  + IFPY+A+    + A KK  +++     +  L   +
Sbjct: 364 QTAKEMYQQGGIRLFYRGVHIGVMGIFPYAALDLGTFSALKK--WYIKKEAKKTGLPEDE 421

Query: 125 RLFS-------GALCGGCSVVATYPLDLIKTRLSIQ 153
            + S       GA  G       YP++L++TRL  Q
Sbjct: 422 VIISNLIVLPMGAFSGTVGATLVYPINLLRTRLQAQ 457

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 4/86 (4%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQ---SSTTSYNRGIFSSIRQVYHEEGTKGLF 80
           I    G  +G V  T+V P   ++  LQ Q   +   +YN G    +++    EG +GLF
Sbjct: 428 IVLPMGAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYN-GFSDVLKKTIQREGYQGLF 486

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKK 106
           +G   N  ++ P  ++ ++ YE  K+
Sbjct: 487 KGLVPNLAKVCPAVSISYLCYENLKR 512

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score =  127 bits (319), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 90/322 (27%), Positives = 149/322 (46%), Gaps = 46/322 (14%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSY--------------------NRGIFS 65
           F+AGG++G +SRT  +PF+R+K+ L  ++  +S                     +  +  
Sbjct: 231 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAK 290

Query: 66  SIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQR 125
           +++ +Y + G K  + GNGLN I++FP S+++F  +E  KK +  + G    + L+    
Sbjct: 291 AVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFST 350

Query: 126 LFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXX 185
             +G L G  +  + YP+D +K R  +Q A L +  +              LL +T    
Sbjct: 351 YIAGGLAGMAAQFSVYPIDTLKFR--VQCAPLDTKLKGN-----------NLLFQTAKDM 397

Query: 186 XXXXXXXXXVWPTSLGVV---PYVALNFAVYEQLREFGV-------NSSDAQPSWKSNLY 235
                        ++G+V   PY AL+   +  L+++ +       N    Q +  SNL 
Sbjct: 398 FREGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTL-SNLV 456

Query: 236 KLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYY 295
            L +GA SG V  ++ YP +LLR R Q  A G     + Y    D L+     EG  G +
Sbjct: 457 VLPMGAFSGTVGASVVYPINLLRTRLQ--AQGTYAHPYVYNGFKDVLLKTLEREGYQGLF 514

Query: 296 KGLAANLFKVVPSTAVSWLVYE 317
           KGL   L KV P+ ++S+L YE
Sbjct: 515 KGLVPTLAKVCPAVSISYLCYE 536

 Score = 36.2 bits (82), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 22  SNIAFL-AGGVAGAVSRTVVSPFERVKILLQVQSSTTS---YNRGIFSSIRQVYHEEGTK 77
           SN+  L  G  +G V  +VV P   ++  LQ Q +      YN G    + +    EG +
Sbjct: 453 SNLVVLPMGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYN-GFKDVLLKTLEREGYQ 511

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYEACKK 106
           GLF+G      ++ P  ++ ++ YE  KK
Sbjct: 512 GLFKGLVPTLAKVCPAVSISYLCYENLKK 540

 Score = 35.4 bits (80), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 16/95 (16%)

Query: 240 GAISGGVAQTITYPFD---------------LLRRRFQVLAMGGN-ELGFRYTSVWDALV 283
           G ISG +++T T PFD               LL  +  +LA   N ++    + +  A+ 
Sbjct: 234 GGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAKAVK 293

Query: 284 TIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318
           ++ R  G+  +Y G   N+ KV P +++ +  +EV
Sbjct: 294 SLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEV 328

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score =  124 bits (310), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 86/316 (27%), Positives = 151/316 (47%), Gaps = 37/316 (11%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNR------GIFSSIRQVYHEEGTKGLF 80
           LAGG+AG+ ++T+V+P +R+KIL Q  +S   + +      G+  + + +   +G +G F
Sbjct: 24  LAGGIAGSCAKTLVAPLDRIKILFQ--TSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFF 81

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
           +G+    +RIFPY+A++F+ YE  +  +     +      ++ +RL SG+L G CSV  T
Sbjct: 82  QGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHE-----SHWRRLLSGSLAGLCSVFVT 136

Query: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSI-----SKPPGIWQLLSETXXXXXXXXXXXXXV 195
           YPLDL++ RL+  T    +  R     I     S+    W +                  
Sbjct: 137 YPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHWSNFYRGYT--- 193

Query: 196 WPTSLGVVPYVALNFAVYE---------QLREFGVNSSDAQPSWKSNL-----YKLTIGA 241
            PT +G++PY  ++F  ++          L  + V S     ++   +      +L  G 
Sbjct: 194 -PTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLVAGG 252

Query: 242 ISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAAN 301
           ++G  +QT  YPF+++RRR QV A+  +     +  + +    I    G  G++ GL+  
Sbjct: 253 LAGMASQTAAYPFEIIRRRLQVSAI-TDPTRRHFVGINEIAKIIYTEGGWRGFFVGLSIG 311

Query: 302 LFKVVPSTAVSWLVYE 317
             KV P  A S+ +YE
Sbjct: 312 YIKVTPMVACSFFIYE 327

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 43/83 (51%), Gaps = 3/83 (3%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNR---GIFSSIRQVYHEEGTKGLFRG 82
            +AGG+AG  S+T   PFE ++  LQV + T    R   GI    + +Y E G +G F G
Sbjct: 248 LVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWRGFFVG 307

Query: 83  NGLNCIRIFPYSAVQFVVYEACK 105
             +  I++ P  A  F +YE  K
Sbjct: 308 LSIGYIKVTPMVACSFFIYERTK 330

 Score = 36.2 bits (82), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 18/89 (20%)

Query: 240 GAISGGVAQTITYPFDLLRRRFQVL---------AMGGNELGFRYTSVWDALVTIGRAEG 290
           G I+G  A+T+  P D ++  FQ           +MGG     +Y    D         G
Sbjct: 26  GGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHD---------G 76

Query: 291 VSGYYKGLAANLFKVVPSTAVSWLVYEVV 319
             G+++G +A L ++ P  A+ ++ YE +
Sbjct: 77  PRGFFQGHSATLLRIFPYAAIKFIAYEQI 105

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score =  117 bits (294), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 95/318 (29%), Positives = 141/318 (44%), Gaps = 56/318 (17%)

Query: 35  VSRTVVSPFERVKILLQVQSSTTS-----------YN-RGIFSSIRQ--------VYHEE 74
           VSRT  +PF+R+K+ L  ++  +S           +N R   + IR         +Y + 
Sbjct: 188 VSRTCTAPFDRIKVFLIARTDLSSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSLYRQG 247

Query: 75  GTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGG 134
           G +  + GNGLN I++FP SA++F  +E  K+ L  + G     +L+      +G L G 
Sbjct: 248 GLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSRLSTYVAGGLGGI 307

Query: 135 CSVVATYPLDLIKTRLSIQTANLSSLNR------SKAKSISKPPGIWQLLSETXXXXXXX 188
            +  + YP+D +K R  IQ A L +  R        AK + +  G+              
Sbjct: 308 MAQFSVYPIDTLKFR--IQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLGVGI--- 362

Query: 189 XXXXXXVWPTSLGVVPYVALNFAVYEQLRE---------FGVNSSDAQPSWKSNLYKLTI 239
                      LGV PY AL+   +  L+           G++ ++      SNL  L +
Sbjct: 363 -----------LGVFPYAALDLGTFSALKRWYITRRANALGISENEV---VMSNLVVLPM 408

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299
           GA SG V  T+ YP +LLR R Q  A G      RY    D      + EG+ G YKGL 
Sbjct: 409 GAFSGTVGATVVYPINLLRTRLQ--AQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLV 466

Query: 300 ANLFKVVPSTAVSWLVYE 317
             L KV P+ A+S+L YE
Sbjct: 467 PTLAKVCPAVAISYLCYE 484

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 3/90 (3%)

Query: 22  SNIAFLA-GGVAGAVSRTVVSPFERVKILLQVQSSTTSYNR--GIFSSIRQVYHEEGTKG 78
           SN+  L  G  +G V  TVV P   ++  LQ Q +    +R  G     R+    EG  G
Sbjct: 401 SNLVVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPG 460

Query: 79  LFRGNGLNCIRIFPYSAVQFVVYEACKKKL 108
           L++G      ++ P  A+ ++ YE  K+ +
Sbjct: 461 LYKGLVPTLAKVCPAVAISYLCYENLKRAM 490

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score =  114 bits (286), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 97/326 (29%), Positives = 139/326 (42%), Gaps = 46/326 (14%)

Query: 15  KDFLKQDSNIAF----LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQV 70
           KD L++   +++    +AG V+G  +R   +P + VKI  Q+Q       +GI S++R +
Sbjct: 7   KDHLRKGETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQEDKYKGIASTVRTI 66

Query: 71  YHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYE------ACKKKLFHVNGNNGQEQLTNTQ 124
             EEG + L++GN         Y AVQF  Y       + K   F   G          Q
Sbjct: 67  MKEEGLRALWKGNIPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQG----------Q 116

Query: 125 RLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXX 184
            L  GAL G  S V +YPLDL++TRL    AN +S   S A+   +   +W         
Sbjct: 117 TLTVGALAGMTSSVVSYPLDLLRTRL---IANRTSHRTSVAEECRQ---MWLNEGVRGFF 170

Query: 185 XXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISG 244
                        T++  + Y  +N       +EF      A             G I+G
Sbjct: 171 TGISTAMTTVTLSTAIMFLTYETVNIVCENHEKEFWSRPVSASS-----------GIIAG 219

Query: 245 GVAQTITYPFDLLRRRFQVL---------AMGGNELGFRYTSVWDALVTIGRAEGVSGYY 295
            V++T+ +P D LRRR QV+                 +RY S    +  I R EGVS  Y
Sbjct: 220 FVSKTMVFPIDTLRRRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALY 279

Query: 296 KGLAANLFKVVPSTAVSWLVYEVVCD 321
           +GL   L K VP+TA+S  VYE   D
Sbjct: 280 RGLTMGLCKSVPTTAISLFVYERTMD 305

>Scas_667.4
          Length = 308

 Score =  110 bits (275), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 94/309 (30%), Positives = 143/309 (46%), Gaps = 29/309 (9%)

Query: 13  SIKDFLKQDSNIA--FLAGGVAGAVSRTVVSPFERVKILLQ------VQSSTTSYNRGIF 64
           S K+ +K++SN A  FL GGV+ AV++T  SP ERVK+L+Q       Q S  S  +GI 
Sbjct: 2   SSKEEVKKESNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGII 61

Query: 65  SSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTN-- 122
              ++    EG    +RGN  N IR FP  A+ F    A K K+  + G   +E      
Sbjct: 62  ECFQRTAKTEGIIAFWRGNTANVIRYFPTQALNF----AFKDKIKAMFGFKKEEGYGKWF 117

Query: 123 TQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETX 182
              L SG   GG S++  Y LD  +TRL+      +    SK     +  G+  +  +T 
Sbjct: 118 AGNLASGGAAGGLSLLFVYSLDYARTRLA------ADAKSSKKGGSRQYKGLIDVYKQTL 171

Query: 183 XXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAI 242
                       + P+ +G++ Y  L F +Y+ L+   V +   + S+   L    +G I
Sbjct: 172 ATDGMAGLYRGFL-PSVVGIIVYRGLYFGLYDSLKP-AVLTGSLEGSF---LASFLLGWI 226

Query: 243 SGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANL 302
               A T +YP D +RRR  + +  G  +  +Y   +D    +  AEGVS  +KG  AN+
Sbjct: 227 VTTGASTASYPLDTVRRRMMMTS--GQAV--KYDGAFDCFRKVVAAEGVSSLFKGCGANI 282

Query: 303 FKVVPSTAV 311
            + V    V
Sbjct: 283 LRGVAGAGV 291

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 239 IGAISGGVAQTITYPFD----LLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGY 294
           +G +S  VA+T   P +    L++ + +++  G   L  +Y  + +      + EG+  +
Sbjct: 19  MGGVSAAVAKTAASPIERVKLLIQNQDEMIKQG--SLDSKYKGIIECFQRTAKTEGIIAF 76

Query: 295 YKGLAANLFKVVPSTAVSW 313
           ++G  AN+ +  P+ A+++
Sbjct: 77  WRGNTANVIRYFPTQALNF 95

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score =  113 bits (282), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 83/303 (27%), Positives = 140/303 (46%), Gaps = 28/303 (9%)

Query: 21  DSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLF 80
           DS   F  G VAG +   VV P + VK  +Q Q   + Y   I   + ++  +EG +GL+
Sbjct: 523 DSIYNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSI-DCLLKILSKEGVRGLY 581

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
            G G   I + P  A++  V +  +  L    G +G+  L+    + SGA  G C VV T
Sbjct: 582 SGLGPQLIGVAPEKAIKLTVNDHMRATL---AGRDGK--LSLPCEIISGATAGACQVVFT 636

Query: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSIS--KPPGIWQLLSETXXXXXXXXXXXXXVWPT 198
            PL+++K RL +++  ++   R+   +IS  K  G+  L                     
Sbjct: 637 NPLEIVKIRLQVKSDYVADAARNSVNAISVIKNLGLIGLYRGAGACL------------- 683

Query: 199 SLGVVPYVALNFAVYEQLRE--FGVNSSDAQPSWKSNLYKLTI-GAISGGVAQTITYPFD 255
            L  +P+ A+ F  Y  ++   F  +  D+    K N ++L + G ++G  A  +T PFD
Sbjct: 684 -LRDIPFSAIYFPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFD 742

Query: 256 LLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLV 315
           +++ R Q+    G  +   Y  +WDA  TI + EG+  ++KG  A + +  P    +   
Sbjct: 743 VIKTRLQIDPKKGESV---YNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAA 799

Query: 316 YEV 318
           YE+
Sbjct: 800 YEI 802

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score =  111 bits (277), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 87/306 (28%), Positives = 138/306 (45%), Gaps = 33/306 (10%)

Query: 21  DSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLF 80
           DS   F  G +AG +  TVV P + +K  +Q Q S   Y   I   + ++   EG KGL+
Sbjct: 529 DSLYNFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSI-DCLLKIISREGIKGLY 587

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
            G G   I + P  A++  V +  + +L   NG     +L+    + SGA  G C V+ T
Sbjct: 588 SGLGPQLIGVAPEKAIKLTVNDFMRNRLTDKNG-----KLSLFPEIISGASAGACQVIFT 642

Query: 141 YPLDLIKTRLSIQT----ANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVW 196
            PL+++K RL +Q+     N+   N + A  I K  G+  L +               V 
Sbjct: 643 NPLEIVKIRLQVQSDYVGENIQQANET-ATQIVKKLGLRGLYN--------------GVA 687

Query: 197 PTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYK----LTIGAISGGVAQTITY 252
              +  VP+ A+ F  Y  L++  +   D     K N  K    LT GAI+G  A  +T 
Sbjct: 688 ACLMRDVPFSAIYFPTYAHLKK-DLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTT 746

Query: 253 PFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVS 312
           PFD+++ R Q+    G     +Y  ++ A+ TI + E    ++KG  A + +  P    +
Sbjct: 747 PFDVIKTRLQIDPRKGET---KYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFT 803

Query: 313 WLVYEV 318
              YE+
Sbjct: 804 LAAYEL 809

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 3/80 (3%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQV--QSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85
           AG +AG  +  + +PF+ +K  LQ+  +   T YN GIF +IR +  EE  +  F+G G 
Sbjct: 733 AGAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKYN-GIFHAIRTILKEESFRSFFKGGGA 791

Query: 86  NCIRIFPYSAVQFVVYEACK 105
             +R  P        YE  K
Sbjct: 792 RVLRSSPQFGFTLAAYELFK 811

>Scas_718.24
          Length = 337

 Score =  107 bits (267), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 91/311 (29%), Positives = 141/311 (45%), Gaps = 27/311 (8%)

Query: 10  QPNSIKDFLKQDSNIA--FLAGGVAGAVSRTVVSPFERVKILLQVQSS-------TTSYN 60
           Q N+I    K  SN A  FL GGV+ AV++T  SP ERVK+L+Q Q+         T Y 
Sbjct: 28  QSNTIMSTEKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKY- 86

Query: 61  RGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQL 120
           +GI    R+   +EG    +RGN  N IR FP  A+ F   +   K +F     +G  + 
Sbjct: 87  KGIVDCFRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKI-KLMFGFKKEDGYGKW 145

Query: 121 TNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSE 180
                L SG   GG S++  Y LD  +TRL+  + +      SK     +  G+  +  +
Sbjct: 146 F-AGNLASGGAAGGLSLLFVYSLDFARTRLAADSKS------SKKGGSRQFNGLIDVYKK 198

Query: 181 TXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIG 240
           T             + P+ +G++ Y  L F +Y+ ++   +  S       S L    +G
Sbjct: 199 TLKSDGVAGLYRGFL-PSVVGIIVYRGLYFGLYDSIKPVLLTGSLE----GSFLASFLLG 253

Query: 241 AISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAA 300
            +    A T +YP D +RR+  ++   G  +  +Y   +D    I  AEGV+  +KG  A
Sbjct: 254 WVVTTGASTCSYPLDTVRRK--MMMTSGQAV--KYKGAFDCFKKIVAAEGVASLFKGCGA 309

Query: 301 NLFKVVPSTAV 311
           N+ + V    V
Sbjct: 310 NILRGVAGAGV 320

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 53/118 (44%), Gaps = 4/118 (3%)

Query: 204 PYVALNFAVYEQLR-EFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQ 262
           P  ALNFA  ++++  FG    D    W +    L  G  +GG++    Y  D  R R  
Sbjct: 118 PTQALNFAFKDKIKLMFGFKKEDGYGKWFAG--NLASGGAAGGLSLLFVYSLDFARTRLA 175

Query: 263 VLAMGGNELGFR-YTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVV 319
             +    + G R +  + D      +++GV+G Y+G   ++  ++    + + +Y+ +
Sbjct: 176 ADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIIVYRGLYFGLYDSI 233

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 239 IGAISGGVAQTITYPFD----LLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGY 294
           +G +S  VA+T   P +    L++ + ++L  G   L  +Y  + D      + EG+  +
Sbjct: 48  MGGVSAAVAKTAASPIERVKLLIQNQNEMLKQG--TLDTKYKGIVDCFRRTAQQEGIISF 105

Query: 295 YKGLAANLFKVVPSTAVSW 313
           ++G  AN+ +  P+ A+++
Sbjct: 106 WRGNTANVIRYFPTQALNF 124

>Scas_602.8
          Length = 885

 Score =  110 bits (274), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 88/302 (29%), Positives = 138/302 (45%), Gaps = 25/302 (8%)

Query: 21  DSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLF 80
           DS   F  G VAG +  T+V P + +K  +Q Q S T Y   I   + +++ +EG +GL+
Sbjct: 497 DSIFNFSLGSVAGCIGATLVYPIDFIKTRMQAQRSLTKYKNSI-DCLVKIFGKEGIRGLY 555

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
            G G   I + P  A++  V +  +K L    GN     L     + SGA  G C VV T
Sbjct: 556 SGLGPQLIGVAPEKAIKLTVNDFMRKSLVDKKGN-----LQLGAEVLSGATAGACQVVFT 610

Query: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSL 200
            PL+++K RL +++   +++       I K     QL +               V    L
Sbjct: 611 NPLEIVKIRLQVKSEYTNAM-------IPKS----QLTAFQIIKELKLIGLYKGVGACLL 659

Query: 201 GVVPYVALNFAVYEQLR----EFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDL 256
             VP+ A+ F  Y  L+    +F  N  D +   K+    LT GA++G  A  +T PFD+
Sbjct: 660 RDVPFSAIYFPTYAHLKKNVFQFDPNDKDKRDRLKT-WELLTAGALAGVPAAFLTTPFDV 718

Query: 257 LRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVY 316
           ++ R Q+    G     RYT +  A+ TI + E    ++KG AA + +  P    +   Y
Sbjct: 719 IKTRLQIEPGVGET---RYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAY 775

Query: 317 EV 318
           E+
Sbjct: 776 EL 777

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 4/89 (4%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQVQSST--TSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85
           AG +AG  +  + +PF+ +K  LQ++     T Y  GI  ++R +  EE  +  F+G   
Sbjct: 701 AGALAGVPAAFLTTPFDVIKTRLQIEPGVGETRYT-GILHAVRTILKEESFRSFFKGGAA 759

Query: 86  NCIRIFPYSAVQFVVYEACKKKLFHVNGN 114
             +R  P        YE   K +F+++ +
Sbjct: 760 RVMRSSPQFGFTLAAYELF-KNMFNISDD 787

>Kwal_47.17321
          Length = 881

 Score =  108 bits (271), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 82/303 (27%), Positives = 137/303 (45%), Gaps = 28/303 (9%)

Query: 21  DSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLF 80
           DS   FL G VAG +  T V P + VK  +Q Q + + Y   I   ++ ++  EG +G++
Sbjct: 499 DSIYNFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFVK-IFSREGIRGIY 557

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
            G G   + + P  A++  V +  +K L   N      +LT    + SGA  G C V+ T
Sbjct: 558 SGLGPQLVGVAPEKAIKLTVNDYVRKLLMDENN-----RLTLPLEIISGAAAGACQVIFT 612

Query: 141 YPLDLIKTRLSIQTANLSSLNRSK--AKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPT 198
            PL+++K RL +++    SL +S+  A  + K  G+  L                 +   
Sbjct: 613 NPLEIVKIRLQVRSEYADSLPKSQLTALGVVKSLGLRGLYK--------------GLVAC 658

Query: 199 SLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYK---LTIGAISGGVAQTITYPFD 255
            +  VP+ A+ F  Y  L+    N      + ++ L+    LT G ++G  A  +T PFD
Sbjct: 659 LMRDVPFSAIYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFD 718

Query: 256 LLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLV 315
           +++ R Q+    G     RYT +  A  TI + E    ++KG  A + +  P    +   
Sbjct: 719 VIKTRLQIDPRKGET---RYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAA 775

Query: 316 YEV 318
           YE+
Sbjct: 776 YEI 778

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query: 234 LYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGF-RYTSVWDALVTIGRAEGVS 292
           +Y   +G+++G +  T  YP DL++ R Q       +  F +Y +  D  V I   EG+ 
Sbjct: 501 IYNFLLGSVAGCIGATAVYPIDLVKTRMQA------QRNFSQYKNSIDCFVKIFSREGIR 554

Query: 293 GYYKGLAANLFKVVPSTAVSWLVYEVV 319
           G Y GL   L  V P  A+   V + V
Sbjct: 555 GIYSGLGPQLVGVAPEKAIKLTVNDYV 581

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 47/108 (43%), Gaps = 3/108 (2%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQV--QSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85
           AGG+AG  +  + +PF+ +K  LQ+  +   T Y  GI  + R +  EE  K  F+G G 
Sbjct: 702 AGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYT-GILHAARTILKEERFKSFFKGGGA 760

Query: 86  NCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCG 133
             +R  P        YE  +      +  N + + TN   + +G    
Sbjct: 761 RVLRSSPQFGFTLAAYEIFQNMFPLQHSENNESRETNDTPIVTGMFSN 808

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score =  105 bits (262), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 134/297 (45%), Gaps = 26/297 (8%)

Query: 23  NIAFLAGGVAGAVSRTVVSPFERVKILLQ------VQSSTTSYNRGIFSSIRQVYHEEGT 76
            + FL GGV+ A+++T  +P ERVK+L+Q       Q S  +  +GI    ++    EG 
Sbjct: 14  GVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGI 73

Query: 77  KGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCS 136
              +RGN  N +R FP  A+ F   +  K  L +    +G  +      LFSG   GG S
Sbjct: 74  VSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWF-AGNLFSGGAAGGLS 132

Query: 137 VVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVW 196
           ++  Y LD  +TRL+           SK+ S  +  G+  +  +T             V 
Sbjct: 133 LLFVYSLDYARTRLAADARG------SKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFV- 185

Query: 197 PTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNL--YKLTIGAISGGVAQTITYPF 254
           P+ LG++ Y  L F +Y+  +   +  +       S L  + +T+G      A T +YP 
Sbjct: 186 PSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVITMG------ASTASYPL 239

Query: 255 DLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAV 311
           D +RRR  ++   G  +  +Y    D L  I + EG    +KG  AN+F+ V +  V
Sbjct: 240 DTVRRR--MMMTSGQTI--KYDGALDCLRKIVQKEGAYSLFKGCGANIFRGVAAAGV 292

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 239 IGAISGGVAQTITYPFD----LLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGY 294
           +G +S  +A+T   P +    L++ + ++L  G   L  RY  + D        EG+  +
Sbjct: 19  MGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQG--SLDTRYKGILDCFKRTATHEGIVSF 76

Query: 295 YKGLAANLFKVVPSTAVSW 313
           ++G  AN+ +  P+ A+++
Sbjct: 77  WRGNTANVLRYFPTQALNF 95

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score =  105 bits (262), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 92/321 (28%), Positives = 154/321 (47%), Gaps = 37/321 (11%)

Query: 12  NSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQ---VQSSTTS--YNRGIFSS 66
           N++  F   D+ I  ++G +AG +S  VV P +  K  LQ   +Q+ TT   Y RG   +
Sbjct: 58  NTLFGFTLNDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGT 117

Query: 67  IRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRL 126
           +  +  +EG +GL++G     +  FP   + F VYE CK  L   N +N     +     
Sbjct: 118 MTTIVRDEGVRGLYKGLVPIIMGYFPTWMIYFSVYEFCKDNL-RTNSSN----WSFVSHS 172

Query: 127 FSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKA-----KSISKPPGIWQLLSET 181
           FS    G  S V T P+ ++KTRL +QT   S+    +      K I    G+  L +  
Sbjct: 173 FSAITAGAVSTVVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYA-- 230

Query: 182 XXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLR-EFGVNSSDAQPSW-KSNLYKLTI 239
                        + P+ LG++ +VA++F VYE+L+  F     D   +  K NL +L +
Sbjct: 231 ------------GLVPSLLGLL-HVAIHFPVYERLKVSFKCYQRDESSNESKINLKRLIL 277

Query: 240 G-AISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGL 298
             ++S  VA  ++YP ++LR R Q+     ++L      +   +      EG+ G+Y G 
Sbjct: 278 ASSVSKMVASVLSYPHEILRTRLQL----KSDLPSHQRRLIPLIKITYIQEGIFGFYSGF 333

Query: 299 AANLFKVVPSTAVSWLVYEVV 319
             NLF+ +P++A++ + +E V
Sbjct: 334 GTNLFRTLPASAITLVSFEYV 354

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 41/82 (50%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLN 86
           LA  V+  V+  +  P E ++  LQ++S   S+ R +   I+  Y +EG  G + G G N
Sbjct: 277 LASSVSKMVASVLSYPHEILRTRLQLKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTN 336

Query: 87  CIRIFPYSAVQFVVYEACKKKL 108
             R  P SA+  V +E  +  L
Sbjct: 337 LFRTLPASAITLVSFEYVRNFL 358

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 1/83 (1%)

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNEL-GFRYTSVWDALVTIGRAEGVSGYYKGL 298
           GA++G ++  +  P D+ + R Q   +         Y      + TI R EGV G YKGL
Sbjct: 75  GALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYKGL 134

Query: 299 AANLFKVVPSTAVSWLVYEVVCD 321
              +    P+  + + VYE   D
Sbjct: 135 VPIIMGYFPTWMIYFSVYEFCKD 157

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score =  103 bits (257), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 89/301 (29%), Positives = 133/301 (44%), Gaps = 25/301 (8%)

Query: 19  KQDSNIA--FLAGGVAGAVSRTVVSPFERVKILLQ------VQSSTTSYNRGIFSSIRQV 70
           K  SN A  FL GGV+ AV++T  SP ERVK+L+Q       Q S     +GI    ++ 
Sbjct: 6   KPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRT 65

Query: 71  YHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGA 130
             +EG    +RGN  N IR FP  A+ F   +   K +F      G  +      L SG 
Sbjct: 66  ARQEGIISFWRGNTANVIRYFPTQALNFAFKDQI-KAMFGFKKEEGYAKWF-AGNLASGG 123

Query: 131 LCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXX 190
           + GG S++  Y LD  +TRL+      +    SK     +  G+  +  +T         
Sbjct: 124 IAGGLSLMFVYSLDYARTRLA------ADAKSSKKGGERQFNGLVDVYKKTIASDGVAGL 177

Query: 191 XXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTI 250
               + P+ +G+V Y  L F +Y+  +   +  S       S +    +G +    A T 
Sbjct: 178 YRGFL-PSVIGIVVYRGLYFGLYDSCKPLLLTGSLE----GSFIASFLLGWVVTTGASTA 232

Query: 251 TYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTA 310
           +YP D +RRR  ++   G  +  +Y    D L  I  AEGVS  +KG  AN+ + V    
Sbjct: 233 SYPLDTVRRR--MMMTSGQAV--KYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAG 288

Query: 311 V 311
           V
Sbjct: 289 V 289

 Score = 36.2 bits (82), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 239 IGAISGGVAQTITYPFD----LLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGY 294
           +G +S  VA+T   P +    L++ + +++  G   L  RY  + D      R EG+  +
Sbjct: 17  MGGVSAAVAKTAASPIERVKLLIQNQDEMIKQG--SLDHRYKGIVDCFQRTARQEGIISF 74

Query: 295 YKGLAANLFKVVPSTAVSW 313
           ++G  AN+ +  P+ A+++
Sbjct: 75  WRGNTANVIRYFPTQALNF 93

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score =  102 bits (255), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 88/296 (29%), Positives = 133/296 (44%), Gaps = 27/296 (9%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTT---SYNR---GIFSSIRQVYHEEGTK 77
           I FL GGV+ AV++T  SP ERVK+L+Q Q       + +R   GI    ++   +EG  
Sbjct: 25  IDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVI 84

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTN--TQRLFSGALCGGC 135
             +RGN  N IR FP  A+ F    A K K+  + G   +E         L SG   G  
Sbjct: 85  SFWRGNTANVIRYFPTQALNF----AFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGAL 140

Query: 136 SVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXV 195
           S++  Y LD  +TRL+  + +      SK     +  G+  +  +T             +
Sbjct: 141 SLLFVYSLDYARTRLAADSKS------SKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFL 194

Query: 196 WPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFD 255
            P+ +G+V Y  L F +Y+ L+   +  S       S L    +G +    A T +YP D
Sbjct: 195 -PSVVGIVVYRGLYFGMYDSLKPLLLTGSLEG----SFLASFLLGWVVTTGASTCSYPLD 249

Query: 256 LLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAV 311
            +RRR  + +  G  +  +Y   +D L  I  AEGV   +KG  AN+ + V    V
Sbjct: 250 TVRRRMMMTS--GQAV--KYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGV 301

 Score = 36.2 bits (82), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 51/116 (43%), Gaps = 4/116 (3%)

Query: 204 PYVALNFAVYEQLRE-FGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQ 262
           P  ALNFA  ++++  FG    +    W +    L  G  +G ++    Y  D  R R  
Sbjct: 99  PTQALNFAFKDKIKAMFGFKKEEGYAKWFAG--NLASGGAAGALSLLFVYSLDYARTRLA 156

Query: 263 VLAMGGNELGFR-YTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
             +    + G R +  + D      +++GV+G Y+G   ++  +V    + + +Y+
Sbjct: 157 ADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYD 212

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 234 LYKLTIGAISGGVAQTITYPFD----LLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAE 289
           L    +G +S  VA+T   P +    L++ + ++L  G   L  +Y  + D        E
Sbjct: 24  LIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQG--TLDRKYAGILDCFKRTATQE 81

Query: 290 GVSGYYKGLAANLFKVVPSTAVSW 313
           GV  +++G  AN+ +  P+ A+++
Sbjct: 82  GVISFWRGNTANVIRYFPTQALNF 105

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score =  102 bits (253), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 90/307 (29%), Positives = 138/307 (44%), Gaps = 31/307 (10%)

Query: 16  DFLKQDSNIA--FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN------RGIFSSI 67
           D  +Q++N A  FL GGV+ A+++T  SP ERVKIL+Q Q              GI    
Sbjct: 4   DAKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCF 63

Query: 68  RQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTN--TQR 125
           ++   +EG    +RGN  N IR FP  A+ F    A K K+  + G   +E         
Sbjct: 64  KRTAKQEGLISFWRGNTANVIRYFPTQALNF----AFKDKIKLMFGFKKEEGYGKWFAGN 119

Query: 126 LFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXX 185
           L SG   G  S++  Y LD  +TRL+   A+  S  +  A+  +   G+  +  +T    
Sbjct: 120 LASGGAAGALSLLFVYSLDFARTRLA---ADAKSSKKGGARQFN---GLTDVYKKTLKSD 173

Query: 186 XXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSS-DAQPSWKSNLYKLTIGAISG 244
                    + P+ +G+V Y  L F +++ L+   +  S D      S L    +G +  
Sbjct: 174 GIAGLYRGFM-PSVVGIVVYRGLYFGMFDSLKPLVLTGSLDG-----SFLASFLLGWVVT 227

Query: 245 GVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFK 304
             A T +YP D +RRR  ++   G  +  +Y    D L  I  +EGV   +KG  AN+ +
Sbjct: 228 TGASTCSYPLDTVRRR--MMMTSGQAV--KYNGAIDCLKKIVASEGVGSLFKGCGANILR 283

Query: 305 VVPSTAV 311
            V    V
Sbjct: 284 SVAGAGV 290

 Score = 35.0 bits (79), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 21/95 (22%), Positives = 48/95 (50%), Gaps = 6/95 (6%)

Query: 223 SSDAQPSWKSNLYKLTIGAISGGVAQTITYPFD----LLRRRFQVLAMGGNELGFRYTSV 278
           SSDA+    +      +G +S  +A+T   P +    L++ + +++  G   L  +Y+ +
Sbjct: 2   SSDAKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQG--TLDKKYSGI 59

Query: 279 WDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSW 313
            D      + EG+  +++G  AN+ +  P+ A+++
Sbjct: 60  VDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNF 94

>Kwal_27.12481
          Length = 304

 Score =  101 bits (252), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 92/305 (30%), Positives = 136/305 (44%), Gaps = 33/305 (10%)

Query: 19  KQDSNIA--FLAGGVAGAVSRTVVSPFERVKILLQVQSSTT---SYNR---GIFSSIRQV 70
           K+ SN A  FL GGV+ AVS+T  +P ERVK+L+Q Q       S +R   GI    ++ 
Sbjct: 5   KKQSNFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGECFKRT 64

Query: 71  YHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTN--TQRLFS 128
              EG    +RGN  N IR FP  A+ F    A K K+  + G   +E         L S
Sbjct: 65  AANEGIASFWRGNTANVIRYFPTQALNF----AFKDKIKAMFGFKKEEGYAKWFAGNLAS 120

Query: 129 GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXX 188
           G   GG S++  Y LD  +TRL+  +        +K     +  G+  +  +T       
Sbjct: 121 GGAAGGLSLMFVYSLDYARTRLAADSKG------AKKGGERQFNGLVDVYKKTLASDGIA 174

Query: 189 XXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNL--YKLTIGAISGGV 246
                 + P+ +G+V Y  L F  Y+ L+   +  S       S L  + +T G      
Sbjct: 175 GLYRGFL-PSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASFLLGWAVTTG------ 227

Query: 247 AQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVV 306
           A T +YP D +RRR  + +  G  +  +Y   +DA   I  AEG+   +KG  AN+ + V
Sbjct: 228 ASTASYPLDTVRRRMMMTS--GQAV--KYNGAFDAFRKIVAAEGIKSLFKGCGANILRGV 283

Query: 307 PSTAV 311
               V
Sbjct: 284 AGAGV 288

 Score = 31.6 bits (70), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 42/79 (53%), Gaps = 6/79 (7%)

Query: 239 IGAISGGVAQTITYPFD----LLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGY 294
           +G +S  V++T   P +    L++ + +++  G   L  RYT + +        EG++ +
Sbjct: 16  MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQG--SLDRRYTGIGECFKRTAANEGIASF 73

Query: 295 YKGLAANLFKVVPSTAVSW 313
           ++G  AN+ +  P+ A+++
Sbjct: 74  WRGNTANVIRYFPTQALNF 92

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score =  102 bits (254), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 86/306 (28%), Positives = 144/306 (47%), Gaps = 27/306 (8%)

Query: 21  DSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQ-----SSTTSYNRGIFSSIRQVYHEEG 75
           D  +A ++G ++GA+S  +V PF+  K  LQ Q     +  + + +G F +   ++ +EG
Sbjct: 37  DPRVAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEG 96

Query: 76  TKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGC 135
             GL++G     +   P   + F VY+ C+K  + V+       L+N     S    G  
Sbjct: 97  AAGLYKGLQPTVLGYIPTLMIYFSVYDFCRK--YSVDIFPHSPFLSNAS---SAITAGAI 151

Query: 136 SVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXV 195
           S VAT P+ ++KTRL +QT  +   +     +I     I Q                  +
Sbjct: 152 STVATNPIWVVKTRLMLQTG-IGKYSTHYKGTIDTFRKIIQ--------QEGAKALYAGL 202

Query: 196 WPTSLGVVPYVALNFAVYEQLR-EFGVNSSD--AQPSWKSNLYKLTIGA-ISGGVAQTIT 251
            P  LG++  VA+ F +YE L+  FG + S   +     SN  KL + + +S  VA T+T
Sbjct: 203 VPALLGMLN-VAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVT 261

Query: 252 YPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAV 311
           YP ++LR R Q+ +   N +      +   +    R EG +G+Y G A NL + VP+  V
Sbjct: 262 YPHEILRTRMQLKSDLPNTVQ---RHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVV 318

Query: 312 SWLVYE 317
           + + +E
Sbjct: 319 TLVSFE 324

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score =  104 bits (260), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 84/310 (27%), Positives = 137/310 (44%), Gaps = 41/310 (13%)

Query: 21  DSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLF 80
           DS   F  G VAG +  T+V P + VK  +Q Q S + Y   I     ++   EG +G++
Sbjct: 542 DSLYNFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLSQYKNSI-DCFLKILSREGIRGVY 600

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
            G G   I + P  A++  V +  + KL   NG     +L     + SGA  G C V+ T
Sbjct: 601 SGLGPQLIGVAPEKAIKLTVNDYMRNKLKDKNG-----KLGLLSEIISGASAGACQVIFT 655

Query: 141 YPLDLIKTRLSI---------QTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXX 191
            PL+++K RL +         + A L++L   K   +   PG+++               
Sbjct: 656 NPLEIVKIRLQVKGEYVAENAENAKLTALQIIKRLGL---PGLYK--------------- 697

Query: 192 XXXVWPTSLGVVPYVALNFAVYEQLRE--FGVNSSDAQPSWKSNLYK-LTIGAISGGVAQ 248
                   L  VP+ A+ F  Y  L+   F  + +D     + N ++ L+ GA++G  A 
Sbjct: 698 --GAAACLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAA 755

Query: 249 TITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPS 308
            +T PFD+++ R Q+    G  +   Y  +  A  TI R E    ++KG AA + +  P 
Sbjct: 756 YLTTPFDVIKTRLQIDPKKGETI---YKGIIHAARTILREESFKSFFKGGAARVLRSSPQ 812

Query: 309 TAVSWLVYEV 318
              +   YE+
Sbjct: 813 FGFTLAAYEL 822

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score =  103 bits (256), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 80/303 (26%), Positives = 137/303 (45%), Gaps = 28/303 (9%)

Query: 21  DSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLF 80
           DS   F  G +AG +  TVV P + VK  +Q Q S + Y   I     +++  EG +G++
Sbjct: 517 DSIYNFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSI-DCFAKIFSREGIRGIY 575

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
            G G   I + P  A++  V +  + +L   + N     L     + SGA  G C VV T
Sbjct: 576 SGLGPQLIGVAPEKAIKLTVNDYMRGRLMDKHAN-----LKWYFEILSGACAGACQVVFT 630

Query: 141 YPLDLIKTRLSIQTANLSSLNRSK--AKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPT 198
            PL+++K RL +++     + +S+  A  + K  GI  L                 +   
Sbjct: 631 NPLEVVKIRLQVRSEYAGDVLKSQVTALGVIKQLGIKGLYK--------------GIAAC 676

Query: 199 SLGVVPYVALNFAVYEQLRE--FGVNSSDAQPSWKSNLYKLTI-GAISGGVAQTITYPFD 255
            +  VP+ A+ F  Y  L++  F  +  D +   K   ++L + G ++G  A  +T PFD
Sbjct: 677 LMRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFD 736

Query: 256 LLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLV 315
           +++ R Q+    G     RY  ++ A  TI + E    ++KG +A + +  P    +   
Sbjct: 737 VIKTRLQIDPRKGET---RYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAA 793

Query: 316 YEV 318
           YE+
Sbjct: 794 YEI 796

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 99.8 bits (247), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 86/295 (29%), Positives = 136/295 (46%), Gaps = 24/295 (8%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQ-------SSTTSYNRGIFSSIRQVYHEEGT 76
           I F+ GGV+ AVS+T  +P ERVK+L+Q Q       S    YN GI    ++    EG 
Sbjct: 11  INFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYN-GIVDCFKRTAASEGV 69

Query: 77  KGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCS 136
              +RGN  N IR FP  A+ F   +  K         +G  +      L SG   GG S
Sbjct: 70  ISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKWF-AGNLASGGAAGGLS 128

Query: 137 VVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVW 196
           ++  Y LD  +TRL+  + +      +K     +  G+  +  +T             + 
Sbjct: 129 LLFVYSLDYARTRLAADSKS------AKKGGERQFNGLVDVYKKTLASDGIAGLYRGFL- 181

Query: 197 PTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDL 256
           P+ +G+V Y  L F +Y+ L+   + + + + S+ ++   L   A++ G A T +YP D 
Sbjct: 182 PSVVGIVVYRGLYFGMYDSLKPL-LLTGNLESSFIASF--LLGWAVTTG-ASTASYPLDT 237

Query: 257 LRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAV 311
           +RRR  ++   G  +  +Y   +DA   I  AEGV   +KG  AN+ + V    V
Sbjct: 238 VRRR--MMMTSGQAV--KYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGV 288

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 6/84 (7%)

Query: 234 LYKLTIGAISGGVAQTITYPFD----LLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAE 289
           L    +G +S  V++T   P +    L++ + ++L  G   L  RY  + D       +E
Sbjct: 10  LINFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQG--SLDRRYNGIVDCFKRTAASE 67

Query: 290 GVSGYYKGLAANLFKVVPSTAVSW 313
           GV  +++G  AN+ +  P+ A+++
Sbjct: 68  GVISFWRGNTANVIRYFPTQALNF 91

>Kwal_55.20868
          Length = 380

 Score = 98.6 bits (244), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 82/311 (26%), Positives = 146/311 (46%), Gaps = 31/311 (9%)

Query: 20  QDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQ---SSTTSYNRGIFSSIRQVYHEEGT 76
            D+ I  L+G +AG ++   V P +  K  LQ Q   S+ ++Y +GI  ++  +  +EG 
Sbjct: 73  DDTEITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGA 132

Query: 77  KGLFRGNGLNCIRIFPYSAVQFVVYEACKK---KLFHVNGNNGQEQLTNTQRLFSGALCG 133
           +GL++G     +  FP   + F VYE  KK   ++F                  S    G
Sbjct: 133 RGLYKGLVPIIMGYFPTWMIYFSVYERSKKLYPRIF--------PSFDFISHSASALTAG 184

Query: 134 GCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXX 193
             S + T P+ ++KTRL +QT     +N++     S      ++ +              
Sbjct: 185 TVSTILTNPVWVVKTRLMLQT----HVNKNSTHYTSTFDAFHKMYT-----TEGLRTFYA 235

Query: 194 XVWPTSLGVVPYVALNFAVYEQLREF--GVNSSDAQPSWKSNLYKLTIG-AISGGVAQTI 250
            + P+ LG+  +VA++F +YE+L+ +     S         NL +L I  + S  VA T+
Sbjct: 236 GLLPSLLGLF-HVAIHFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTL 294

Query: 251 TYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTI----GRAEGVSGYYKGLAANLFKVV 306
           TYP ++LR R Q+ A   + L     +    L+ +     ++EG+ G+Y G  ANL + +
Sbjct: 295 TYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTL 354

Query: 307 PSTAVSWLVYE 317
           P++A++ + +E
Sbjct: 355 PASAITLVSFE 365

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 48/107 (44%), Gaps = 12/107 (11%)

Query: 20  QDSNIAF----LAGGVAGAVSRTVVSPFERVKILLQVQSSTT--------SYNRGIFSSI 67
           +D N+      +A   +  V+ T+  P E ++  +Q+++  T        +   G+   I
Sbjct: 271 EDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLI 330

Query: 68  RQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGN 114
           +  Y  EG +G + G   N  R  P SA+  V +E  +K L  +N N
Sbjct: 331 KHTYKSEGLRGFYSGFTANLARTLPASAITLVSFEYFRKYLTKLNDN 377

>Scas_709.9
          Length = 365

 Score = 97.8 bits (242), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 87/314 (27%), Positives = 147/314 (46%), Gaps = 44/314 (14%)

Query: 21  DSNIAFLAGGVAGAVSRTVVSPFERVKILLQ---VQSSTTSYNRGIFSSIRQVYHEEGTK 77
           D  I  L+G +AG +S  +V P +  K  LQ   +QS    Y RG+  ++  +  +EG +
Sbjct: 63  DPKITALSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVR 122

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSV 137
           GL++G     +  FP   + F VYE  K     V  N+  + ++++    S    G  S 
Sbjct: 123 GLYKGLIPIILGYFPTWMIYFSVYEFAKDLYPRVLPNS--DFISHS---CSAITAGAAST 177

Query: 138 VATYPLDLIKTRLSIQTANLSSLNRSKA-----KSISKPPGIWQLLSETXXXXXXXXXXX 192
           V T P+ ++KTRL +QT    S    +      K I    G+  L +             
Sbjct: 178 VLTNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYT------------- 224

Query: 193 XXVWPTSLGVVPYVALNFAVYEQLREF--------GVNSSDAQPSWKSNLYKLTIG-AIS 243
             + P+  G++ +VA++F VYE+L+          G NS +       +L +L I  + S
Sbjct: 225 -GLVPSMFGLL-HVAIHFPVYEKLKNRLHCDTITGGHNSQE----HSLHLTRLIIASSAS 278

Query: 244 GGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLF 303
             +A  +TYP ++LR R Q   +  ++L      + D +    R EG+ G+Y G A NL 
Sbjct: 279 KMLASILTYPHEILRTRMQ---LKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLL 335

Query: 304 KVVPSTAVSWLVYE 317
           + VP++A++ + +E
Sbjct: 336 RTVPASAITLVSFE 349

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 1/82 (1%)

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299
           GA++G ++  I  P D+ + R Q   +   E  + Y  V   + TI   EGV G YKGL 
Sbjct: 71  GALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPY-YRGVLGTMSTIVVDEGVRGLYKGLI 129

Query: 300 ANLFKVVPSTAVSWLVYEVVCD 321
             +    P+  + + VYE   D
Sbjct: 130 PIILGYFPTWMIYFSVYEFAKD 151

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 98.6 bits (244), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/303 (26%), Positives = 134/303 (44%), Gaps = 28/303 (9%)

Query: 21  DSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLF 80
           DS   F  G +AG +  TVV P + VK  +Q Q ++  Y   I   + +++  +G +GL+
Sbjct: 503 DSIHNFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSI-DCVVKIFQTKGIRGLY 561

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
            G G   I + P  A++  V +  ++        N    +   Q + SGA  G C VV T
Sbjct: 562 SGLGPQLIGVAPEKAIKLTVNDFMRQYFM-----NKSRTIKWYQEILSGATAGACQVVFT 616

Query: 141 YPLDLIKTRLSIQTANLSSLNRSK--AKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPT 198
            PL+++K RL +++  +    R +  A  I +  G+  L                     
Sbjct: 617 NPLEIVKIRLQMRSDYVGENARPQLGAVGIIRQLGLRGLYKGAAACL------------- 663

Query: 199 SLGVVPYVALNFAVYEQLRE--FGVNSSDAQPSWKSNLYKLTI-GAISGGVAQTITYPFD 255
            L  VP+ A+ F  Y  L++  F  + +D     K   ++L + G I+G  A  +T PFD
Sbjct: 664 -LRDVPFSAIYFPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFD 722

Query: 256 LLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLV 315
           +++ R Q+    G      YT V  A  TI + E +  ++KG  A + +  P    +   
Sbjct: 723 VIKTRLQIDPRKGETT---YTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAA 779

Query: 316 YEV 318
           +E+
Sbjct: 780 FEM 782

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 95.5 bits (236), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 86/311 (27%), Positives = 140/311 (45%), Gaps = 36/311 (11%)

Query: 18  LKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQS--STTSYNRGIFSSIRQVYHEEG 75
           L  D+ +  ++G +AG VS  +V P +  K  LQ Q   S   Y RGI  ++  +  +EG
Sbjct: 80  LLDDTQVTAVSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEG 139

Query: 76  TKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKL-FHVNGNNGQEQLTNTQRLFSGALCGG 134
             GL++G     +  FP   + F VYE CK++   ++ G              S    G 
Sbjct: 140 VAGLYKGLAPIVLGYFPTWMLYFSVYEKCKQRYPSYLPGG-------FVSHAASALTAGA 192

Query: 135 CSVVATYPLDLIKTRLSIQT--ANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXX 192
            S   T P+ ++KTRL IQ+  +  S+  RS   +  K                      
Sbjct: 193 ISTALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRK-----------MYRSEGLKVFY 241

Query: 193 XXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTI------GAISGGV 246
             + P+  G+  +VA++F VYE+L+ +   ++ A    + +  KL +        +S  V
Sbjct: 242 SGLVPSLFGLF-HVAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVV 300

Query: 247 AQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVV 306
           A  ITYP ++LR R QV   G         S+ + L  I  +EG  G+Y G A NL + V
Sbjct: 301 ASVITYPHEILRTRMQVRHSGVPP------SLLNLLGRIRASEGYVGFYSGFATNLVRTV 354

Query: 307 PSTAVSWLVYE 317
           P++ ++ + +E
Sbjct: 355 PASVITLVSFE 365

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 94.4 bits (233), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 123/301 (40%), Gaps = 41/301 (13%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85
            +AG  AG +  +V+ P + +K  +Q  ++ +   + + S I  +   EGT  L++G   
Sbjct: 37  LIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALWKGVQS 96

Query: 86  NCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT----Y 141
             +   P  AV F  YE CKK L   +        T T   F  A+ G C+  A+     
Sbjct: 97  VILGAGPAHAVYFGTYEFCKKNLIDSSD-------TQTHHPFKTAISGACATTASDALMN 149

Query: 142 PLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLG 201
           P D IK R+ + T+                  +WQ   +               +PT+L 
Sbjct: 150 PFDTIKQRIQLNTSA----------------SVWQTTKQIYQSEGLAAFYYS--YPTTLV 191

Query: 202 V-VPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRR 260
           + +P+ A NF +YE   +F   S++  P     L     G+ISG     IT P D ++  
Sbjct: 192 MNIPFAAFNFVIYESSTKFLNPSNEYNP-----LIHCLCGSISGSTCAAITTPLDCIKTV 246

Query: 261 FQVLAMGGNELGFRYTSVWD----ALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVY 316
            Q+   G   +        D    A   I +  G  G+++G    +   +P+TA+SW  Y
Sbjct: 247 LQI--RGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAY 304

Query: 317 E 317
           E
Sbjct: 305 E 305

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 85/199 (42%), Gaps = 33/199 (16%)

Query: 124 QRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNR----SKAKSISKPPGIWQLLS 179
            +L +GA  G       +P+D +KTR  IQ+AN  SL+     S+   IS   G   L  
Sbjct: 35  HQLIAGAFAGIMEHSVMFPIDALKTR--IQSANAKSLSAKNMLSQISHISTSEGTLALWK 92

Query: 180 ETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTI 239
                          V    LG  P  A+ F  YE  ++  ++SSD Q     + +K  I
Sbjct: 93  --------------GVQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQ---THHPFKTAI 135

Query: 240 -GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGL 298
            GA +   +  +  PFD +++R Q+             SVW     I ++EG++ +Y   
Sbjct: 136 SGACATTASDALMNPFDTIKQRIQLNTSA---------SVWQTTKQIYQSEGLAAFYYSY 186

Query: 299 AANLFKVVPSTAVSWLVYE 317
              L   +P  A ++++YE
Sbjct: 187 PTTLVMNIPFAAFNFVIYE 205

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 46/96 (47%), Gaps = 14/96 (14%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTT----------SYNRGIFSSIRQVYHE 73
           I  L G ++G+    + +P + +K +LQ++ S T          ++++   S+I QVY  
Sbjct: 221 IHCLCGSISGSTCAAITTPLDCIKTVLQIRGSQTVSLEIMRKADTFSKAA-SAIYQVY-- 277

Query: 74  EGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLF 109
            G KG +RG     +   P +A+ +  YE  K  L 
Sbjct: 278 -GWKGFWRGWKPRIVANMPATAISWTAYECAKHFLM 312

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 93.6 bits (231), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 84/330 (25%), Positives = 144/330 (43%), Gaps = 48/330 (14%)

Query: 15  KDFLKQDSNIA----FLAGGVAGAVSRTVVSPFERVKILLQVQSST--TSYNRGIFSSIR 68
           +D L++  N+A     LAG V+G ++R++ +P + +KI LQ+  +     +   +    R
Sbjct: 5   EDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVAR 64

Query: 69  QVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFS 128
            +   EG +  ++GN    +    Y + QF  Y    + L       G E       L  
Sbjct: 65  SMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPF----GLE--ARLHSLVV 118

Query: 129 GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKP-PGIWQLLSETXXXXXX 187
           GA  G  S + +YP D+++TRL    AN    N+  + SI++    IW+L          
Sbjct: 119 GAFAGITSSIVSYPFDVLRTRL---VAN----NQMHSMSITREVRDIWKL---------- 161

Query: 188 XXXXXXXVWPTSLGVVPYVALN----FAVYEQLREF---GVNSSDAQPSWKSNLYKLTIG 240
                   +  S+  +  + L     F  YE +R +      ++ A   W+      + G
Sbjct: 162 --EGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAG 219

Query: 241 AISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDAL---------VTIGRAEGV 291
            I G +A+ IT+P + +RRR Q +     E   R++SV+ +          + I + EGV
Sbjct: 220 TIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGV 279

Query: 292 SGYYKGLAANLFKVVPSTAVSWLVYEVVCD 321
           S  Y+G+   L K +P+T VS+  YE    
Sbjct: 280 SSLYRGILVALSKTIPTTFVSFWGYETAIH 309

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 93.2 bits (230), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 135/326 (41%), Gaps = 59/326 (18%)

Query: 19  KQDSNIA--FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNR---------GIFSSI 67
           K+ SN A   +AGG AG        P + +K+ +Q+      Y R         G   + 
Sbjct: 5   KKSSNPAVNLIAGGTAGLFEALCCHPLDTIKVRMQI------YRRSALEGIKPPGFIKTG 58

Query: 68  RQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLF 127
           R +Y EEG   L++G G   I I P  A++F  YE  +  L   +   G     NT    
Sbjct: 59  RNIYTEEGLLALYKGLGAVVIGIIPKMAIRFSSYEFYRSAL--ADKQTGSVSTGNT--FL 114

Query: 128 SGALCGGC-SVVATYPLDLIKTRLSIQTANLSSLNRSKAKS-------ISKPPGIWQLLS 179
           +G   G   +V+   P++++K RL  Q  +  +    + ++       I K  GI  L  
Sbjct: 115 AGVGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYR 174

Query: 180 ETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREF--GVNSSDAQPSWKSNLYKL 237
                             T+ G       NF VY +L+EF    + +DA PSW+++    
Sbjct: 175 GVSLTAARQA--------TNQGA------NFTVYSKLKEFLQEHHKTDALPSWETS---- 216

Query: 238 TIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGR----AEGVSG 293
            IG ISG +      P D ++ R Q      N  G      W  +VTIG+     EG   
Sbjct: 217 CIGLISGAIGPFSNAPLDTIKTRLQKDKSTANMSG------WSRIVTIGKQLIKEEGFRA 270

Query: 294 YYKGLAANLFKVVPSTAVSWLVYEVV 319
            YKG+   + +V P  AV++ VYE V
Sbjct: 271 LYKGITPRVMRVAPGQAVTFTVYEFV 296

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 83/203 (40%), Gaps = 27/203 (13%)

Query: 26  FLAGGVAGAVSRT-VVSPFERVKILLQVQ-----SSTTSYNRGIFSSIRQVYHEEGTKGL 79
           FLAG  AG      VV+P E VKI LQ Q     ++ +   R    +   +  EEG   L
Sbjct: 113 FLAGVGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGAL 172

Query: 80  FRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVA 139
           +RG  L   R        F VY   K+ L     ++  + L + +    G + G     +
Sbjct: 173 YRGVSLTAARQATNQGANFTVYSKLKEFL---QEHHKTDALPSWETSCIGLISGAIGPFS 229

Query: 140 TYPLDLIKTRLSIQ--TANLSSLNR--SKAKSISKPPGIWQLLSETXXXXXXXXXXXXXV 195
             PLD IKTRL     TAN+S  +R  +  K + K  G   L                 +
Sbjct: 230 NAPLDTIKTRLQKDKSTANMSGWSRIVTIGKQLIKEEGFRALYK--------------GI 275

Query: 196 WPTSLGVVPYVALNFAVYEQLRE 218
            P  + V P  A+ F VYE +RE
Sbjct: 276 TPRVMRVAPGQAVTFTVYEFVRE 298

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 9/106 (8%)

Query: 12  NSIKDFLKQDSNIAFLA-------GGVAGAVSRTVVSPFERVKILLQVQSSTTSYN--RG 62
           + +K+FL++      L        G ++GA+     +P + +K  LQ   ST + +    
Sbjct: 195 SKLKEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTANMSGWSR 254

Query: 63  IFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKL 108
           I +  +Q+  EEG + L++G     +R+ P  AV F VYE  ++ L
Sbjct: 255 IVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVREHL 300

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 91.7 bits (226), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 92/307 (29%), Positives = 140/307 (45%), Gaps = 37/307 (12%)

Query: 19  KQDSNIA--FLAGGVAGAVSRTVVSPFERVKILLQVQSSTT---SYNR---GIFSSIRQV 70
           K+ SN A  FL GGV+ AVS+T  +P ERVK+L+Q Q       S +R   GI    ++ 
Sbjct: 5   KKQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRT 64

Query: 71  YHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGA 130
             +EG    +RGN  N IR FP  A+ F    A K K+  + G   +E      + F+G 
Sbjct: 65  AADEGVASFWRGNTANVIRYFPTQALNF----AFKDKIKAMFGFKKEE---GYAKWFAGN 117

Query: 131 LCGGCSVVA-----TYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXX 185
           L  G           Y LD  +TRL+   A+  S  +   +  +   G+  +  +T    
Sbjct: 118 LASGGLAGGLSLLFVYSLDYARTRLA---ADSKSAKKGGERQFN---GLVDVYKKTLASD 171

Query: 186 XXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIG-AISG 244
                    + P+ +G+V Y  L F +Y+ L+   +  S       S L    +G A++ 
Sbjct: 172 GVAGLYRGFL-PSVVGIVVYRGLYFGLYDSLKPLLLTGSLEN----SFLASFLLGWAVTT 226

Query: 245 GVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFK 304
           G A T +YP D +RRR  ++   G  +  +Y   +DA   I  AEG+   +KG  AN+ +
Sbjct: 227 G-ASTASYPLDTVRRR--MMMTSGQAV--KYDGAFDAFRKIVAAEGIKSLFKGCGANILR 281

Query: 305 VVPSTAV 311
            V    V
Sbjct: 282 GVAGAGV 288

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 42/79 (53%), Gaps = 6/79 (7%)

Query: 239 IGAISGGVAQTITYPFD----LLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGY 294
           +G +S  V++T   P +    L++ + +++  G   L  RYT + +        EGV+ +
Sbjct: 16  MGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQG--SLDRRYTGIVECFKRTAADEGVASF 73

Query: 295 YKGLAANLFKVVPSTAVSW 313
           ++G  AN+ +  P+ A+++
Sbjct: 74  WRGNTANVIRYFPTQALNF 92

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 92.0 bits (227), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 88/328 (26%), Positives = 141/328 (42%), Gaps = 60/328 (18%)

Query: 13  SIKDFLKQDSNI----AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIR 68
           + +D L++   +    A +AG V+G V+R+V +P + VKI  Q+Q ++     GI  + R
Sbjct: 11  ATEDHLRKGEAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEHKYHGILHTFR 70

Query: 69  QVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQL-TNTQRLF 127
            V  EEG + L++GN         Y ++QF  Y         +N       L      L 
Sbjct: 71  TVAREEGVRALWKGNVPASAMYVLYGSLQFGTYA-------WLNTAAASAGLPPQAHSLA 123

Query: 128 SGALCGGCSVVATYPLDLIKTRL-SIQTANLSSLNRSKAKSI--SKPP------GIWQLL 178
            GAL G  S + TYPLDL++TRL + ++A+  SL R +A+ I  ++ P      G W + 
Sbjct: 124 VGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRR-QARVIWDTEGPAGFFRGGAWAIA 182

Query: 179 SETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLT 238
           + T                          L F +YE         + A  ++        
Sbjct: 183 ATTLT----------------------TGLIFGIYE-------TCTIAADTYGLPWLAAA 213

Query: 239 IGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDAL---------VTIGRAE 289
               +G V++   +P D +RRR Q++         R    + AL         V + RAE
Sbjct: 214 ASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAE 273

Query: 290 GVSGYYKGLAANLFKVVPSTAVSWLVYE 317
           G++  YKGL   L K  P+T ++  VY+
Sbjct: 274 GIASLYKGLTMALCKSTPTTVITLWVYQ 301

 Score = 32.0 bits (71), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 13/98 (13%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTT----SYNRGIFSSIR---------QV 70
           +A  A   AG VS+  V P + V+  LQ+  +      + + G +S++R          +
Sbjct: 210 LAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHM 269

Query: 71  YHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKL 108
              EG   L++G  +   +  P + +   VY+ C + L
Sbjct: 270 VRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307

>Scas_716.29
          Length = 316

 Score = 90.9 bits (224), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 85/336 (25%), Positives = 153/336 (45%), Gaps = 45/336 (13%)

Query: 5   LTVLEQPNSIKDFLKQDSNI----AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN 60
           +T ++      D L++  ++    + +AG V+G ++RTV++P + +KI LQ++ S T   
Sbjct: 1   MTNIDDGQHNTDHLRKGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQA 60

Query: 61  -RGIFSSIR-QVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQE 118
             G+   ++  + +E G +  ++GN    +    Y   QF  Y          +  NGQ 
Sbjct: 61  PSGLLKMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQ- 119

Query: 119 QLTNTQRLFSGALCGGCSVVATYPLDLIKTR-LSIQTANLSSLNRSKAK--SISKPPGIW 175
                Q L  GAL G  S   +YP D+++TR ++ Q   LSSL+    +  ++   PG +
Sbjct: 120 ----LQSLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFF 175

Query: 176 QLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLY 235
           +  + +                    +    ++ F  YE ++ +    S  + S  +N  
Sbjct: 176 RGCTASM-----------------FTITLSASILFGTYESIKIYCDEYS--KESDYTNYL 216

Query: 236 KLTIGAISGGVAQTITYPFDLLRRRFQV---LAMGGNELGFRYTSVWDAL---------V 283
           + +  +ISG  ++ +TYP D +RRR QV   + +  N      T ++ +          +
Sbjct: 217 RYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGL 276

Query: 284 TIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVV 319
            I R EG+   Y+G++ +L K VPST VS   YE V
Sbjct: 277 NILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETV 312

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 90/210 (42%), Gaps = 29/210 (13%)

Query: 118 EQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQL 177
           E +  +Q L +G++ G  +     PLD +K RL ++           + +   P G+ ++
Sbjct: 18  EDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLR----------PSYTGQAPSGLLKM 67

Query: 178 LSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKL 237
           +                  P ++  V Y    F+ Y         +SD     +S    L
Sbjct: 68  MKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQS----L 123

Query: 238 TIGAISGGVAQTITYPFDLLRRRF---QVLAMGGNELGFRYTSVWDALVTIGRAEGVSGY 294
            +GA++G  +  ++YP D+LR RF   Q +A+     G +   +W+        EG+ G+
Sbjct: 124 VVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCK--EIWN-------MEGIPGF 174

Query: 295 YKGLAANLFKVVPSTAVSWLVYE---VVCD 321
           ++G  A++F +  S ++ +  YE   + CD
Sbjct: 175 FRGCTASMFTITLSASILFGTYESIKIYCD 204

>Kwal_23.3965
          Length = 307

 Score = 90.1 bits (222), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/325 (24%), Positives = 137/325 (42%), Gaps = 49/325 (15%)

Query: 15  KDFLKQDSNI----AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQV 70
           +D L++   +    + +AG ++G  +R V +P + +KI LQ+Q +  +   GI  + +++
Sbjct: 3   EDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRL 62

Query: 71  YHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQL-TNTQRLFSG 129
             +EG + L++GN         Y + QF  Y    K L        + QL         G
Sbjct: 63  VRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKLL-------SKSQLPAQIHTGMVG 115

Query: 130 ALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXX 189
           AL G CS +A+YP D+++TR     +   S   S A+ I +  G                
Sbjct: 116 ALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIA 175

Query: 190 XXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKL---TIGAISGGV 246
                +               A YE ++ F     + +P   S++ +L   +   I+G V
Sbjct: 176 VATSSI--------------LATYESVKIF----CEQRPDRDSSVIQLLESSASVIAGIV 217

Query: 247 AQTITYPFDLLRRRFQVLAMGGNELG--------------FRYTSVWDALVTIGRAEGVS 292
           ++TI +P D +R+R+QV+     +LG              +  T+     + I   EG+ 
Sbjct: 218 SKTIVFPIDTVRKRYQVI--DWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLL 275

Query: 293 GYYKGLAANLFKVVPSTAVSWLVYE 317
             Y G    + K VPST VS  VYE
Sbjct: 276 ALYHGYTLGIAKSVPSTVVSLGVYE 300

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 90/201 (44%), Gaps = 33/201 (16%)

Query: 124 QRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLN--RSKAKSISKPPGIWQLLSET 181
           Q L +G L G  + + T PLD +K RL +Q AN +         K + +  G+  L    
Sbjct: 16  QSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRAL---- 71

Query: 182 XXXXXXXXXXXXXVWPTSLGVVPYVALNFAVY--EQLREFGV-NSSDAQPSWKSNLYKLT 238
                         W    G VP +A+ + +Y   Q   + + N   ++    + ++   
Sbjct: 72  --------------WK---GNVPAMAM-YILYGSTQFTSYAILNKLLSKSQLPAQIHTGM 113

Query: 239 IGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGL 298
           +GA+SG  +   +YP D+LR RF  +A    EL    ++  +    I R EG  G++KG+
Sbjct: 114 VGALSGTCSAIASYPCDVLRTRF--IANHSRELSTMLSTAQE----IWRHEGFRGFFKGV 167

Query: 299 AANLFKVVPSTAVSWLVYEVV 319
           ++++  +  +T+     YE V
Sbjct: 168 SSSIVSIAVATSSILATYESV 188

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 54/127 (42%), Gaps = 24/127 (18%)

Query: 6   TVLEQPNSIKDFLKQ----DSNIAFL----AGGVAGAVSRTVVSPFERVKILLQV----- 52
           ++L    S+K F +Q    DS++  L    A  +AG VS+T+V P + V+   QV     
Sbjct: 180 SILATYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQ 239

Query: 53  ----------QSSTTSYNRGIFSSIR-QVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVY 101
                       +  SY    F  +   +  +EG   L+ G  L   +  P + V   VY
Sbjct: 240 LGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVY 299

Query: 102 EACKKKL 108
           E C +++
Sbjct: 300 EWCLRRM 306

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 90.1 bits (222), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 87/316 (27%), Positives = 140/316 (44%), Gaps = 47/316 (14%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFR---- 81
            ++G  AG ++     P + VK+ LQ+ + T    +G +  ++++  +      FR    
Sbjct: 12  MISGLTAGTITTVSTHPLDLVKVRLQLLA-TNKKPQGYYDVVKRIVKDSKQHSFFRETYR 70

Query: 82  GNGLNCIRIFPYSAVQFVVYEACKKKLFHV---------NGNNGQEQLTNTQRLFSGALC 132
           G G+N +       + F +Y A K  +F           N  N  +++T+   L + A+ 
Sbjct: 71  GLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYLLAAAMS 130

Query: 133 GGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKP------PGIWQLLSETXXXXX 186
           G  + V T P+ +IKTR+   +   S   RS    I K        G W+ L        
Sbjct: 131 GVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLV------- 183

Query: 187 XXXXXXXXVWPTSLGVVPYVALNFAVYEQLRE--FGVNSSDAQPSWKSNLYKLTIGAISG 244
                     P+  GV    A+ F VY+ L+   F     D +    SNL  +TI ++S 
Sbjct: 184 ----------PSLFGV-SQGAIYFTVYDTLKYHYFAAKHVDKKKK-LSNLEYITITSLSK 231

Query: 245 GVAQTITYPFDLLR---RRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAAN 301
            V+ T  YP  LL+   + F+V  +   +   R   VW  + TI   +GV+G YKGL AN
Sbjct: 232 MVSVTAVYPLQLLKSNLQSFEVSTVINPKTSHR---VWKLITTIYVRDGVTGLYKGLLAN 288

Query: 302 LFKVVPSTAVSWLVYE 317
           L + VPST +++ VYE
Sbjct: 289 LIRAVPSTCITFCVYE 304

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 83/201 (41%), Gaps = 13/201 (6%)

Query: 124 QRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSK-AKSISKPPGIWQLLSETX 182
           + + SG   G  + V+T+PLDL+K RL +   N          K I K         ET 
Sbjct: 10  KEMISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQHSFFRETY 69

Query: 183 XXXXXXXXXXXXVWPTSLGVVPYVALNFAVYE----QLREFGVNSSDAQPSWKSNLYKLT 238
                        W    G+  Y A    V++     ++ F  N+ +      S +Y L 
Sbjct: 70  RGLGVNLLGNSVAWGLYFGL--YRASKDWVFQWCNTDVKRFN-NTMNNDKEMTSLMY-LL 125

Query: 239 IGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGL 298
             A+SG     +T P  +++ R    +   +     Y S  D +  + R EG++G+++GL
Sbjct: 126 AAAMSGVATSVLTNPIWVIKTRIMSTSFVDSR---SYRSTVDGIKKLYRIEGLAGFWRGL 182

Query: 299 AANLFKVVPSTAVSWLVYEVV 319
             +LF  V   A+ + VY+ +
Sbjct: 183 VPSLFG-VSQGAIYFTVYDTL 202

>Scas_379.2
          Length = 301

 Score = 89.7 bits (221), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/301 (25%), Positives = 128/301 (42%), Gaps = 43/301 (14%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85
            LAG  AG +  +V+ P + +K  +Q  S+ ++ N  + S + ++   EG+  L++G   
Sbjct: 27  LLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSN--MLSQMAKISTAEGSLALWKGVQS 84

Query: 86  NCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT----Y 141
             +   P  AV F  YE  KK L         E+   T +    AL G  + +A      
Sbjct: 85  VILGAGPAHAVYFATYEYTKKYLI-------DEKDMQTHQPLKTALSGTVATIAADALMN 137

Query: 142 PLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLG 201
           P D +K R+ + T N +  N +K   I K  G                      +PT+L 
Sbjct: 138 PFDTLKQRMQLNT-NTTVWNVTK--QIYKNEGF---------------SAFYYSYPTTLA 179

Query: 202 V-VPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRR 260
           + +P+ A NF +YE   +F   ++D  P     L     G +SG     IT P D ++  
Sbjct: 180 MNIPFAAFNFMIYESATKFFNPTNDYNP-----LVHCLSGGLSGATCAAITTPLDCIKTV 234

Query: 261 FQVLAMGGNELGFRY----TSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVY 316
            QV   G   +  +      +   A   I +  G  G+++GL   +F  +P+TA++W  Y
Sbjct: 235 LQV--RGSESVSLQVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAY 292

Query: 317 E 317
           E
Sbjct: 293 E 293

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 83/198 (41%), Gaps = 31/198 (15%)

Query: 123 TQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPG---IWQLLS 179
           + +L +GA  G       +P+D +KTR+   +A  +S   S+   IS   G   +W+   
Sbjct: 24  SHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKISTAEGSLALWK--- 80

Query: 180 ETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTI 239
                          V    LG  P  A+ FA YE  +++ ++  D Q      L     
Sbjct: 81  --------------GVQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQT--HQPLKTALS 124

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299
           G ++   A  +  PFD L++R Q   +  N      T+VW+    I + EG S +Y    
Sbjct: 125 GTVATIAADALMNPFDTLKQRMQ---LNTN------TTVWNVTKQIYKNEGFSAFYYSYP 175

Query: 300 ANLFKVVPSTAVSWLVYE 317
             L   +P  A ++++YE
Sbjct: 176 TTLAMNIPFAAFNFMIYE 193

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 6/89 (6%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTT------SYNRGIFSSIRQVYHEEGTKGLF 80
           L+GG++GA    + +P + +K +LQV+ S +              + + +Y   G KG +
Sbjct: 212 LSGGLSGATCAAITTPLDCIKTVLQVRGSESVSLQVMKEANTFQKATKAIYQVHGAKGFW 271

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLF 109
           RG         P +A+ +  YE  K  L 
Sbjct: 272 RGLQPRVFANMPATAIAWTAYECAKHFLL 300

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 89.7 bits (221), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 84/318 (26%), Positives = 129/318 (40%), Gaps = 47/318 (14%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNR----GIFSSIRQVYHEEGTKGL 79
           I  +AGG AG        P + +K+ +Q+             G   + R +Y +EG   L
Sbjct: 12  INLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLAL 71

Query: 80  FRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCS--V 137
           ++G G   I I P  A++F  YE  +  L  VN  +G   + +T   F   +  G +  V
Sbjct: 72  YKGLGAVVIGIIPKMAIRFSSYEFYRTLL--VNKESG---IVSTGNTFVAGVGAGITEAV 126

Query: 138 VATYPLDLIKTRLSIQTANLSSLNR--------SKAKSISKPPGIWQLLSETXXXXXXXX 189
           +   P++++K RL  Q    S  N           A +I K  G+  L            
Sbjct: 127 LVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQA 186

Query: 190 XXXXXVWPTSLGVVPYVALNFAVYEQLREFGVN--SSDAQPSWKSNLYKLTIGAISGGVA 247
                   T+ G       NF VY +L+EF  N    D  PSW+++     IG ISG + 
Sbjct: 187 --------TNQGA------NFTVYSKLKEFLQNYHQMDVLPSWETS----CIGLISGAIG 228

Query: 248 QTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIG----RAEGVSGYYKGLAANLF 303
                P D ++ R Q        +     S    ++TIG    + EG    YKG+   + 
Sbjct: 229 PFSNAPLDTIKTRLQ----KDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVM 284

Query: 304 KVVPSTAVSWLVYEVVCD 321
           +V P  AV++ VYE V +
Sbjct: 285 RVAPGQAVTFTVYEYVRE 302

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 61/220 (27%), Positives = 88/220 (40%), Gaps = 28/220 (12%)

Query: 26  FLAGGVAGAVSRT-VVSPFERVKILLQVQSSTTS-------YNRGIFSSIRQVYHEEGTK 77
           F+AG  AG      VV+P E VKI LQ Q  T S       YN  I ++   +  EEG  
Sbjct: 114 FVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAY-TIVKEEGVS 172

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSV 137
            L+RG  L   R        F VY   K+ L      +  + L + +    G + G    
Sbjct: 173 ALYRGVSLTAARQATNQGANFTVYSKLKEFL---QNYHQMDVLPSWETSCIGLISGAIGP 229

Query: 138 VATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLS--ETXXXXXXXXXXXXXV 195
            +  PLD IKTR          L + K+ S+ K  G+ ++++                 +
Sbjct: 230 FSNAPLDTIKTR----------LQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGI 279

Query: 196 WPTSLGVVPYVALNFAVYEQLRE----FGVNSSDAQPSWK 231
            P  + V P  A+ F VYE +RE     G+   +  P  K
Sbjct: 280 TPRVMRVAPGQAVTFTVYEYVREHLENLGIFKKNDTPKPK 319

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 89.4 bits (220), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 125/298 (41%), Gaps = 34/298 (11%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQVQSST-----TSYNRGIFSSIRQVYHEEGTKGLFRG 82
           AG  AG +  +++ P + +K  +Q  S+T     T     + + I ++   EG+  L++G
Sbjct: 23  AGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALWKG 82

Query: 83  NGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYP 142
                +   P  AV F  YE CK +L         + L   +   SG L    +     P
Sbjct: 83  VQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTHQPL---KTALSGTLATVAADALMNP 139

Query: 143 LDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGV 202
            D IK RL +  ++  S+ +   +   +  GI                     +PT++ +
Sbjct: 140 FDTIKQRLQLHPSD--SMTKCAVRMYQRE-GIAAFFYS---------------YPTTIAM 181

Query: 203 -VPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRF 261
            +P+ ALNF +YE   +    S++  P W   L     G ISG     IT P D ++   
Sbjct: 182 NIPFAALNFVIYESSTKIFNPSNNYNP-WIHCL----CGGISGATCAAITTPLDCVKTVL 236

Query: 262 QVLAMGG--NELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
           Q+       ++L     +   A   I +  G SG+++GL   +   +P+TA+SW  YE
Sbjct: 237 QIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAISWTSYE 294

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 63/135 (46%), Gaps = 21/135 (15%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLN 86
           L+G +A   +  +++PF+ +K  LQ+  S +     +     ++Y  EG    F      
Sbjct: 124 LSGTLATVAADALMNPFDTIKQRLQLHPSDSMTKCAV-----RMYQREGIAAFFYSYPTT 178

Query: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGG-----CSVVATY 141
                P++A+ FV+YE+   K+F+ + N            +   LCGG     C+ + T 
Sbjct: 179 IAMNIPFAALNFVIYES-STKIFNPSNNYNP---------WIHCLCGGISGATCAAITT- 227

Query: 142 PLDLIKTRLSIQTAN 156
           PLD +KT L I+ A+
Sbjct: 228 PLDCVKTVLQIRGAD 242

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 47/108 (43%), Gaps = 16/108 (14%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN---------RGIFSSIRQVYHEE 74
           I  L GG++GA    + +P + VK +LQ++ + +  +         R   S+I + Y   
Sbjct: 210 IHCLCGGISGATCAAITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTY--- 266

Query: 75  GTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTN 122
           G  G FRG     I   P +A+ +  YE  K  LF     N    L N
Sbjct: 267 GWSGFFRGLKPRIISNMPATAISWTSYEFAKHLLF----TNSNAHLDN 310

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query: 225 DAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTS-VWDALV 283
           +A P     +Y+L  GA +G +  +I +P D ++ R Q ++  G+    R  S +   + 
Sbjct: 9   EALPENAPLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIA 68

Query: 284 TIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318
            I   EG    +KG+ + +    P+ AV +  YE+
Sbjct: 69  KISTTEGSLALWKGVQSVVLGAGPAHAVYFATYEM 103

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 80/194 (41%), Gaps = 20/194 (10%)

Query: 125 RLFSGALCGGCSVVATYPLDLIKTRL-SIQTANLSSLNRSKAKSISKPPGIWQLLSETXX 183
           +L +GA  G       +P+D IKTR+ ++ T   S+  R  +  +++   I    S T  
Sbjct: 20  QLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKI----STTEG 75

Query: 184 XXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAIS 243
                      V    LG  P  A+ FA YE  +   ++  D Q      L     G ++
Sbjct: 76  SLALWKGVQSVV----LGAGPAHAVYFATYEMCKSRLIDPEDRQT--HQPLKTALSGTLA 129

Query: 244 GGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLF 303
              A  +  PFD +++R Q+             S+    V + + EG++ ++      + 
Sbjct: 130 TVAADALMNPFDTIKQRLQL---------HPSDSMTKCAVRMYQREGIAAFFYSYPTTIA 180

Query: 304 KVVPSTAVSWLVYE 317
             +P  A+++++YE
Sbjct: 181 MNIPFAALNFVIYE 194

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 88.6 bits (218), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 80/301 (26%), Positives = 135/301 (44%), Gaps = 23/301 (7%)

Query: 22  SNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTT----SYNRGIFSSIRQVYHEEGTK 77
           + I  L+G  AG +S   V P +  K  LQ Q   T     Y RGI  ++  +  +EG +
Sbjct: 77  TQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPR 136

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSV 137
           GL++G     +  FP   + F VYE   KK FH        Q     +  +    G  S 
Sbjct: 137 GLYKGLVPIVLGYFPTWMIYFSVYE-FSKKFFH----GIFPQFDFVAQSCAAITAGAAST 191

Query: 138 VATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWP 197
             T P+ ++KTRL +Q+      N  +  +  K  G +    +              V P
Sbjct: 192 TLTNPIWVVKTRLMLQS------NLGEHPTHYK--GTFDAFRKLFYQEGFKALYAGLV-P 242

Query: 198 TSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIG-AISGGVAQTITYPFDL 256
           + LG+  +VA++F +YE L+      S    +   NL +L +  ++S  +A  +TYP ++
Sbjct: 243 SLLGLF-HVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEI 301

Query: 257 LRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVY 316
           LR R Q+ +   + +  R   +  A       EG+ G+Y G   NL + +P++A++ + +
Sbjct: 302 LRTRMQLKSDIPDSIQRRLFPLIKATYA---QEGLKGFYSGFTTNLVRTIPASAITLVSF 358

Query: 317 E 317
           E
Sbjct: 359 E 359

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 77/151 (50%), Gaps = 11/151 (7%)

Query: 16  DFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSS---TTSYNRGIFSSIRQVYH 72
           DF+ Q       A   AGA S T+ +P   VK  L +QS+     ++ +G F + R++++
Sbjct: 175 DFVAQSC-----AAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFY 229

Query: 73  EEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRL-FSGAL 131
           +EG K L+ G   + + +F + A+ F +YE  K + FH           N QRL  + ++
Sbjct: 230 QEGFKALYAGLVPSLLGLF-HVAIHFPIYEDLKVR-FHCYSRENNTNSINLQRLIMASSV 287

Query: 132 CGGCSVVATYPLDLIKTRLSIQTANLSSLNR 162
               +   TYP ++++TR+ +++    S+ R
Sbjct: 288 SKMIASAVTYPHEILRTRMQLKSDIPDSIQR 318

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSST-TSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85
           +A  V+  ++  V  P E ++  +Q++S    S  R +F  I+  Y +EG KG + G   
Sbjct: 283 MASSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTT 342

Query: 86  NCIRIFPYSAVQFVVYEACKKKL 108
           N +R  P SA+  V +E  + +L
Sbjct: 343 NLVRTIPASAITLVSFEYFRNRL 365

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 89.0 bits (219), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 89/339 (26%), Positives = 153/339 (45%), Gaps = 68/339 (20%)

Query: 20  QDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQS--------------STT---SYNRG 62
            D+ I  L+G +AG ++  +V P +  K  LQ Q               +TT    Y  G
Sbjct: 101 NDTEITALSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSG 160

Query: 63  IFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTN 122
           I+ ++  +  +E  +GL++G     +  FP   + F VYE CK  L +    N  E L++
Sbjct: 161 IWGTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCK--LSYPRYFNNSEFLSH 218

Query: 123 TQRLFSGALCGGCSVVATYPLDLIKTRLSIQTA-NLSSLNRSKAK-----SISKPPGIWQ 176
           +    S    G  S   T P+ ++KTRL +Q+  N+  +   K        I K  GI  
Sbjct: 219 S---MSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKS 275

Query: 177 LLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLRE--------------FGVN 222
             S               + P+  G++ +VA++F VYE+L++                VN
Sbjct: 276 FYS--------------GLIPSLFGLL-HVAIHFPVYEKLKKVLHCYPSGRPNQETMNVN 320

Query: 223 -SSDAQPSWKSN--LYKLTIGAI-SGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSV 278
            +S+ Q +  +N  L +L + +  S  +A T+TYP ++LR R Q+ +           S+
Sbjct: 321 GNSNPQTTGSTNFQLGRLIVASCGSKMIASTLTYPHEILRTRLQLKSD-------MKPSI 373

Query: 279 WDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
              + T    EG+ G+Y G   N+F+ VP++A++ + +E
Sbjct: 374 KSIIRTTYAKEGIRGFYSGFLTNMFRTVPASAITLVSFE 412

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 3/74 (4%)

Query: 35  VSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYS 94
           ++ T+  P E ++  LQ++S        I S IR  Y +EG +G + G   N  R  P S
Sbjct: 348 IASTLTYPHEILRTRLQLKSDMKP---SIKSIIRTTYAKEGIRGFYSGFLTNMFRTVPAS 404

Query: 95  AVQFVVYEACKKKL 108
           A+  V +E  +K  
Sbjct: 405 AITLVSFEYFRKHF 418

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 87.0 bits (214), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 130/301 (43%), Gaps = 30/301 (9%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTS--YNRGIFSSIRQVYHEEGTKGLFRGN 83
           F+AG VAG     V+ P + VK ++Q+Q S  S    +G+F  ++Q+  +EG   L++G 
Sbjct: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGI 72

Query: 84  GLNCIRIFPYSAVQFVV---YEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
               +   P  A +F     ++   K LF      G E+LT    + SGA  G C     
Sbjct: 73  SSPILMEAPKRATKFACNDEFQKIYKDLF------GAEKLTQPLSILSGASAGICESFVV 126

Query: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSL 200
            P +L+K RL   ++  +S           P  + + + E              +W   +
Sbjct: 127 VPFELVKIRLQDVSSKFTS-----------PIAVVKNIVEKEGILAMYNGLESTMWRHGI 175

Query: 201 GVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRR 260
               + A  F +  Q+R     +S      +++L   T+G   G ++  ++ PFD+++ R
Sbjct: 176 ----WNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVG---GTLSSLLSTPFDVVKSR 228

Query: 261 FQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVC 320
            Q  A+    +  +Y   W AL TI + EG    YKG    + ++ P   +  +V+  V 
Sbjct: 229 VQNTAVIPG-VPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVM 287

Query: 321 D 321
           D
Sbjct: 288 D 288

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 4/90 (4%)

Query: 224 SDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALV 283
           SD +P     +Y+   GA++G     + YP D+++   Q+   GG+  G +Y  V+D L 
Sbjct: 2   SDQKPL--PFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGS--GPQYKGVFDCLK 57

Query: 284 TIGRAEGVSGYYKGLAANLFKVVPSTAVSW 313
            I   EG S  YKG+++ +    P  A  +
Sbjct: 58  QIAAKEGPSRLYKGISSPILMEAPKRATKF 87

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/188 (20%), Positives = 75/188 (39%), Gaps = 19/188 (10%)

Query: 117 QEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQ 176
           Q+ L    +  +GA+ G   ++  YPLD++KT + +Q +  S              G++ 
Sbjct: 4   QKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYK---------GVFD 54

Query: 177 LLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYK 236
            L +                P  L   P  A  FA  ++ ++   +   A+    +    
Sbjct: 55  CLKQIAAKEGPSRLYKGISSPI-LMEAPKRATKFACNDEFQKIYKDLFGAEKL--TQPLS 111

Query: 237 LTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYK 296
           +  GA +G     +  PF+L++ R Q       ++  ++TS    +  I   EG+   Y 
Sbjct: 112 ILSGASAGICESFVVVPFELVKIRLQ-------DVSSKFTSPIAVVKNIVEKEGILAMYN 164

Query: 297 GLAANLFK 304
           GL + +++
Sbjct: 165 GLESTMWR 172

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 66/145 (45%), Gaps = 10/145 (6%)

Query: 19  KQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKG 78
           K    ++ L+G  AG     VV PFE VKI LQ  SS  +    +   ++ +  +EG   
Sbjct: 105 KLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKFTSPIAV---VKNIVEKEGILA 161

Query: 79  LFRGNGLNCIRIFPYSAVQF-VVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSV 137
           ++ G      R   ++A  F ++++    +      +   EQ  N   L +G + G  S 
Sbjct: 162 MYNGLESTMWRHGIWNAGYFGIIFQV---RALLPKASTKSEQTRND--LLAGTVGGTLSS 216

Query: 138 VATYPLDLIKTRLSIQTANLSSLNR 162
           + + P D++K+R+   TA +  + R
Sbjct: 217 LLSTPFDVVKSRVQ-NTAVIPGVPR 240

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 86.7 bits (213), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 123/304 (40%), Gaps = 47/304 (15%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85
            LAG  AG +  +++ P + +K  +Q      + + G+ S I ++   EG+  L++G   
Sbjct: 27  LLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISKISTMEGSMALWKGVQS 86

Query: 86  NCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT----Y 141
             +   P  AV F  YE CK +L          +   T +    AL G  + +A      
Sbjct: 87  VILGAGPAHAVYFGTYEFCKARLI-------SPEDMQTHQPMKTALSGTIATIAADALMN 139

Query: 142 PLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLG 201
           P D +K RL + T NL   N +K         I+Q                   +PT+L 
Sbjct: 140 PFDTVKQRLQLDT-NLRVWNVTKQ--------IYQ---------NEGFAAFYYSYPTTLA 181

Query: 202 V-VPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRR 260
           + +P+ A NF +YE   +F    +   P     L     G ISG     +T P D ++  
Sbjct: 182 MNIPFAAFNFMIYESASKFFNPQNSYNP-----LIHCLCGGISGATCAALTTPLDCIKTV 236

Query: 261 FQVLAMGGNELGFRYTSVWDALVTIGRA-------EGVSGYYKGLAANLFKVVPSTAVSW 313
            QV   G   +      +     T GRA        G  G+++GL   +   +P+TA+SW
Sbjct: 237 LQV--RGSETVSIE---IMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISW 291

Query: 314 LVYE 317
             YE
Sbjct: 292 TAYE 295

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 77/200 (38%), Gaps = 37/200 (18%)

Query: 125 RLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNR-------SKAKSISKPPGIWQL 177
           +L +GA  G       +P+D +KTR  +Q A L+           SK  ++     +W+ 
Sbjct: 26  QLLAGAFAGIMEHSLMFPIDALKTR--VQAAGLNKAASTGMISQISKISTMEGSMALWK- 82

Query: 178 LSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKL 237
                            V    LG  P  A+ F  YE  +   ++  D Q      +   
Sbjct: 83  ----------------GVQSVILGAGPAHAVYFGTYEFCKARLISPEDMQT--HQPMKTA 124

Query: 238 TIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKG 297
             G I+   A  +  PFD +++R Q+      +   R   VW+    I + EG + +Y  
Sbjct: 125 LSGTIATIAADALMNPFDTVKQRLQL------DTNLR---VWNVTKQIYQNEGFAAFYYS 175

Query: 298 LAANLFKVVPSTAVSWLVYE 317
               L   +P  A ++++YE
Sbjct: 176 YPTTLAMNIPFAAFNFMIYE 195

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 14/96 (14%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTT----------SYNRGIFSSIRQVYHE 73
           I  L GG++GA    + +P + +K +LQV+ S T          ++ R    + R +   
Sbjct: 211 IHCLCGGISGATCAALTTPLDCIKTVLQVRGSETVSIEIMKDANTFGR----ASRAILEV 266

Query: 74  EGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLF 109
            G KG +RG     +   P +A+ +  YE  K  L 
Sbjct: 267 HGWKGFWRGLKPRIVANIPATAISWTAYECAKHFLM 302

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 86.3 bits (212), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 120/295 (40%), Gaps = 30/295 (10%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85
            LAG  AG +  +V+ P + +K  +Q  SS+ +  +G+   I ++   EG+  L++G   
Sbjct: 20  LLAGAFAGIMEHSVLFPVDAIKTRIQ-SSSSGAATQGLIKQISKITTAEGSLALWKGVQS 78

Query: 86  NCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDL 145
             +   P  AV F  YE  K KL      +  + +   +   SG      +     P D+
Sbjct: 79  VILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQPI---KTAISGMAATTVADALMNPFDV 135

Query: 146 IKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGV-VP 204
           IK R+ + T                   +W +                  +PT+L + +P
Sbjct: 136 IKQRMQLNTRE----------------SVWHVTKNIYHKEGFAAFYYS--YPTTLVMNIP 177

Query: 205 YVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVL 264
           + A NFA+YE   +F   S++  P           G +SG     IT P D ++   QV 
Sbjct: 178 FAAFNFAIYESATKFMNPSNEYNP-----FIHCISGGLSGATCAAITTPLDCIKTVLQVR 232

Query: 265 AMG--GNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
                 NE+  +  +   A   I +  G  G+ +GL   +   +P+TA+SW  YE
Sbjct: 233 GSETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYE 287

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 80/198 (40%), Gaps = 17/198 (8%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLN 86
           ++G  A  V+  +++PF+ +K  +Q+ +        ++   + +YH+EG    +      
Sbjct: 117 ISGMAATTVADALMNPFDVIKQRMQLNT-----RESVWHVTKNIYHKEGFAAFYYSYPTT 171

Query: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLI 146
            +   P++A  F +YE+  K +      N   +        SG L G      T PLD I
Sbjct: 172 LVMNIPFAAFNFAIYESATKFM------NPSNEYNPFIHCISGGLSGATCAAITTPLDCI 225

Query: 147 KTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYV 206
           KT L ++ +   S        I K    +Q  +               + P  +  +P  
Sbjct: 226 KTVLQVRGSETVS------NEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPAT 279

Query: 207 ALNFAVYEQLREFGVNSS 224
           A+++  YE  + F VNSS
Sbjct: 280 AISWTSYECAKHFLVNSS 297

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 78/198 (39%), Gaps = 32/198 (16%)

Query: 124 QRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXX 183
            +L +GA  G       +P+D IKTR  IQ+++  +  +   K ISK             
Sbjct: 18  HQLLAGAFAGIMEHSVLFPVDAIKTR--IQSSSSGAATQGLIKQISK-----------IT 64

Query: 184 XXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAIS 243
                      V    LG  P  A+ FA YE  +   ++  D       + ++    AIS
Sbjct: 65  TAEGSLALWKGVQSVILGAGPAHAVYFATYEFSKSKLIDPQDM------HTHQPIKTAIS 118

Query: 244 GGVAQTIT----YPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299
           G  A T+      PFD++++R Q        L  R  SVW     I   EG + +Y    
Sbjct: 119 GMAATTVADALMNPFDVIKQRMQ--------LNTR-ESVWHVTKNIYHKEGFAAFYYSYP 169

Query: 300 ANLFKVVPSTAVSWLVYE 317
             L   +P  A ++ +YE
Sbjct: 170 TTLVMNIPFAAFNFAIYE 187

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 85.9 bits (211), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 84/326 (25%), Positives = 136/326 (41%), Gaps = 44/326 (13%)

Query: 15  KDFLKQDSNIA----FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQV 70
           KD L++D  ++     +AG ++G  +RT ++P + VKI LQV     + N  I      +
Sbjct: 4   KDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLI-----NI 58

Query: 71  YHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFS-- 128
              EG +G ++GN    I    Y   QF  Y      L       G   L  + +L+S  
Sbjct: 59  LKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFL------RGGLDLNISPQLYSCL 112

Query: 129 -GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXX 187
            G+L G  S +A+YP D+++TR +  +       R +  +I    G+    S        
Sbjct: 113 VGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFS-------- 164

Query: 188 XXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKS-NLYKLTIGAISGGV 246
                     + + +    A+ F VYE ++ F    S          L     G ISG  
Sbjct: 165 ------GCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFT 218

Query: 247 AQTITYPFDLLRRRFQVLAMGGNELGFR------YTSVWDAL-----VTIGRAEGVSGYY 295
           ++  T+P D +RRR Q+      E   R      Y S  +       +++ + EG    Y
Sbjct: 219 SKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLY 278

Query: 296 KGLAANLFKVVPSTAVSWLVYEVVCD 321
           +G+  +L K VPSTA+S   YE+  +
Sbjct: 279 RGVTMSLIKSVPSTAISLWSYELFMN 304

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 15/97 (15%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTS------YNRGIFSSIRQ---------VY 71
           LAG ++G  S+    P + V+  +Q+++S         + + I+ S +          + 
Sbjct: 210 LAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMV 269

Query: 72  HEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKL 108
            +EG   L+RG  ++ I+  P +A+    YE    KL
Sbjct: 270 QQEGPLSLYRGVTMSLIKSVPSTAISLWSYELFMNKL 306

>Scas_691.4
          Length = 334

 Score = 85.5 bits (210), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 80/318 (25%), Positives = 129/318 (40%), Gaps = 33/318 (10%)

Query: 19  KQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN-RGIFSSIRQVYHEEGTK 77
           K    I  +AGG AG        P + +K+ +Q+   T      G  ++ R +Y  EG  
Sbjct: 10  KSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGFL 69

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLT-NTQRLFSGALCGGCS 136
            L++G G   I I P  A++F  YE      F+ N    +E  T  T   F   +  G +
Sbjct: 70  ALYKGLGAVVIGIIPKMAIRFSSYE------FYRNALTDKETRTITTGNTFLAGVGAGIT 123

Query: 137 --VVATYPLDLIKTRLSIQTAN------LSSLNRSKAKSISKPPGIWQLLSE-TXXXXXX 187
             V+   P++++K RL  Q  N              A +++KP     + +  T      
Sbjct: 124 EAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEG 183

Query: 188 XXXXXXXVWPTSLGVVPYVALNFAVYEQLREF--GVNSSDAQPSWKSNLYKLTIGAISGG 245
                  V  T+         NF VY  L+++    ++ ++ PSW+++     IG ISG 
Sbjct: 184 AGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWETSC----IGLISGA 239

Query: 246 VAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIG----RAEGVSGYYKGLAAN 301
           +      P D ++ R Q       +      S W  +  IG    + EG    YKG+   
Sbjct: 240 IGPFSNAPLDTIKTRLQ------KDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPR 293

Query: 302 LFKVVPSTAVSWLVYEVV 319
           + +V P  AV++ VYE V
Sbjct: 294 VMRVAPGQAVTFTVYEFV 311

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 86/233 (36%), Gaps = 46/233 (19%)

Query: 26  FLAGGVAGAVSRT-VVSPFERVKILLQVQ----------------SSTTSYNRGIFSSIR 68
           FLAG  AG      VV+P E VKI LQ Q                ++ T       ++I 
Sbjct: 114 FLAGVGAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIH 173

Query: 69  QVY---HEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQR 125
             Y    EEG   L+RG  L   R        F VY   K    ++   + +E L + + 
Sbjct: 174 AAYTIVKEEGAGALYRGVSLTAARQATNQGANFTVYSYLKD---YLQKYHNRESLPSWET 230

Query: 126 LFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQ---LLSETX 182
              G + G     +  PLD IKTRL             K KSIS     W+   ++    
Sbjct: 231 SCIGLISGAIGPFSNAPLDTIKTRLQ------------KDKSISSNSA-WKKIYIIGTQL 277

Query: 183 XXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLRE-------FGVNSSDAQP 228
                       + P  + V P  A+ F VYE +R+       FG +   A+P
Sbjct: 278 IKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRKHLETLNFFGGSGPSAKP 330

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 54/108 (50%), Gaps = 9/108 (8%)

Query: 14  IKDFLKQDSNIAFLA-------GGVAGAVSRTVVSPFERVKILLQVQSSTTSYN--RGIF 64
           +KD+L++  N   L        G ++GA+     +P + +K  LQ   S +S +  + I+
Sbjct: 212 LKDYLQKYHNRESLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISSNSAWKKIY 271

Query: 65  SSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVN 112
               Q+  EEG + L++G     +R+ P  AV F VYE  +K L  +N
Sbjct: 272 IIGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRKHLETLN 319

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 40/215 (18%), Positives = 79/215 (36%), Gaps = 36/215 (16%)

Query: 126 LFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXX 185
           L +G   G    +  +PLD IK R+ I          +K     +P G +          
Sbjct: 17  LVAGGTAGLFEALCCHPLDTIKVRMQI----------AKRTEGMRPHG-FITTGRNIYSH 65

Query: 186 XXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGG 245
                    +    +G++P +A+ F+ YE  R   +   + +     N +   +GA   G
Sbjct: 66  EGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRN-ALTDKETRTITTGNTFLAGVGA---G 121

Query: 246 VAQTI--TYPFDLLRRRFQVLAMGGNEL-----------------GFRYTSVWDALVTIG 286
           + + +    P ++++ R Q   +  N+L                   +Y +   A  TI 
Sbjct: 122 ITEAVLVVNPMEVVKIRLQAQHL--NDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIV 179

Query: 287 RAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVCD 321
           + EG    Y+G++    +   +   ++ VY  + D
Sbjct: 180 KEEGAGALYRGVSLTAARQATNQGANFTVYSYLKD 214

>Scas_632.9
          Length = 292

 Score = 84.7 bits (208), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 82/325 (25%), Positives = 140/325 (43%), Gaps = 42/325 (12%)

Query: 1   MAEVLTVLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN 60
           M+E +    + +S+++ L    N     G +AGA  + +  PF+ VK+ LQ Q S     
Sbjct: 1   MSESIDHPIEKSSVQNALSDIVN-----GSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPT 55

Query: 61  RGIFSSIRQVYHEEGT-KGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQ 119
              +S I+  YH EG  +G F+G G         +A  FV Y  C   L         E+
Sbjct: 56  T--WSCIKYTYHNEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVL---------EK 104

Query: 120 LTN----TQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIW 175
            TN    +  L SGA  G C+     P++LIK +L  Q +NL +    + K     P + 
Sbjct: 105 FTNVSPLSNILLSGAFAGSCASFVLTPVELIKCKL--QVSNLQTAVEGQIKHTKIIPTLM 162

Query: 176 QLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLY 235
            +L E              +   SLG V +    FA YE +++      D +   ++  +
Sbjct: 163 YVLREKGILGLWQGQSSTFI-RESLGGVAW----FATYEVMKQ---GLKDRRKDTENKTW 214

Query: 236 KLTIGAISGGVA-QTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGY 294
           +L +   S G+A     +P D ++   Q            + ++ +A+  +    G++G+
Sbjct: 215 ELLVSGASAGLAFNASIFPADTVKSMMQT----------EHITLINAVKKVLTTYGITGF 264

Query: 295 YKGLAANLFKVVPSTAVSWLVYEVV 319
           Y+GL   L + VP+ A  + +YE +
Sbjct: 265 YRGLGITLIRAVPANATVFYMYETL 289

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 9/96 (9%)

Query: 14  IKDFLKQDSNIAF---LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQV 70
           +KD  K   N  +   ++G  AG      + P + VK ++Q +  T      + +++++V
Sbjct: 202 LKDRRKDTENKTWELLVSGASAGLAFNASIFPADTVKSMMQTEHIT------LINAVKKV 255

Query: 71  YHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKK 106
               G  G +RG G+  IR  P +A  F +YE   K
Sbjct: 256 LTTYGITGFYRGLGITLIRAVPANATVFYMYETLSK 291

>Scas_662.12
          Length = 308

 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 81/310 (26%), Positives = 145/310 (46%), Gaps = 38/310 (12%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTS--YNRGIFSSIRQVYHEE---GTKG--- 78
           ++G  AG+++  +V P + +K+ LQ+ ++TT+  + +G    I ++ +     G++G   
Sbjct: 12  ISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQGPIY 71

Query: 79  -----LFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCG 133
                 +RG  +N +      ++ F +Y + K  +F    NN       T  L SG + G
Sbjct: 72  NLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQ---NNYLHNNNTTIFLTSGLISG 128

Query: 134 GCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXX 193
             + + T PL +IKTR+     + S  ++   KSI    G   LL++             
Sbjct: 129 ISTTLLTNPLWVIKTRI----MSTSRHHKDSYKSIRH--GFKSLLTK---------EGPK 173

Query: 194 XVW----PTSLGVVPYVALNFAVYEQLR-EFGVN-SSDAQPSWKSNLYKLTIGAISGGVA 247
            +W    P+ LGV    A+ F +Y+ L+  F VN +   + +  +NL  + I ++S  ++
Sbjct: 174 AIWMGLLPSLLGV-SQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLS 232

Query: 248 QTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVP 307
               YPF LL+   Q      N +          +  I R  G+ G YKGL+ANL + +P
Sbjct: 233 VMSVYPFQLLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIP 292

Query: 308 STAVSWLVYE 317
           ST +++ +YE
Sbjct: 293 STCITFCIYE 302

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 4/86 (4%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSY----NRGIFSSIRQVYHEEGTKGLFRG 82
           L   ++  +S   V PF+ +K  LQ   S T+     +    + IR++Y + G KGL++G
Sbjct: 223 LISSLSKMLSVMSVYPFQLLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKG 282

Query: 83  NGLNCIRIFPYSAVQFVVYEACKKKL 108
              N +R  P + + F +YE  K KL
Sbjct: 283 LSANLLRAIPSTCITFCIYENFKSKL 308

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 44/214 (20%), Positives = 83/214 (38%), Gaps = 32/214 (14%)

Query: 118 EQLTNTQR-LFSGALCGGCSVVATYPLDLIKTRLSIQTANLSS-------------LNRS 163
            +LT  Q+ + SG   G  + +  +PLDLIK RL +     +              +N S
Sbjct: 2   HELTPIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNS 61

Query: 164 KAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNS 223
           K      P  I+ L+ E+              W          +L F +Y   +++   +
Sbjct: 62  KKMGSQGP--IYNLIKESYRGLPINLLGNAVAW----------SLYFTIYNSTKDYMFQN 109

Query: 224 SDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALV 283
           +    +  + ++ LT G ISG     +T P  +++ R    +    +    Y S+     
Sbjct: 110 NYLHNN-NTTIF-LTSGLISGISTTLLTNPLWVIKTRIMSTSRHHKD---SYKSIRHGFK 164

Query: 284 TIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
           ++   EG    + GL  +L   V   A+ +++Y+
Sbjct: 165 SLLTKEGPKAIWMGLLPSLLG-VSQGAIYFMIYD 197

>Kwal_33.14050
          Length = 314

 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 80/307 (26%), Positives = 125/307 (40%), Gaps = 48/307 (15%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQVQSST-------TSYNRGIFSSIRQVYHEEGTKGLF 80
           AG  AG +  +++ P + +K  +Q  S+T             I   I ++   EG+  L+
Sbjct: 22  AGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMALW 81

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
           +G     +   P  AV F  YE CK  L          Q   T +    A  G  + VA 
Sbjct: 82  KGVQSVILGAGPAHAVYFATYEMCKSYLI-------DPQDFQTHQPLKTAASGIAATVAA 134

Query: 141 ----YPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVW 196
                P D IK R+ ++T +   +  S A  I +  G+                     +
Sbjct: 135 DLLMNPFDTIKQRMQLRTFSKDRM-WSVASRIYRNEGLAAFFYS---------------Y 178

Query: 197 PTSLGV-VPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFD 255
           PT++ + +P+ A NFA+YE   +F    +   P     L     G ISG     IT P D
Sbjct: 179 PTTIAMNIPFAAFNFAIYESATKFFNPENTYNP-----LIHCLCGGISGATCAAITTPLD 233

Query: 256 LLRRRFQVLAMGGNELG----FRYTSVWD-ALVTIGRAEGVSGYYKGLAANLFKVVPSTA 310
            ++    VL + G+E      FR    +  A   I +  G SG+++GL   +   +P+TA
Sbjct: 234 CIK---TVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATA 290

Query: 311 VSWLVYE 317
           +SW  YE
Sbjct: 291 ISWTAYE 297

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 78/196 (39%), Gaps = 16/196 (8%)

Query: 123 TQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETX 182
           T +L +GA  G       +P+D IKTR+   +A + S N +       P  I Q ++   
Sbjct: 17  THQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAA----KLPSNIVQQIARI- 71

Query: 183 XXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAI 242
                       V    LG  P  A+ FA YE  + + ++  D Q        K     I
Sbjct: 72  STTEGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQ---THQPLKTAASGI 128

Query: 243 SGGVAQTITY-PFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAAN 301
           +  VA  +   PFD +++R Q+     + +       W     I R EG++ ++      
Sbjct: 129 AATVAADLLMNPFDTIKQRMQLRTFSKDRM-------WSVASRIYRNEGLAAFFYSYPTT 181

Query: 302 LFKVVPSTAVSWLVYE 317
           +   +P  A ++ +YE
Sbjct: 182 IAMNIPFAAFNFAIYE 197

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 14/97 (14%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTT----------SYNRGIFSSIRQVYHE 73
           I  L GG++GA    + +P + +K +LQV+ S +          +++R   S+I +VY  
Sbjct: 213 IHCLCGGISGATCAAITTPLDCIKTVLQVRGSESVVDPLFRQADTFSRAA-SAISKVY-- 269

Query: 74  EGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFH 110
            G  G +RG     I   P +A+ +  YE  K  LF+
Sbjct: 270 -GWSGFWRGLKPRIISNMPATAISWTAYECAKHTLFN 305

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 41/87 (47%), Gaps = 3/87 (3%)

Query: 235 YKLTIGAISGGVAQTITYPFDLLRRRFQVLAM---GGNELGFRYTSVWDALVTIGRAEGV 291
           ++L  GA +G +  +I +P D ++ R Q L+      N      +++   +  I   EG 
Sbjct: 18  HQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGS 77

Query: 292 SGYYKGLAANLFKVVPSTAVSWLVYEV 318
              +KG+ + +    P+ AV +  YE+
Sbjct: 78  MALWKGVQSVILGAGPAHAVYFATYEM 104

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 84.0 bits (206), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 126/312 (40%), Gaps = 43/312 (13%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSS-----------------TTSYNRGIFSSIR 68
            +AG  AG +  +++ P + +K  +Q  S                    +    +   I 
Sbjct: 24  LIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQIS 83

Query: 69  QVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFS 128
           ++   EG+  L+RG     +   P  AV F  YE CK++L      N  + L   +   S
Sbjct: 84  RISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPL---KTAVS 140

Query: 129 GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXX 188
           G      +     P D IK RL +Q+ +  S     A +I K  G               
Sbjct: 141 GVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIYKNEGPMAFFYS-------- 192

Query: 189 XXXXXXVWPTSLGV-VPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVA 247
                  +PT+L + +P+ ALNF +YE   +F  N ++A   W   L     G I+G   
Sbjct: 193 -------YPTTLAMNIPFAALNFVIYESSTKF-FNPTNAYNPWIHCL----CGGIAGATC 240

Query: 248 QTITYPFDLLRRRFQVLAMGGNEL-GFRYTSVWD-ALVTIGRAEGVSGYYKGLAANLFKV 305
             +T P D ++   Q+       +  F+  + +  A   I ++ G  G+++GL   +   
Sbjct: 241 AAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISN 300

Query: 306 VPSTAVSWLVYE 317
           +P+TA+SW  YE
Sbjct: 301 IPATAISWTSYE 312

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 74/175 (42%), Gaps = 20/175 (11%)

Query: 9   EQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIR 68
           EQ    KDF         ++G  A   +  +++PF+ +K  LQ+QS ++  +  ++    
Sbjct: 121 EQLIDAKDFNTHQPLKTAVSGVAATVAADALMNPFDTIKQRLQLQSKSS--DSSMWRMAF 178

Query: 69  QVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFS 128
            +Y  EG    F           P++A+ FV+YE+  K     N  N           + 
Sbjct: 179 NIYKNEGPMAFFYSYPTTLAMNIPFAALNFVIYESSTKFFNPTNAYNP----------WI 228

Query: 129 GALCGG-----CSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPP--GIWQ 176
             LCGG     C+ V T PLD IKT L I+ ++   +   K  +  K     IWQ
Sbjct: 229 HCLCGGIAGATCAAVTT-PLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQ 282

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 43/92 (46%), Gaps = 6/92 (6%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSY-----NRGIFSSIRQ-VYHEEGTK 77
           I  L GG+AGA    V +P + +K +LQ++ S T +         F    Q ++   G K
Sbjct: 228 IHCLCGGIAGATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWK 287

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYEACKKKLF 109
           G +RG     I   P +A+ +  YE  K  LF
Sbjct: 288 GFWRGLQPRVISNIPATAISWTSYEFAKHLLF 319

 Score = 36.2 bits (82), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 81/203 (39%), Gaps = 23/203 (11%)

Query: 125 RLFSGALCGGCSVVATYPLDLIKTRL------SIQTANLSSLNRSKAKSISKPPGIWQLL 178
           +L +GA  G       +P+D +KTR+          +  +S     A   +    + Q +
Sbjct: 23  QLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQI 82

Query: 179 SETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSD---AQPSWKSNLY 235
           S               V    +G  P  A+ FA YE  +E  +++ D    QP       
Sbjct: 83  SRI-SSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQP------L 135

Query: 236 KLTIGAISGGV-AQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGY 294
           K  +  ++  V A  +  PFD +++R Q+ +   +      +S+W     I + EG   +
Sbjct: 136 KTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSD------SSMWRMAFNIYKNEGPMAF 189

Query: 295 YKGLAANLFKVVPSTAVSWLVYE 317
           +      L   +P  A+++++YE
Sbjct: 190 FYSYPTTLAMNIPFAALNFVIYE 212

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 19/31 (61%)

Query: 235 YKLTIGAISGGVAQTITYPFDLLRRRFQVLA 265
           Y+L  GA +G +  +I +P D L+ R Q ++
Sbjct: 22  YQLIAGAFAGIMEHSIMFPIDALKTRMQAVS 52

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 82.8 bits (203), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 83/314 (26%), Positives = 140/314 (44%), Gaps = 33/314 (10%)

Query: 12  NSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVY 71
           +S K  L + + +  + G +AGA  + +  PF+ VK+ LQ Q+S        +S I+  Y
Sbjct: 3   DSKKKGLIEGAILDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTT--WSCIKFTY 60

Query: 72  HEEG-TKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNT----QRL 126
             EG  +G F+G     +     +A  FV Y  C K L         E+ TN     Q L
Sbjct: 61  QNEGIARGFFQGIASPLVGACLENATLFVSYNQCSKFL---------EKHTNVFPLGQIL 111

Query: 127 FSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXX 186
            SG + G C+ +   P++L+K +L  Q ANL  +  +K K     P I  +++E      
Sbjct: 112 ISGGVAGSCASLVLTPVELVKCKL--QVANLQ-VASAKTKHTKVLPTIKAIITERGLAGL 168

Query: 187 XXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGV 246
                   +   S G V + A    V + L++   +S D     +S +++L I   S G+
Sbjct: 169 WQGQSGTFI-RESFGGVAWFATYEIVKKSLKD--RHSLDDPKRDESKIWELLISGGSAGL 225

Query: 247 A-QTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKV 305
           A     +P D ++   Q            + S+ +A+  I    G+ G+Y+GL   LF+ 
Sbjct: 226 AFNASIFPADTVKSVMQT----------EHISLTNAVKKIFGKFGLKGFYRGLGITLFRA 275

Query: 306 VPSTAVSWLVYEVV 319
           VP+ A  + ++E +
Sbjct: 276 VPANAAVFYIFETL 289

>Kwal_23.4731
          Length = 314

 Score = 82.4 bits (202), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 83/316 (26%), Positives = 137/316 (43%), Gaps = 50/316 (15%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTS---YNRGIFSSIRQVYHEEGT-KGLFRG 82
           +AG  AG ++     P + VK+ LQ+  +TT    Y   I + IR    +    +  +RG
Sbjct: 18  IAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFREAYRG 77

Query: 83  NGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQL-TNTQRLF-------------S 128
            G+N I       + F +Y   K  ++      G  Q+ T TQ  F             S
Sbjct: 78  LGVNLIGNSIAWGLYFGLYRFTKDMVYRY----GVAQMKTPTQSSFQKDKAMGPSLYLAS 133

Query: 129 GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKP------PGIWQLLSETX 182
            AL G  + + T P+ +IKTR+   ++  S   ++    I K        G W+ L    
Sbjct: 134 AALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWRGLV--- 190

Query: 183 XXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLR-EFGVNSSDAQPSWKSNLYKLTIGA 241
                         P+  GV    A+ F +Y+ LR ++       +     NL  + I +
Sbjct: 191 --------------PSLFGVAQ-GAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITS 235

Query: 242 ISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAAN 301
           +S  ++ T  YPF LL+   Q  A       +R+   W+ + +I + EG+ G YKGL+AN
Sbjct: 236 VSKMLSVTAVYPFQLLKSNLQSFAAVEKRDSYRF---WNLVKSIHQKEGLQGLYKGLSAN 292

Query: 302 LFKVVPSTAVSWLVYE 317
           L + +PST +++ +YE
Sbjct: 293 LLRAIPSTCITFCIYE 308

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 79/198 (39%), Gaps = 9/198 (4%)

Query: 124 QRLFSGALCGGCSVVATYPLDLIKTRLS--IQTANLSSLNRSKAKSISKPPGIWQLLSET 181
           + + +G   G  + +AT+PLDL+K RL   + T +           I        +  E 
Sbjct: 15  REIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFREA 74

Query: 182 XXXXXXXXXXXXXVWPTSLGVVPYVALNFAVY--EQLREFGVNSSDAQPSWKSNLYKLTI 239
                         W    G+  +       Y   Q++    +S     +   +LY L  
Sbjct: 75  YRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLY-LAS 133

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299
            A+SG     +T P  +++ R    +   +E   RY + WD +  +   EG SG+++GL 
Sbjct: 134 AALSGLGTAILTNPIWVIKTRIMSTSSQASE---RYKTTWDGIRKVYAHEGFSGFWRGLV 190

Query: 300 ANLFKVVPSTAVSWLVYE 317
            +LF V    A+ + +Y+
Sbjct: 191 PSLFGVAQG-AIYFTIYD 207

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 44/96 (45%), Gaps = 9/96 (9%)

Query: 224 SDAQPSWKSNLYKLTIGAISGGVAQTI-TYPFDLLRRRFQVLAMGGNELGFRYTSVWDAL 282
           S A  S  + L +  I  ++ G   TI T+P DL++ R Q+L    +  G  Y  V   +
Sbjct: 3   SSAMASDFTPLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHG--YKEVIKTI 60

Query: 283 VTIGRAEG--VSGYYKGLAANLFKVVPSTAVSWLVY 316
           +   +A+       Y+GL  NL       +++W +Y
Sbjct: 61  IRDSKADSNVFREAYRGLGVNLI----GNSIAWGLY 92

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 82.4 bits (202), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 85/315 (26%), Positives = 141/315 (44%), Gaps = 47/315 (14%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQ-SSTTSYNRGIFSSIRQVYHEEGTKG------L 79
           ++G  AG+V+  VV P + +K+ LQ+  +S    + G F  I+++       G      L
Sbjct: 14  ISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVTNEL 73

Query: 80  FRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLT---NTQRLFS------GA 130
           +RG  +N         V F +Y   K+ ++      G+ QL    N  ++ S      GA
Sbjct: 74  YRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLSAGA 133

Query: 131 LCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXX 190
             G  + + T P+ +IKTR+      +S+   ++    S   G+ QLL            
Sbjct: 134 SSGLMTAILTNPIWVIKTRI------MSTSKGAQGAYTSMYNGVQQLLRTDGFQG----- 182

Query: 191 XXXXVWPTSLGVVPYV------ALNFAVYEQL--REFGVNSSDAQPSWKSNLYKLTIGAI 242
               +W    G+VP +      AL FAVY+ L  R+      +      +NL  + I ++
Sbjct: 183 ----LWK---GLVPALFGVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSL 235

Query: 243 SGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANL 302
              V+ T+ YPF LL+   Q  +   NE  FR   +   ++     +G  G YKGL+ANL
Sbjct: 236 GKMVSVTLVYPFQLLKSNLQ--SFRANEQKFRLFPLIKLIIA---NDGFVGLYKGLSANL 290

Query: 303 FKVVPSTAVSWLVYE 317
            + +PST +++ VYE
Sbjct: 291 VRAIPSTCITFCVYE 305

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 35  VSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYS 94
           VS T+V PF+ +K  LQ   +     R +F  I+ +   +G  GL++G   N +R  P +
Sbjct: 239 VSVTLVYPFQLLKSNLQSFRANEQKFR-LFPLIKLIIANDGFVGLYKGLSANLVRAIPST 297

Query: 95  AVQFVVYEACKKKL 108
            + F VYE  K +L
Sbjct: 298 CITFCVYENLKHRL 311

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 81.3 bits (199), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 82/318 (25%), Positives = 141/318 (44%), Gaps = 58/318 (18%)

Query: 39  VVSPFERVKILLQ---VQSSTTSYNRGI------------------FSSIRQVYHEEGTK 77
           V  PF+ VK  LQ    Q++  S+ + I                  F  I  VY  EG +
Sbjct: 69  VTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFR 128

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSV 137
            LF+G G N + + P  ++ F  Y    K+++    NNGQE +     L + A  G  + 
Sbjct: 129 SLFKGLGPNLVGVIPARSINFFTY-GTTKEIYSKTLNNGQEAV--WIHLMAAATAGWATS 185

Query: 138 VATYPLDLIKTRLSIQTANLSSLNRSK---AKSISKPPGIWQLLSETXXXXXXXXXXXXX 194
            AT P+ L+KTRL +  A  +   ++     K++ +  GI  L                 
Sbjct: 186 TATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSA----------- 234

Query: 195 VWPTSLGVVPYVALNFAVYEQLR---------EFGVNSSDAQPSWKSNLYKLTIGAISGG 245
              + LG V  + L + +YEQ++         +FG N S+ + S    + +    + S G
Sbjct: 235 ---SYLGSVEGI-LQWVLYEQMKHIIKQRSMEKFG-NISEVEKSTSDKIKEWCQRSGSAG 289

Query: 246 ----VAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAAN 301
               VA  ITYP +++R R +   +   +L  +YT +  ++  I + EG++  Y GL  +
Sbjct: 290 LAKFVASIITYPHEVVRTRLRQAPLENGKL--KYTGLVQSIRVIIKEEGLASMYGGLTPH 347

Query: 302 LFKVVPSTAVSWLVYEVV 319
           L + VP++ + +  +E+V
Sbjct: 348 LLRTVPNSIIMFGTWELV 365

>Scas_582.7
          Length = 329

 Score = 80.9 bits (198), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 128/299 (42%), Gaps = 33/299 (11%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTS----YNRGIFSSIRQVYHEEGTKGLFR 81
            LAG  AG +  + + P + +K   ++QS+TT      +  I   I ++   EG+  L++
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKT--RIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWK 97

Query: 82  GNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATY 141
           G     +   P  AV F  YE  K    H+  ++ +E     +   SGA     S     
Sbjct: 98  GVQSVILGAGPAHAVYFATYEFTKA---HLIPDSQRETHQPIKVAVSGATATVASDFFMN 154

Query: 142 PLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLG 201
           P D IK R+ I     S L + K  +++K   I+ L   +              +PT++ 
Sbjct: 155 PFDTIKQRMQI-----SDLKKEKVYNVAK--KIYNLEGLSAFYYS---------YPTTIA 198

Query: 202 V-VPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRR 260
           + +P+ A NF +YE   +F        P     L     G ISG +A  +T P D ++  
Sbjct: 199 MNIPFAAFNFMIYESASKFFNPLHHYNP-----LIHCLCGGISGAIAAAVTTPLDCIKTV 253

Query: 261 FQVL--AMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
            Q+   ++   E+  +  +   A   I    G  G+++GL   +   +P+TA+SW  YE
Sbjct: 254 IQIRGSSVVSLEVMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYE 312

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/196 (22%), Positives = 78/196 (39%), Gaps = 21/196 (10%)

Query: 123 TQRLFSGALCGGCSVVATYPLDLIKTRL-SIQTANLSSLNRSKAKSISKPPGIWQLLSET 181
           + +L +GA  G       +P+D +KTR+ S  T      + S  K ISK   +   L+  
Sbjct: 37  SHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLA-- 94

Query: 182 XXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGA 241
                        V    LG  P  A+ FA YE  +   +   D+Q      +     GA
Sbjct: 95  ---------LWKGVQSVILGAGPAHAVYFATYEFTKAHLI--PDSQRETHQPIKVAVSGA 143

Query: 242 ISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAAN 301
            +   +     PFD +++R Q+  +       +   V++    I   EG+S +Y      
Sbjct: 144 TATVASDFFMNPFDTIKQRMQISDL-------KKEKVYNVAKKIYNLEGLSAFYYSYPTT 196

Query: 302 LFKVVPSTAVSWLVYE 317
           +   +P  A ++++YE
Sbjct: 197 IAMNIPFAAFNFMIYE 212

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 48/96 (50%), Gaps = 14/96 (14%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSST----------TSYNRGIFSSIRQVYHE 73
           I  L GG++GA++  V +P + +K ++Q++ S+           ++ +   S+I  VY  
Sbjct: 228 IHCLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVVSLEVMKKANTFKKAT-SAILMVY-- 284

Query: 74  EGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLF 109
            G KG +RG     +   P +A+ +  YE  K  LF
Sbjct: 285 -GWKGFWRGLQPRILANMPATAISWTAYECAKHFLF 319

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 42/93 (45%), Gaps = 2/93 (2%)

Query: 225 DAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVT 284
           +A P+     ++L  GA +G +  +  +P D L+ R Q     G E     TS+   +  
Sbjct: 28  EALPAHAPLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQ--TSTSIIKQISK 85

Query: 285 IGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
           I   EG    +KG+ + +    P+ AV +  YE
Sbjct: 86  ISTMEGSLALWKGVQSVILGAGPAHAVYFATYE 118

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 80.9 bits (198), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 83/334 (24%), Positives = 138/334 (41%), Gaps = 52/334 (15%)

Query: 7   VLEQP---NSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQV--QSSTTSYNR 61
           V +QP   N +      +  +  +AGG AG        P + +K+ +Q+  +++  +   
Sbjct: 39  VCQQPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPP 98

Query: 62  GIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLT 121
           G   +   +Y  EG    ++G G   I I P  A++F  YE  +  L      + Q  + 
Sbjct: 99  GFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLL-----ADRQTGVV 153

Query: 122 NTQRLFSGALCGGCS--VVATYPLDLIKTRLSIQTANLSSLNRSKAKSIS------KPPG 173
           +T   F   +  G +  V+   P++++K RL  Q  + ++  +    +I       K  G
Sbjct: 154 STGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEG 213

Query: 174 IWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVY----EQLREFGVNSSDAQPS 229
           I  L                    T+ G       NF VY    E+L+E+  + S   PS
Sbjct: 214 IGALYRGVSLTAARQA--------TNQGA------NFTVYSKLMERLQEY--HGSQNLPS 257

Query: 230 WKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGR-- 287
           W+++L    IG +SG +      P D ++ R Q       +   R  S W  + TIGR  
Sbjct: 258 WETSL----IGLVSGAIGPFSNAPLDTIKTRLQ------KDKSTRNLSNWVRITTIGRQL 307

Query: 288 --AEGVSGYYKGLAANLFKVVPSTAVSWLVYEVV 319
              EG    YKG+   + +V P  AV++ VYE V
Sbjct: 308 VQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFV 341

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 80/198 (40%), Gaps = 18/198 (9%)

Query: 26  FLAGGVAGAVSRT-VVSPFERVKILLQVQ----SSTTSYNRGIFSSIRQVYHEEGTKGLF 80
           FLAG  AG      VV+P E VKI LQ Q    ++     R    +   +  EEG   L+
Sbjct: 159 FLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALY 218

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
           RG  L   R        F VY    ++L   +G+   + L + +    G + G     + 
Sbjct: 219 RGVSLTAARQATNQGANFTVYSKLMERLQEYHGS---QNLPSWETSLIGLVSGAIGPFSN 275

Query: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSL 200
            PLD IKTRL    +  +  N  +  +I +     QL+ E              + P  +
Sbjct: 276 APLDTIKTRLQKDKSTRNLSNWVRITTIGR-----QLVQEE-----GFRALYKGITPRVM 325

Query: 201 GVVPYVALNFAVYEQLRE 218
            V P  A+ F VYE +R 
Sbjct: 326 RVAPGQAVTFTVYEFVRR 343

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 46/84 (54%), Gaps = 2/84 (2%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGI-FSSI-RQVYHEEGTKGLFRGNG 84
           L G V+GA+     +P + +K  LQ   ST + +  +  ++I RQ+  EEG + L++G  
Sbjct: 262 LIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGIT 321

Query: 85  LNCIRIFPYSAVQFVVYEACKKKL 108
              +R+ P  AV F VYE  ++ L
Sbjct: 322 PRVMRVAPGQAVTFTVYEFVRRHL 345

>Kwal_47.18216
          Length = 333

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 81/328 (24%), Positives = 131/328 (39%), Gaps = 49/328 (14%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN---RGIFSSIRQVYHEEGTKGLF 80
           I  +AGG AG        P + +K+ +Q+ S         RG   + R +  +EG   L+
Sbjct: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCS--VV 138
           +G G   I I P  A++F  YE      F     + Q  + +T   F   +  G +  V+
Sbjct: 72  KGLGAVVIGIIPKMAIRFTSYE-----FFRTLLADRQTGVVSTGNTFVAGVGAGITEAVM 126

Query: 139 ATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVW-- 196
              P++++K RL  Q      L    A S++     +   +               +   
Sbjct: 127 VVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAA 186

Query: 197 --------PTSL--GVVPYVA-------LNFAVYE----QLREFGVNSSDAQPSWKSNLY 235
                   P +L  GV    A        NF VY     +L+E+  + +D  PSW+++L 
Sbjct: 187 YVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEY--HQTDMLPSWETSL- 243

Query: 236 KLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGR----AEGV 291
              IG ISG +      P D ++ R Q       + G      W  ++ IGR     EG 
Sbjct: 244 ---IGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSG------WSRILAIGRQLIREEGF 294

Query: 292 SGYYKGLAANLFKVVPSTAVSWLVYEVV 319
              YKG+   + +V P  AV++ VYE++
Sbjct: 295 RALYKGITPRVMRVAPGQAVTFTVYELI 322

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 4/85 (4%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRG---IFSSIRQVYHEEGTKGLFRGN 83
           L G ++GA+     +P + +K  LQ +  +TS + G   I +  RQ+  EEG + L++G 
Sbjct: 243 LIGLISGALGPFSNAPLDTIKTRLQ-KDKSTSKDSGWSRILAIGRQLIREEGFRALYKGI 301

Query: 84  GLNCIRIFPYSAVQFVVYEACKKKL 108
               +R+ P  AV F VYE  +KKL
Sbjct: 302 TPRVMRVAPGQAVTFTVYELIRKKL 326

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 81/230 (35%), Gaps = 54/230 (23%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQS----------------------------- 54
           +A +  G+  AV   VV+P E VKI LQ Q                              
Sbjct: 114 VAGVGAGITEAV--MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATE 171

Query: 55  --STTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKL--FH 110
             + T   R    +   +  EEG + L+RG  L   R        F VY   K +L  +H
Sbjct: 172 NVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYH 231

Query: 111 VNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISK 170
                  + L + +    G + G     +  PLD IKTRL             K KS SK
Sbjct: 232 QT-----DMLPSWETSLIGLISGALGPFSNAPLDTIKTRL------------QKDKSTSK 274

Query: 171 PPGIWQLLS--ETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLRE 218
             G  ++L+                 + P  + V P  A+ F VYE +R+
Sbjct: 275 DSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRK 324

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/313 (24%), Positives = 133/313 (42%), Gaps = 40/313 (12%)

Query: 14  IKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHE 73
           + D      +IA+  G VAGA+ + +  PF+ VK+ LQ Q +        +S IR  Y +
Sbjct: 1   MSDLESALKDIAY--GSVAGAIGKVIEYPFDTVKVRLQTQPA--HLYPTTWSCIRSTYTD 56

Query: 74  EGT-KGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTN----TQRLFS 128
           EG  KG ++G           +AV FV +  C          N  ++ T     T+ ++S
Sbjct: 57  EGIWKGFYQGIASPLFGAALENAVLFVSFNQC---------TNFLDEFTQLKPLTKTIYS 107

Query: 129 GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXX 188
           GA  G C+     P++L+K +L  Q +N+S+      +  S  P I  ++ E        
Sbjct: 108 GAFAGACASFILTPVELVKCKL--QVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQ 165

Query: 189 XXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSN-LYKLTIGAISGGVA 247
                 V     G     A+ F  YE ++   +  +   P+ K N  ++L +   S GV 
Sbjct: 166 GQLSTFVRECLGG-----AVWFTTYEIMK---MKFASLHPAEKENHTWELLVSGASAGVL 217

Query: 248 -QTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVV 306
                +P D ++   Q            + S+ +AL  + R  G++G+Y+GL   L +  
Sbjct: 218 FNASVFPADTVKSVCQT----------EHVSIVNALKKVLRTHGITGFYRGLGITLIRAA 267

Query: 307 PSTAVSWLVYEVV 319
           P+ A  +  YE +
Sbjct: 268 PANATVFYTYETL 280

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 6/81 (7%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85
            ++G  AG +    V P + VK + Q +      +  I +++++V    G  G +RG G+
Sbjct: 208 LVSGASAGVLFNASVFPADTVKSVCQTE------HVSIVNALKKVLRTHGITGFYRGLGI 261

Query: 86  NCIRIFPYSAVQFVVYEACKK 106
             IR  P +A  F  YE  KK
Sbjct: 262 TLIRAAPANATVFYTYETLKK 282

>Scas_721.27
          Length = 374

 Score = 79.7 bits (195), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 82/321 (25%), Positives = 139/321 (43%), Gaps = 60/321 (18%)

Query: 39  VVSPFERVKILLQ-----------VQSSTTSYNRGIFSSIRQ--------------VYHE 73
           V  PF+ VK  LQ             + T ++N  I +S+ Q              VY  
Sbjct: 69  VTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYKR 128

Query: 74  EGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCG 133
           EG + LF+G G N + + P  ++ F  Y    K+++    NNGQE  T    L S A  G
Sbjct: 129 EGFRSLFKGLGPNLVGVIPARSINFFTY-GTTKEIYSKAFNNGQE--TPLIHLMSAATAG 185

Query: 134 GCSVVATYPLDLIKTRLSIQTANLSSLNRSK---AKSISKPPGIWQLLSETXXXXXXXXX 190
             +  AT P+ +IKTR+ +  A  +   ++     K++ K  GI+ L             
Sbjct: 186 WATSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYR----------- 234

Query: 191 XXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAI-------- 242
               +  + LG +  + L + +YEQ++      S  +   +  L K     I        
Sbjct: 235 ---GLSASYLGSIEGI-LQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSG 290

Query: 243 SGGVAQTI----TYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGL 298
           S GVA+ I    TYP +++R R + + M   +   +YT +  +   I + EG++  Y GL
Sbjct: 291 SAGVAKFIASIVTYPHEVVRTRLRQMPMENGKP--KYTGLVQSFRVIIKEEGLASMYSGL 348

Query: 299 AANLFKVVPSTAVSWLVYEVV 319
             +L + VP++ + +  +E+V
Sbjct: 349 TPHLMRTVPNSIIMFGTWELV 369

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 79.0 bits (193), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/334 (23%), Positives = 131/334 (39%), Gaps = 57/334 (17%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQV------------------------------Q 53
           +  +AGG AG        P + +K+ +Q+                               
Sbjct: 13  VNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGD 72

Query: 54  SSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNG 113
           ++      G   + R +Y +EG   L++G G   I I P  A++F  YE  +  L     
Sbjct: 73  ATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLL----- 127

Query: 114 NNGQEQLTNTQRLFSGALCGGCS--VVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKP 171
            + Q  + +T   F   +  G +  V+   P++++K RL  Q  N  + + +K K  +  
Sbjct: 128 ADKQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLN-PNHDLAKPKYTNAV 186

Query: 172 PGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREF--GVNSSDAQPS 229
              + ++ E              V  T+         NF VY +LREF    + ++  PS
Sbjct: 187 QAGYTIIKE-----EGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPS 241

Query: 230 WKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIG--- 286
           W+++     IG ISG +      P D ++ R Q          F+  S W  +  IG   
Sbjct: 242 WETSC----IGLISGAIGPFSNAPLDTIKTRLQ----KDKSTSFKGESGWKRIAHIGTQL 293

Query: 287 -RAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVV 319
            + EG    YKG+   + +V P  AV++ VYE V
Sbjct: 294 LKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFV 327

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 84/201 (41%), Gaps = 19/201 (9%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN--RGIFSSIRQ----VYHEEGTK 77
           IA +  GV  AV   VV+P E VKI LQ Q    +++  +  +++  Q    +  EEG  
Sbjct: 142 IAGVGAGVTEAV--LVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGIS 199

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSV 137
            L+RG  L   R        F VY   ++ L   +G    E L + +    G + G    
Sbjct: 200 ALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGT---ETLPSWETSCIGLISGAIGP 256

Query: 138 VATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWP 197
            +  PLD IKTRL  +  + S    S  K I+      QLL E              + P
Sbjct: 257 FSNAPLDTIKTRLQ-KDKSTSFKGESGWKRIAHIG--TQLLKE-----EGFRALYKGITP 308

Query: 198 TSLGVVPYVALNFAVYEQLRE 218
             + V P  A+ F VYE +R 
Sbjct: 309 RVMRVAPGQAVTFTVYEFVRR 329

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 4/84 (4%)

Query: 29  GGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSI----RQVYHEEGTKGLFRGNG 84
           G ++GA+     +P + +K  LQ   ST+      +  I     Q+  EEG + L++G  
Sbjct: 248 GLISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGIT 307

Query: 85  LNCIRIFPYSAVQFVVYEACKKKL 108
              +R+ P  AV F VYE  ++ L
Sbjct: 308 PRVMRVAPGQAVTFTVYEFVRRHL 331

>Kwal_26.8669
          Length = 296

 Score = 77.8 bits (190), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 122/301 (40%), Gaps = 30/301 (9%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSS--TTSYNRGIFSSIRQVYHEEGTKGLFRGN 83
           F AG VAG     V+ P + VK  +Q+Q S       +G+   I+Q+  +EG   L++G 
Sbjct: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72

Query: 84  GLNCIRIFPYSAVQFVVYEACKKKLFHVNGNN-GQEQLTNTQRLFSGALCGGCSVVATYP 142
               +   P  A +F    AC  +   +     G E+LT +  + SGA  G C      P
Sbjct: 73  SSPVLMEAPKRATKF----ACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVP 128

Query: 143 LDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGV 202
            +L+K RL     ++SS       S   P  + + +                +W   +  
Sbjct: 129 FELVKIRLQ----DVSS-------SYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWN 177

Query: 203 VPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQ 262
             Y  + F V   L E       A+   +     L  G+I G +   ++ PFD+++ R Q
Sbjct: 178 AGYFGIIFQVRALLPE-------AKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQ 230

Query: 263 VLAM--GGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVC 320
             A+  GG     +Y   W ++ TI + EG    YKG    + ++ P   +  +V+    
Sbjct: 231 NTAVVAGGAR---KYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCM 287

Query: 321 D 321
           D
Sbjct: 288 D 288

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 4/90 (4%)

Query: 224 SDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALV 283
           +DA+P      Y+   GA++G     + YP D+++ R Q+   GG  LG +Y  V D + 
Sbjct: 2   TDARPL--PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGG--LGPQYKGVVDCIK 57

Query: 284 TIGRAEGVSGYYKGLAANLFKVVPSTAVSW 313
            I   EG S  YKG+++ +    P  A  +
Sbjct: 58  QIVAKEGASRLYKGISSPVLMEAPKRATKF 87

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 61/132 (46%), Gaps = 7/132 (5%)

Query: 19  KQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKG 78
           K   +++ L+G  AG     VV PFE VKI LQ  SS+    +G    +R++  +EG   
Sbjct: 105 KLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSY---KGPIDVVRKIIAQEGVLA 161

Query: 79  LFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVV 138
           ++ G      R   ++A  F +    +  L      + Q +      L +G++ G    +
Sbjct: 162 MYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTR----NDLIAGSIGGTIGSL 217

Query: 139 ATYPLDLIKTRL 150
            + P D++K+R+
Sbjct: 218 MSTPFDVVKSRI 229

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 20  QDSNIAFLAGGVAGAVSRTVVSPFERVKILLQ----VQSSTTSYNRGIFSSIRQVYHEEG 75
           Q +    +AG + G +   + +PF+ VK  +Q    V      YN   + SI  +Y EEG
Sbjct: 199 QQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWS-WPSIFTIYKEEG 257

Query: 76  TKGLFRGNGLNCIRIFPYSAVQFVVYEAC 104
            + L++G     +R+ P   +  VV+  C
Sbjct: 258 FRALYKGFVPKVLRLGPGGGILLVVFTGC 286

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 77.0 bits (188), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 78/301 (25%), Positives = 134/301 (44%), Gaps = 40/301 (13%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQ--VQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNG 84
           ++G  AG+V+  +V P +  K+ LQ  + S+T    R ++S I        T+ L+RG  
Sbjct: 13  ISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGS-DLSLTRELYRGLT 71

Query: 85  LNCIRIFPYSAVQFVVYEACKKKLFHVNGN-NGQEQLTNTQRLFSGALCGGCSVVATYPL 143
           +N +       + F  Y   K  L + N      + L++   L + A  G  + V T PL
Sbjct: 72  VNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLTTVLTNPL 131

Query: 144 DLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVV 203
            +IKTR+ +  AN    +    + + K  G+  L                  W    G+V
Sbjct: 132 WVIKTRM-MSKANSDLTSMKVLRDLIKNDGVQGL------------------WK---GLV 169

Query: 204 PYV------ALNFAVYEQLR-EFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDL 256
           P +      AL+F  Y+ L+ +  + + D+     +NL  + + ++S  ++ +  YPF L
Sbjct: 170 PALVGVSQGALHFTCYDTLKHKLVLKNRDSDEI--TNLETIAVTSVSKMLSTSAVYPFQL 227

Query: 257 LRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVY 316
           L+   Q      N+      S       I    G+ G+YKGL+ANL + VPST +++ +Y
Sbjct: 228 LKSNLQSFQASENDFKLLPLSK-----MIYSRSGLLGFYKGLSANLLRSVPSTCITFCIY 282

Query: 317 E 317
           E
Sbjct: 283 E 283

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 3/76 (3%)

Query: 31  VAGAVSRTVVSPFERVKILLQ-VQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIR 89
           V+  +S + V PF+ +K  LQ  Q+S   +     S  + +Y   G  G ++G   N +R
Sbjct: 213 VSKMLSTSAVYPFQLLKSNLQSFQASENDFKLLPLS--KMIYSRSGLLGFYKGLSANLLR 270

Query: 90  IFPYSAVQFVVYEACK 105
             P + + F +YE  K
Sbjct: 271 SVPSTCITFCIYENFK 286

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 77.0 bits (188), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 125/278 (44%), Gaps = 24/278 (8%)

Query: 50  LQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLF 109
           L  ++S+  +N G   +  ++   EG   L+RG  L  +   P + V F  YE  +    
Sbjct: 93  LHCKNSSLKFN-GTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIR---- 147

Query: 110 HVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSIS 169
             + +           LF GA+    +  +  PL+L+KT+L        S+ RS +KS  
Sbjct: 148 --DVSPIASTYPTLNPLFCGAIARVFAATSIAPLELVKTKLQ-------SIPRS-SKSTK 197

Query: 170 KPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGV---VPYVALNFAVYEQLRE-FGVNSS- 224
               +  LL+ET                  + +   VP+ A+ ++ YE  +E   ++S+ 
Sbjct: 198 TWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTR 257

Query: 225 --DAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNEL--GFRYTSVWD 280
                 +W   +     G ISG +A   T+PFD+ + R+Q+  M  ++   G R  +++ 
Sbjct: 258 FASKDANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFK 317

Query: 281 ALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318
            L TI R EG++  Y GLAA + K+ PS A+    YE+
Sbjct: 318 FLETIWRTEGLAALYTGLAARVIKIRPSCAIMISSYEI 355

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 261 FQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVC 320
           FQ L    + L F  T   +A   I   EG++  ++G++  L   +P+  V +  YE + 
Sbjct: 90  FQELHCKNSSLKFNGT--LEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIR 147

Query: 321 D 321
           D
Sbjct: 148 D 148

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 79/317 (24%), Positives = 130/317 (41%), Gaps = 56/317 (17%)

Query: 39  VVSPFERVKILLQVQSSTTSYN----------------------RGIFSSIRQVYHEEGT 76
           V  PF+ VK  LQ     T Y                       +  F  I  VY +EG 
Sbjct: 67  VTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGF 126

Query: 77  KGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCS 136
           + LF+G G N + + P  ++ F+ Y    K ++    NNGQE       L + A  G  +
Sbjct: 127 RSLFKGLGPNLVGVIPARSINFLTY-GTTKDIYSRTLNNGQE--APWIHLLAAATAGWAT 183

Query: 137 VVATYPLDLIKTRLSIQTANLSSLNRSKA--KSISKPPGIWQLLSETXXXXXXXXXXXXX 194
              T P+ L+KTRL +  A   +   S    KS+ K  G+  L                 
Sbjct: 184 STVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSA----------- 232

Query: 195 VWPTSLGVVPYVALNFAVYEQLR---------EFGVNSSDAQPSW---KSNLYKLTIGAI 242
              + LG V  + L + +YEQ++         +FG    DA+ +    K    +     +
Sbjct: 233 ---SYLGSVEGI-LQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGL 288

Query: 243 SGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANL 302
           +  VA  +TYP +++R R +       +L  +YT +  +   I + EG+   Y GL  +L
Sbjct: 289 AKFVASIVTYPHEVVRTRLRQAPTENGKL--KYTGLVQSFRVIIKEEGLVSMYSGLTPHL 346

Query: 303 FKVVPSTAVSWLVYEVV 319
            + VP++ + +  +E+V
Sbjct: 347 LRTVPNSIIMFGTWELV 363

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 62/138 (44%), Gaps = 12/138 (8%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGN 83
           I  LA   AG  + TV +P   VK  LQ+  + T   +     I+ V   EG  GL++G 
Sbjct: 171 IHLLAAATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGL 230

Query: 84  GLNCIRIFPYSAVQFVVYEACKKKL----------FHVNGNNGQEQLTN-TQRLFSGALC 132
             + +       +Q+++YE  K+ +           H +  +  +++    QR  S  L 
Sbjct: 231 SASYLGSVE-GILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLA 289

Query: 133 GGCSVVATYPLDLIKTRL 150
              + + TYP ++++TRL
Sbjct: 290 KFVASIVTYPHEVVRTRL 307

 Score = 35.4 bits (80), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 40/90 (44%), Gaps = 18/90 (20%)

Query: 250 ITYPFDLLRRRFQV---------LAM---GGNELGFRYTSVWDALVTIG------RAEGV 291
           +T PFD+++ R Q           AM   G + L F   S+     T G      R EG 
Sbjct: 67  VTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGF 126

Query: 292 SGYYKGLAANLFKVVPSTAVSWLVYEVVCD 321
              +KGL  NL  V+P+ ++++L Y    D
Sbjct: 127 RSLFKGLGPNLVGVIPARSINFLTYGTTKD 156

>Scas_667.22
          Length = 306

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 78/335 (23%), Positives = 142/335 (42%), Gaps = 52/335 (15%)

Query: 1   MAEVLTVLEQPNSIKDFLKQDSN--IAFLAGGVAGAVSRTVVS-PFERVKILLQVQSSTT 57
           M+E     +  + +++  K D+   I  L  G AG +++ +V  PF+  K+ LQ  S+ T
Sbjct: 1   MSEEFPTPQLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT 60

Query: 58  SYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQ 117
           +        IR++   EG KG ++G     I +    ++QF V EA  K+ FH    +  
Sbjct: 61  T----AMEVIRKLLKNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAM-KRFFHSRNPDST 115

Query: 118 EQLTNTQRLFSGALCGGC--SVVATYPLDLIKTRLSIQTAN---------LSSLNRSKAK 166
            Q+ +  + +   L GG   S +A+ P++ ++ RL  QT +         L  + + +A+
Sbjct: 116 SQILSLPQYYICGLTGGITNSFLAS-PIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQ 174

Query: 167 SISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDA 226
                 G  + L+                 PT L         F VYE +    +N    
Sbjct: 175 G-----GFMRGLT-----------------PTMLREGHGCGTYFLVYEAMVANEINKGFK 212

Query: 227 Q---PSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALV 283
           +   P+WK  L+    GA+SG     + YP D+++   Q   +   + G   +SV   L 
Sbjct: 213 RTEVPAWKLCLF----GALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLY 268

Query: 284 TIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318
             G   G+  ++KG    + +  P+   ++  +E+
Sbjct: 269 AKG---GLGAFFKGFGPTMLRAAPANGATFATFEL 300

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 37/83 (44%), Gaps = 1/83 (1%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQS-STTSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85
           L G ++G     +V P + +K ++Q  +  +  Y   I S  + +Y + G    F+G G 
Sbjct: 223 LFGALSGTTLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKGFGP 282

Query: 86  NCIRIFPYSAVQFVVYEACKKKL 108
             +R  P +   F  +E   + L
Sbjct: 283 TMLRAAPANGATFATFELAMRLL 305

>Kwal_27.12081
          Length = 369

 Score = 75.9 bits (185), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 138/315 (43%), Gaps = 55/315 (17%)

Query: 39  VVSPFERVKILLQ------------------VQSSTTSYNRGIFSSIRQVYHEEGTKGLF 80
           V  PF+ VK  LQ                  V SS   + R  F  I  +Y  EG + LF
Sbjct: 69  VTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSLF 128

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
           +G G N + + P  ++ F  Y    K+++    NNG+E       L S A  G  +  AT
Sbjct: 129 KGLGPNLVGVIPARSINFFTY-GTTKQIYSRAFNNGEE--APWIHLISAATAGWATSTAT 185

Query: 141 YPLDLIKTRLSIQTANLSSLNRSK---AKSISKPPGIWQLLSETXXXXXXXXXXXXXVWP 197
            P+ LIKTRL +  A  +   ++     K I +  G + L                    
Sbjct: 186 NPIWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSA-------------- 231

Query: 198 TSLGVVPYVALNFAVYEQLRE---------FGVNSSDAQPSWKSNLYKLTIGAISGGVAQ 248
           + LG V  + L + +YEQ+++         FG + S+ + +    + +    + S G+A+
Sbjct: 232 SYLGSVEGI-LQWLLYEQMKQMIKMRSIEKFG-HISEGEKNTSEKIKEWCQRSGSAGLAK 289

Query: 249 ----TITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFK 304
                +TYP +++R R +   +  ++L  +YT +  +   I + EG++  Y GL  +L +
Sbjct: 290 FLASIVTYPHEVVRTRLRQAPLENDKL--KYTGLIQSFRVIIKEEGLASMYGGLTPHLLR 347

Query: 305 VVPSTAVSWLVYEVV 319
            VP++ + +  +E+V
Sbjct: 348 TVPNSIIMFGTWELV 362

>Scas_640.25
          Length = 306

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 125/305 (40%), Gaps = 33/305 (10%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSST------TSYNRGIFSSIRQVYHEEGTKGL 79
           F+AG +AG     V+ P + VK  +Q+Q ST       ++ +G+   + Q+  +EG   +
Sbjct: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76

Query: 80  FRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVA 139
           ++G     +   P  AV+F   +   K    V G    +QLT    + SGA  G    + 
Sbjct: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGT---KQLTQQISVLSGASAGITEALV 133

Query: 140 TYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTS 199
             P +L+K RL    +          K I K  G+  L S               VW  +
Sbjct: 134 IVPFELVKIRLQDVNSKFKG-PVEVLKHIIKQDGLKGLYSGVEST----------VWRNA 182

Query: 200 LGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRR 259
           +    Y    F V  Q+RE    +   Q   +++L     G + G        PFD+++ 
Sbjct: 183 VWNAGY----FGVIFQVRELLPVAKSKQEKTRNDL---CAGFVGGTFGVMFNTPFDVVKS 235

Query: 260 RFQVLAMGGNEL--GFR-YTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVY 316
           R Q     GNE+  G R Y   W +++ I   EG    YKG    + ++ P  AV  +V+
Sbjct: 236 RIQ---SDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292

Query: 317 EVVCD 321
             V +
Sbjct: 293 TNVMN 297

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 64/129 (49%), Gaps = 9/129 (6%)

Query: 23  NIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRG 82
            I+ L+G  AG     V+ PFE VKI LQ      S  +G    ++ +  ++G KGL+ G
Sbjct: 117 QISVLSGASAGITEALVIVPFELVKIRLQ---DVNSKFKGPVEVLKHIIKQDGLKGLYSG 173

Query: 83  NGLNCIRIFPYSAVQF-VVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATY 141
                 R   ++A  F V+++   ++L  V   + QE+  N   L +G + G   V+   
Sbjct: 174 VESTVWRNAVWNAGYFGVIFQV--RELLPV-AKSKQEKTRND--LCAGFVGGTFGVMFNT 228

Query: 142 PLDLIKTRL 150
           P D++K+R+
Sbjct: 229 PFDVVKSRI 237

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 81/196 (41%), Gaps = 25/196 (12%)

Query: 114 NNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPG 173
           +N Q  L    +  +GA+ G   ++  YPLD++KTR+ +Q +  ++       S +   G
Sbjct: 5   HNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAA-----GASATHYKG 59

Query: 174 IWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLRE-----FGVNSSDAQP 228
           +   LS+                P  L   P  A+ FA  ++  +     FG      Q 
Sbjct: 60  VIDCLSQIVKKEGPMHMYKGISSPM-LMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQI 118

Query: 229 SWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRA 288
           S  S       GA +G     +  PF+L++ R Q       ++  ++    + L  I + 
Sbjct: 119 SVLS-------GASAGITEALVIVPFELVKIRLQ-------DVNSKFKGPVEVLKHIIKQ 164

Query: 289 EGVSGYYKGLAANLFK 304
           +G+ G Y G+ + +++
Sbjct: 165 DGLKGLYSGVESTVWR 180

>Scas_669.6
          Length = 373

 Score = 75.1 bits (183), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 84/158 (53%), Gaps = 9/158 (5%)

Query: 21  DSNIAFLAGGVAGA-VSRTVVSPFERVKILLQVQSST------TSYN-RGIFSSIRQVYH 72
           +  ++ L+ G+ G  VS  V  P E +K  LQ+Q         + YN R + ++IR + +
Sbjct: 144 NDTVSHLSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVN 203

Query: 73  EEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNN-GQEQLTNTQRLFSGAL 131
            EG K LF G      R  P+SA+QF  YE  ++  F +   +  +  L+    +F+GA+
Sbjct: 204 TEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLEKKDITKHNLSIPNEIFTGAI 263

Query: 132 CGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSIS 169
            GG + + T P+D+IKTRL  Q A+++  + +   +IS
Sbjct: 264 AGGLAGIITTPMDVIKTRLQTQQADINPNSATTVGAIS 301

 Score = 59.3 bits (142), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 121/308 (39%), Gaps = 52/308 (16%)

Query: 43  FERVKILLQVQSSTTSYNRGIFSSIRQVYHEEG-TKGLFRGNGLNCIRIFPYSAVQFVVY 101
            + VK   Q    T  Y + + ++ R ++ EEG  +GL+ G     +  FP +A+ F  Y
Sbjct: 72  LDTVKTRQQGAPMTPKY-KNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFGTY 130

Query: 102 EACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTA------ 155
           E CK+K+    G N          L +G L    S     P +++KTRL +Q        
Sbjct: 131 EWCKRKMIGDLGFN-----DTVSHLSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFF 185

Query: 156 ----NLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFA 211
               N  SL R+  + I    G+  L                         +P+ AL F 
Sbjct: 186 QSGYNYRSL-RTAIRIIVNTEGVKALFFGYKATLARD--------------LPFSALQFG 230

Query: 212 VYEQLRE--FGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGN 269
            YE+ R+  F +   D      S   ++  GAI+GG+A  IT P D+++ R Q      N
Sbjct: 231 FYEKFRQTAFKLEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADIN 290

Query: 270 ELG------------------FRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAV 311
                                    S++ +L  + ++EGV G++ G+          +++
Sbjct: 291 PNSATTVGAISAKTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFVWTSVQSSI 350

Query: 312 SWLVYEVV 319
             L+Y++ 
Sbjct: 351 MLLLYQMT 358

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 47/118 (39%), Gaps = 24/118 (20%)

Query: 15  KDFLKQDSNIA--FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRG---------- 62
           KD  K + +I      G +AG ++  + +P + +K  LQ Q +  + N            
Sbjct: 245 KDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADINPNSATTVGAISAKT 304

Query: 63  ------------IFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKL 108
                       IF S++ VY  EG  G F G G   +     S++  ++Y+   + L
Sbjct: 305 NKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFVWTSVQSSIMLLLYQMTLRLL 362

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 74.3 bits (181), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 77/301 (25%), Positives = 123/301 (40%), Gaps = 37/301 (12%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQ-VQSSTTSYNRGIFSS-IRQ---VYHEEGTKGLFR 81
           +AG  AG    +V+ P + +K  LQ + + +T+  + I S+ +RQ   +  +EG+  L++
Sbjct: 23  MAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSMVLWK 82

Query: 82  GNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATY 141
           G     +   P  AV F  YE  K  L     +  +     T   FSGA     +     
Sbjct: 83  GVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTA--FSGATATIAADALMN 140

Query: 142 PLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLG 201
           P D+IK R+ + T N+S  +   AK I    G     S                +PT+L 
Sbjct: 141 PFDVIKQRIQLNT-NISVWD--TAKRIYSKEGFQAFYSS---------------YPTTLA 182

Query: 202 V-VPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRR 260
           + +P+ A NF +Y+    +   S    P           G ISG     +T P D ++  
Sbjct: 183 INIPFAAFNFGIYDTATRYFNPSGVYNP-----FIHCLCGGISGAACAGLTTPLDCIKTA 237

Query: 261 FQVLAMGGNELGFRYTSVWDALVTIGRA----EGVSGYYKGLAANLFKVVPSTAVSWLVY 316
            QV   G  ++        D      RA     G  G++ G+   +   +P+TA+SW  Y
Sbjct: 238 LQV--RGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWTAY 295

Query: 317 E 317
           E
Sbjct: 296 E 296

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 84/195 (43%), Gaps = 19/195 (9%)

Query: 124 QRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXX 183
            +L +GA  G       +PLD +KTRL      + +++ +  + I  P  + + LS +  
Sbjct: 20  HQLMAGAFAGIAEHSVIFPLDALKTRLQ----AMHAISTTGGQPI--PSTMLRQLS-SIS 72

Query: 184 XXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTI-GAI 242
                      V    LG  P  A+ FA YE ++ F ++  +A  + K + +K    GA 
Sbjct: 73  AQEGSMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLID--EATSTSKYHFFKTAFSGAT 130

Query: 243 SGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANL 302
           +   A  +  PFD++++R Q   +  N       SVWD    I   EG   +Y      L
Sbjct: 131 ATIAADALMNPFDVIKQRIQ---LNTN------ISVWDTAKRIYSKEGFQAFYSSYPTTL 181

Query: 303 FKVVPSTAVSWLVYE 317
              +P  A ++ +Y+
Sbjct: 182 AINIPFAAFNFGIYD 196

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 8/94 (8%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFS-------SIRQVYHEEGT 76
           I  L GG++GA    + +P + +K  LQV+ S    +  +F        + R +Y   G 
Sbjct: 212 IHCLCGGISGAACAGLTTPLDCIKTALQVRGSE-KVSMEVFKQADTFKKATRAIYQVYGW 270

Query: 77  KGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFH 110
           +G + G     +   P +A+ +  YE  K  LFH
Sbjct: 271 RGFWSGVKPRILANMPATAISWTAYEFAKHFLFH 304

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 46/99 (46%), Gaps = 7/99 (7%)

Query: 225 DAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVL----AMGGNELGFRYTSVWD 280
           +A P      ++L  GA +G    ++ +P D L+ R Q +      GG  +    +++  
Sbjct: 10  EALPDHAPLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIP---STMLR 66

Query: 281 ALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVV 319
            L +I   EG    +KG+ + L    P+ AV +  YE+V
Sbjct: 67  QLSSISAQEGSMVLWKGVQSVLLGAGPAHAVYFATYEMV 105

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 86/321 (26%), Positives = 128/321 (39%), Gaps = 68/321 (21%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIF----SSIRQVYHEEGT-KGLFR 81
           L G +AGA+ + +  PF+ VK+ LQ Q       R +F    S I   Y  EG  KG F+
Sbjct: 18  LYGSIAGALGKVIEYPFDTVKVRLQTQ------GRHVFPDTWSCITYTYKNEGIIKGFFQ 71

Query: 82  GNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATY 141
           G           +A  F+ Y  C K L H    +    LTN   L SGA  G C+     
Sbjct: 72  GIASPLAGAAIENAALFLSYNQCSKFLQHYTNVS---DLTNI--LISGAFAGSCASFVLT 126

Query: 142 PLDLIKTRLSIQTANLSSL-------NRSKAKSISKPP------------GIWQLLSETX 182
           P++LIK +L  Q +NL SL       N    +     P            G+WQ  S T 
Sbjct: 127 PVELIKCKL--QVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTF 184

Query: 183 XXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQ----PSWKSNLYKLT 238
                           S G V +    FA YE ++++  +  + +    P+       L 
Sbjct: 185 IR-------------ESFGGVAW----FATYELMKKYLKSRHNIEDPSLPNDNKTWELLA 227

Query: 239 IGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGL 298
            GA +G       +P D ++   Q        LG +      A+  I   +G+ G+Y+GL
Sbjct: 228 SGASAGLAFNASIFPADTVKSMMQT-----EHLGLK-----TAIKKIFVEKGLRGFYRGL 277

Query: 299 AANLFKVVPSTAVSWLVYEVV 319
              L + +P+ A  + VYE +
Sbjct: 278 GITLIRAIPANATVFYVYETL 298

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 50/106 (47%), Gaps = 19/106 (17%)

Query: 14  IKDFLKQDSNIA-------------FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN 60
           +K +LK   NI                +G  AG      + P + VK ++Q +      +
Sbjct: 201 MKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSMMQTE------H 254

Query: 61  RGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKK 106
            G+ ++I++++ E+G +G +RG G+  IR  P +A  F VYE   K
Sbjct: 255 LGLKTAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFYVYETLSK 300

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 71.6 bits (174), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 80/320 (25%), Positives = 128/320 (40%), Gaps = 34/320 (10%)

Query: 8   LEQPNSIKDFL-KQDSNIAF--LAGGVAGAVSRTVVS-PFERVKILLQVQSSTTSYNRGI 63
           L  P  I D     DS   F  L  G AG VS+ ++  PF+  K+ LQ  S  T+     
Sbjct: 5   LPTPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTT----A 60

Query: 64  FSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNG-QEQLTN 122
              ++++   EG +G ++G     + +    +VQF V EA K+     NGN+G  E L  
Sbjct: 61  LDVVKKLVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGL 120

Query: 123 TQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETX 182
            Q    G   G  +     P++ ++ RL  QT          A     P    + L+   
Sbjct: 121 LQYYLCGFAGGTANSFLASPIEHVRIRLQTQTGT------GAAAQFHGPLDCIKKLTAN- 173

Query: 183 XXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQL----REFGVNSSDAQPSWKSNLYKLT 238
                       + PT L       + F  YE L       GV+ S+  P+WK  L+   
Sbjct: 174 ------NSLMRGLTPTMLRESHGCGVYFLTYEALIANELHKGVSRSEI-PTWKLCLF--- 223

Query: 239 IGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGL 298
            GA SG     + YP D+++   Q  ++   + G     V     TI    G+S ++KG 
Sbjct: 224 -GATSGTTLWLMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAK---TIYSTRGLSSFFKGF 279

Query: 299 AANLFKVVPSTAVSWLVYEV 318
              + +  P+   ++  +E+
Sbjct: 280 GPTMLRAAPANGATFATFEL 299

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 72.0 bits (175), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 82/167 (49%), Gaps = 9/167 (5%)

Query: 14  IKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSS------TTSYN-RGIFSS 66
           I D+   D+     AG +    S  V  P E +K  LQ+Q         + YN + + ++
Sbjct: 140 INDYHLNDTFSHLTAGFLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNA 199

Query: 67  IRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNN-GQEQLTNTQR 125
           I  +Y  EG   LF G      R  P+SA+QF  YE  ++  F + G +  +  L+ +  
Sbjct: 200 IATIYRTEGVAALFFGYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNE 259

Query: 126 LFSGALCGGCSVVATYPLDLIKTRLSIQ-TANLSSLNRSKAKSISKP 171
           + +GA  GG + + T PLD++KTR+  Q  + +     +K K++SKP
Sbjct: 260 IVTGACAGGLAGILTTPLDVVKTRVQTQLPSQIDISTDTKIKNVSKP 306

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 107/254 (42%), Gaps = 40/254 (15%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEG-TKGLFRGNG 84
           FLAGGV G +  + +   + VK   Q   +   Y + +  + R ++ EEG  +GL+ G  
Sbjct: 57  FLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHKY-KHMLQAYRTMFIEEGFRRGLYGGYC 115

Query: 85  LNCIRIFPYSAVQFVVYEACKKKL---FHVNGNNGQEQLTNTQRLFSGALCGGCSVVATY 141
              +  FP +A+ F  YE  K+ +   +H+N             L +G L    S     
Sbjct: 116 AAMLGSFPSAAIFFSTYEFTKRTMINDYHLND--------TFSHLTAGFLGDFFSSFVYV 167

Query: 142 PLDLIKTRLSIQTA----------NLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXX 191
           P +++KTRL +Q            N  SL R+   +I +  G+  L              
Sbjct: 168 PSEVLKTRLQLQGCYNNPHFNSGYNYKSL-RNAIATIYRTEGVAALF------------- 213

Query: 192 XXXVWPTSLGVVPYVALNFAVYEQLRE--FGVNSSDAQPSWKSNLYKLTIGAISGGVAQT 249
                 T    +P+ AL FA YE+ R+  F +   D      S   ++  GA +GG+A  
Sbjct: 214 -FGYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGI 272

Query: 250 ITYPFDLLRRRFQV 263
           +T P D+++ R Q 
Sbjct: 273 LTTPLDVVKTRVQT 286

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 57/121 (47%), Gaps = 7/121 (5%)

Query: 200 LGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRR 259
           LG  P  A+ F+ YE  +   +N      ++      LT G +    +  +  P ++L+ 
Sbjct: 119 LGSFPSAAIFFSTYEFTKRTMINDYHLNDTFS----HLTAGFLGDFFSSFVYVPSEVLKT 174

Query: 260 RFQVLAMGGNEL---GFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVY 316
           R Q+     N     G+ Y S+ +A+ TI R EGV+  + G  A L + +P +A+ +  Y
Sbjct: 175 RLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARDLPFSALQFAFY 234

Query: 317 E 317
           E
Sbjct: 235 E 235

 Score = 28.5 bits (62), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 32/78 (41%), Gaps = 18/78 (23%)

Query: 15  KDFLKQDSNIA--FLAGGVAGAVSRTVVSPFERVKILLQVQ----------------SST 56
           KD  K D +I+   + G  AG ++  + +P + VK  +Q Q                S  
Sbjct: 247 KDIYKHDLSISNEIVTGACAGGLAGILTTPLDVVKTRVQTQLPSQIDISTDTKIKNVSKP 306

Query: 57  TSYNRGIFSSIRQVYHEE 74
            +    IF S+R VY  E
Sbjct: 307 VTLTNSIFKSLRTVYTSE 324

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 71.6 bits (174), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 84/166 (50%), Gaps = 11/166 (6%)

Query: 14  IKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSS------TTSYN-RGIFSS 66
           I+D+   D+     AG +   +S  V  P E +K  LQ+Q         + YN   + ++
Sbjct: 140 IEDWQINDTITHLSAGFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNA 199

Query: 67  IRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQE-QLTNTQR 125
           I+ V  EEG + LF G      R  P+SA+QF  YE  ++  F +   +G++ +L+    
Sbjct: 200 IKTVIKEEGFRSLFFGYKATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNE 259

Query: 126 LFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKP 171
           + +GA  GG + + T P+D++KTR+  Q     S   +K+ S++ P
Sbjct: 260 ILTGACAGGLAGIITTPMDVVKTRVQTQQPPSQS---NKSYSVTHP 302

 Score = 68.9 bits (167), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 75/322 (23%), Positives = 134/322 (41%), Gaps = 51/322 (15%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTK-GLFRGNGL 85
           ++GG+ G +  + +   + VK   Q   +   Y R + S+ R ++ EEG + GL+ G   
Sbjct: 58  VSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKY-RNMISAYRTIWLEEGVRRGLYGGYMA 116

Query: 86  NCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNT-QRLFSGALCGGCSVVATYPLD 144
             +  FP +A+ F  YE  K+ +          Q+ +T   L +G L    S     P +
Sbjct: 117 AMLGSFPSAAIFFGTYEYTKRTMIE------DWQINDTITHLSAGFLGDFISSFVYVPSE 170

Query: 145 LIKTRLSIQTA----------NLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXX 194
           ++KTRL +Q            N S+L R+  K++ K  G   L                 
Sbjct: 171 VLKTRLQLQGRFNNPFFQSGYNYSNL-RNAIKTVIKEEGFRSLFFGYKATLARD------ 223

Query: 195 VWPTSLGVVPYVALNFAVYEQLRE--FGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITY 252
                   +P+ AL FA YE+ R+  F +   D +    S   ++  GA +GG+A  IT 
Sbjct: 224 --------LPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIITT 275

Query: 253 PFDLLRRRFQVL---AMGGNELGFRYTSVWD------------ALVTIGRAEGVSGYYKG 297
           P D+++ R Q     +         +  V +            +L T+ ++EGV G++ G
Sbjct: 276 PMDVVKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSG 335

Query: 298 LAANLFKVVPSTAVSWLVYEVV 319
           +          +++  L+Y++ 
Sbjct: 336 VGPRFVWTSVQSSIMLLLYQMT 357

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 70.9 bits (172), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 130/297 (43%), Gaps = 36/297 (12%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGT-KGLFRGNGL 85
           L G +AGAV + +  PF+ VK+ LQ Q +        +S I+  Y  EG  +G ++G G 
Sbjct: 11  LYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPT--TWSCIKFTYDNEGLWRGFYQGIGS 68

Query: 86  NCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTN--TQRLFSGALCGGCSVVATYPL 143
                   +AV FV +   K+ L         E L +  ++ +++GA  G C+     P+
Sbjct: 69  PLAGAALENAVLFVSFNQAKRLL-------DVESLLSPLSKTVWAGAFAGACASFVLTPV 121

Query: 144 DLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVV 203
           +LIK +L  Q +NLS+   S  K +   P I  +LSE              +  +  G  
Sbjct: 122 ELIKCKL--QVSNLSTTKTSHTKIL---PTIKSVLSERGFLGLWQGQSGTFIRESGGG-- 174

Query: 204 PYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTIT-YPFDLLRRRFQ 262
              A  F  YE ++ +  +   A+   ++  ++L     S G+A   + +P D ++   Q
Sbjct: 175 ---AAWFTTYEVVKNYLASRRQAE---QNTTWELLASGASAGLAFNASIFPADTIKSTMQ 228

Query: 263 VLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVV 319
                       +  +  A   I   +G++G+Y+GL   L + VP+ A  +  YE +
Sbjct: 229 T----------DHIDLSSATRKIYARQGIAGFYRGLGITLIRAVPANAAIFYTYETL 275

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 7/85 (8%)

Query: 19  KQDSNIAFLAGGV-AGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTK 77
           +Q++    LA G  AG      + P + +K  +Q      S      S+ R++Y  +G  
Sbjct: 195 EQNTTWELLASGASAGLAFNASIFPADTIKSTMQTDHIDLS------SATRKIYARQGIA 248

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYE 102
           G +RG G+  IR  P +A  F  YE
Sbjct: 249 GFYRGLGITLIRAVPANAAIFYTYE 273

>Scas_589.10
          Length = 316

 Score = 71.2 bits (173), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 68/314 (21%), Positives = 134/314 (42%), Gaps = 33/314 (10%)

Query: 15  KDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSY------------NRG 62
           KD +K      F++G VAG     ++ P + VK   Q+Q +  +             +  
Sbjct: 6   KDPVKLPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSS 65

Query: 63  IFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTN 122
           I S + ++  EEG K L++G     +   P  AV+F   E  ++ +         +++T+
Sbjct: 66  ILSCLSKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMK---KFKLKEVTS 122

Query: 123 TQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETX 182
           T  L +G   G    +   P +L+K RL    ++  S  R   ++I +  G++ + +   
Sbjct: 123 TVTLLAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIRC-TRTIIENQGLFGIYA--- 178

Query: 183 XXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAI 242
                       +W  ++    Y  L F    Q+++F +  + +   ++       +GAI
Sbjct: 179 -------GFESTIWRNTIWNASYFGLIF----QVKKF-IPRAKSTTKFQGIRNDFLVGAI 226

Query: 243 SGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANL 302
           +G ++  ++ PFD+++ R Q         G  Y   W ++  I R EG+ G YKG+   +
Sbjct: 227 AGCMSCFLSVPFDVVKTRMQ--GSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPII 284

Query: 303 FKVVPSTAVSWLVY 316
            +  P   +  +V+
Sbjct: 285 CRYGPGGGLLLVVF 298

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 8/97 (8%)

Query: 225 DAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVL----AMGGNELGF----RYT 276
           D  P     +Y+   GA++G     + YP D+++ RFQ+     A+  + +       ++
Sbjct: 5   DKDPVKLPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHS 64

Query: 277 SVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSW 313
           S+   L  I + EG    YKG++  L   VP  AV +
Sbjct: 65  SILSCLSKILKEEGFKNLYKGMSPPLLMEVPKRAVKF 101

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 123/294 (41%), Gaps = 28/294 (9%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQ----VYHEEGTKGLF 80
           +F AGG+A  ++ TV +P E VKI +Q+Q    + N+ I+++  Q    V+  EG +GL 
Sbjct: 21  SFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQ 80

Query: 81  RGNGLNCIRIFPYSAVQFVVYE---ACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSV 137
           +G     I     +  +   YE   A   K F+ +  + + Q      +F+GA  G    
Sbjct: 81  KGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGIN-VFAGAASGIIGA 139

Query: 138 VATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWP 197
           V   PL L+KTRL       S  N  K    +   G+W  L +T             +  
Sbjct: 140 VMGSPLFLVKTRLQ------SYSNAIKIGEQTHYTGVWNGL-KTIYMTEGVKGLFRGIDA 192

Query: 198 TSLGVVPYVALNFAVYEQLREFGVNSS--DAQPSWKSNLYKLTIGAISGGVAQTITYPFD 255
             L      ++   +Y   + F + +   +  PS       LT   ISG     +  P+D
Sbjct: 193 AILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSL-----HLTASTISGLGVAVVMNPWD 247

Query: 256 LLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPST 309
           ++  R        N+ G  Y    D LV   + EG++  YKG  A +F++ P T
Sbjct: 248 VILTRIY------NQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHT 295

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 63/143 (44%), Gaps = 9/143 (6%)

Query: 20  QDSNIAFLAGGVAGAVSRTVVSPFERVKILLQ-----VQSSTTSYNRGIFSSIRQVYHEE 74
           Q   I   AG  +G +   + SP   VK  LQ     ++    ++  G+++ ++ +Y  E
Sbjct: 122 QSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTE 181

Query: 75  GTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGG 134
           G KGLFRG     +R    S+VQ  +Y   K  L   +       L  T    SG    G
Sbjct: 182 GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGL---G 238

Query: 135 CSVVATYPLDLIKTRLSIQTANL 157
            +VV   P D+I TR+  Q  +L
Sbjct: 239 VAVVMN-PWDVILTRIYNQKGDL 260

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 7/81 (8%)

Query: 240 GAISGGVAQTITYPFDLLRRRFQ----VLAMGGNELGFRYTSVWDALVTIGRAEGVSGYY 295
           GA SG +   +  P  L++ R Q     + +G       YT VW+ L TI   EGV G +
Sbjct: 131 GAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQT---HYTGVWNGLKTIYMTEGVKGLF 187

Query: 296 KGLAANLFKVVPSTAVSWLVY 316
           +G+ A + +    ++V   +Y
Sbjct: 188 RGIDAAILRTGAGSSVQLPIY 208

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/326 (23%), Positives = 132/326 (40%), Gaps = 35/326 (10%)

Query: 1   MAEVLTVLEQPNSIKDFLKQDSN--IAFLAGGVAGAVSRTVV-SPFERVKILLQVQSSTT 57
           M+E     +  + ++D   QD+   +  L  G AG +++ ++  PF+  K+ LQ     T
Sbjct: 1   MSEEFPTPQLIDDLEDHPGQDNGRVVKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPT 60

Query: 58  SYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQ 117
           S        ++ +   EG KG ++G     + +    ++QF V EA K+  FH    +  
Sbjct: 61  SAA----EVVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEAMKR-FFHARNVDHN 115

Query: 118 EQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPP--GIW 175
             L+ +Q    G   G  +     P++ ++ RL  QT        S A++  K P   I 
Sbjct: 116 ATLSLSQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTG-------SGAQAEFKGPIDCIK 168

Query: 176 QLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQ---PSWKS 232
           +L S+              + PT L         F VYE L    +N    +   P WK 
Sbjct: 169 KLRSQKGLMRG--------LIPTMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPWKL 220

Query: 233 NLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVS 292
            LY    GA+SG     + YP D+++   Q   +   + G     V   L      EG+ 
Sbjct: 221 CLY----GALSGTALWLMVYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYA---REGLK 273

Query: 293 GYYKGLAANLFKVVPSTAVSWLVYEV 318
            ++KG    + +  P+   ++  +E+
Sbjct: 274 AFFKGFGPTMLRAAPANGGTFATFEL 299

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 1/83 (1%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN-RGIFSSIRQVYHEEGTKGLFRGNGL 85
           L G ++G     +V P + VK ++Q  +     N + +    R +Y  EG K  F+G G 
Sbjct: 222 LYGALSGTALWLMVYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGP 281

Query: 86  NCIRIFPYSAVQFVVYEACKKKL 108
             +R  P +   F  +E   + L
Sbjct: 282 TMLRAAPANGGTFATFELAMRLL 304

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 128/310 (41%), Gaps = 27/310 (8%)

Query: 19  KQDSN---IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN---RGIFSSIRQVYH 72
           KQ S+   +  +AGG AG +      P + +K+ +Q+  +         G   +  ++Y 
Sbjct: 4   KQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYR 63

Query: 73  EEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALC 132
            EG    ++G G   I I P  A++F  YE  +  L   +   G+    NT   F   + 
Sbjct: 64  NEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLL--ADKETGKVSTGNT---FIAGVG 118

Query: 133 GGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXX 192
            G +        +   ++ +Q  +L+ +  +  K  +     + ++ E            
Sbjct: 119 AGITEAVVVVNPMEVVKIRLQAQHLNPVEGA-PKYKNAVQACYTIVKEEGFSALYRG--- 174

Query: 193 XXVWPTSLGVVPYVALNFAVYEQLREF--GVNSSDAQPSWKSNLYKLTIGAISGGVAQTI 250
             V  T+         NF VY +L+EF  G ++ +  PSW+++L    IG ISG +    
Sbjct: 175 --VSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSL----IGLISGAIGPFS 228

Query: 251 TYPFDLLRRRFQVLAMGGNELGF-RYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPST 309
             P D ++ R Q      N  G  R T +   L+   + EG    YKG+   + +V P  
Sbjct: 229 NAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLI---QEEGFRALYKGITPRVMRVAPGQ 285

Query: 310 AVSWLVYEVV 319
           AV++  YE +
Sbjct: 286 AVTFTAYEFI 295

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 59/153 (38%), Gaps = 21/153 (13%)

Query: 70  VYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSG 129
           +  EEG   L+RG  L   R        F VY   K+ L    G + QE L + +    G
Sbjct: 162 IVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFL---QGYHNQEMLPSWETSLIG 218

Query: 130 ALCGGCSVVATYPLDLIKTRLSIQ--TANLSSLNRSK--AKSISKPPGIWQLLSETXXXX 185
            + G     +  PLD IKTRL     T N+S L R     K + +  G   L        
Sbjct: 219 LISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYK------ 272

Query: 186 XXXXXXXXXVWPTSLGVVPYVALNFAVYEQLRE 218
                    + P  + V P  A+ F  YE +R+
Sbjct: 273 --------GITPRVMRVAPGQAVTFTAYEFIRK 297

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 9/106 (8%)

Query: 12  NSIKDFLKQDSNIAFLA-------GGVAGAVSRTVVSPFERVKILLQVQSSTTSYN--RG 62
           + +K+FL+   N   L        G ++GA+     +P + +K  LQ   ST + +  + 
Sbjct: 194 SKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKR 253

Query: 63  IFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKL 108
           I    +Q+  EEG + L++G     +R+ P  AV F  YE  +K+L
Sbjct: 254 ITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFIRKEL 299

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/287 (24%), Positives = 123/287 (42%), Gaps = 35/287 (12%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLN 86
           +AG + GA S  V  P   +   LQ + +     R    +I+++Y++ G  G F G    
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQTKENEA---RPKLETIKEIYNKNGIIGYFLGLESA 72

Query: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLI 146
              +   + V +  YE C K    +     ++ L+  + + +  + G  + VA+ P+ + 
Sbjct: 73  VYGMATTNFVYYYFYEWCAKTARTLTT---KQYLSTWESILASTIAGSMTAVASNPIWVA 129

Query: 147 KTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYV 206
            TR+++  +N S+L       I K  G   LL+                   +L +V   
Sbjct: 130 NTRMTVAKSNHSTLRT--VIDIVKTDGPLTLLNGLK---------------PALVLVSNP 172

Query: 207 ALNFAVYEQLREFGVNSSDAQ---PSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQV 263
            + + VYEQL+   +     +   PSW        +GAI    A   TYP+  L+ R  +
Sbjct: 173 IIQYTVYEQLKNLVLRLQRKKVLSPSWA-----FLLGAIGKLAATGTTYPYITLKTRMHL 227

Query: 264 LAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTA 310
           +    N+   +  S+W  +V I + +GVSG Y G+A  L + + + A
Sbjct: 228 MQ---NDPKHQ-KSMWSLIVEIVKKDGVSGLYNGVAVKLVQSIMTAA 270

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 117/270 (43%), Gaps = 37/270 (13%)

Query: 67  IRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRL 126
           I+ VY +EG + LF+G G N + + P  ++ F  Y   K     +  N+GQE        
Sbjct: 111 IQNVYTQEGFRSLFKGLGPNLVGVIPARSINFFTYGVTKDTASRLL-NDGQE--APWIHF 167

Query: 127 FSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSK-----AKSISKPPGIWQLLSET 181
            +GA  G  +  AT P+ L+KTRL +  A      R K      K + +  GI  L    
Sbjct: 168 LAGATAGWATSTATNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGL 227

Query: 182 XXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLR---------EFGVNSSDAQPSW-- 230
                           + LG V  + L + +YEQ++         EFG  S + + ++  
Sbjct: 228 SA--------------SYLGSVESI-LQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMK 272

Query: 231 -KSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAE 289
            K    +      +   A  +TYP +++R R +       +L  +YT ++ +   I + E
Sbjct: 273 VKEWCQRSGSAGAAKLFASILTYPHEVVRTRLRQAPKENGKL--KYTGLFQSFSLIIKEE 330

Query: 290 GVSGYYKGLAANLFKVVPSTAVSWLVYEVV 319
           G +  Y GL  +L + VP++ + +  +E+V
Sbjct: 331 GFASMYSGLTPHLMRTVPNSIIMFGTWELV 360

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 13/84 (15%)

Query: 251 TYPFDLLRRRFQVLAMGG---NELGFRYTSVWDALV----TIG------RAEGVSGYYKG 297
           T PFD+++ R Q     G    +   R   V+  L+    T+G        EG    +KG
Sbjct: 67  TCPFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKG 126

Query: 298 LAANLFKVVPSTAVSWLVYEVVCD 321
           L  NL  V+P+ ++++  Y V  D
Sbjct: 127 LGPNLVGVIPARSINFFTYGVTKD 150

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 68.9 bits (167), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 77/318 (24%), Positives = 141/318 (44%), Gaps = 54/318 (16%)

Query: 18  LKQDSNIAF---LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEE 74
           + +D++ A+   L GGVAG++ + V  PF+ VK+ LQ QS+        +S +   Y +E
Sbjct: 1   MSEDADKAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFPT--TWSCVSHTYKQE 58

Query: 75  GT-KGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCG 133
           G  +G ++G        F   AV FV +   +  L +       E++     +F+GA+ G
Sbjct: 59  GLWRGFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENCYSCGPLEKV-----VFAGAIAG 113

Query: 134 GCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSI----------SKPPGIWQLLSETXX 183
            C+     P++L+K +L  Q +NL+ ++  +  ++          +   G+WQ  S T  
Sbjct: 114 ACTSYVLTPVELVKCKL--QVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFI 171

Query: 184 XXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAIS 243
                      VW             F  YE L+ +    +  + S ++ +++L      
Sbjct: 172 RESAGGA----VW-------------FTAYEVLKGW---LARRRGSTENTVWELLASGAG 211

Query: 244 GGVA-QTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANL 302
            G A     +P D ++   Q   +G   LG        A+ T+ +  G +G+Y+G+   L
Sbjct: 212 AGAAFHASIFPADTVKSTMQTEHLG---LG-------PAVRTVLKKHGPTGFYRGVGITL 261

Query: 303 FKVVPSTAVSWLVYEVVC 320
            + +P+ AV + VYE +C
Sbjct: 262 LRALPANAVIFYVYESLC 279

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 120/299 (40%), Gaps = 33/299 (11%)

Query: 27  LAGGVAGAVSRTVV-SPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85
           L  G AG +++ +V  PF+  K+ LQ  S+ T+        +R++   EG +G ++G   
Sbjct: 29  LLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT----AMEVVRKLLANEGPRGFYKGTLT 84

Query: 86  NCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDL 145
             I +    ++QF V EA  K+ FH    +    L+  Q    G   G  +     P++ 
Sbjct: 85  PLIGVGACVSLQFGVNEAM-KRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEH 143

Query: 146 IKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPY 205
           ++ RL  QT        S   +  K P       E              + PT L     
Sbjct: 144 VRIRLQTQTG-------SGTNAEFKGP------LECIKKLRHNKALLRGLTPTILREGHG 190

Query: 206 VALNFAVYEQL------REFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRR 259
               F VYE L      +  G+   D  P+WK  ++    GA+SG     + YP D+++ 
Sbjct: 191 CGTYFLVYEALIANQMNKRRGLERKDI-PAWKLCIF----GALSGTALWLMVYPLDVIKS 245

Query: 260 RFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318
             Q   +   + G   +SV   L   G   G+  ++KG    + +  P+   ++  +E+
Sbjct: 246 VMQTDNLQKPKFGNSISSVAKTLYANG---GIGAFFKGFGPTMLRAAPANGATFATFEL 301

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 60/134 (44%), Gaps = 7/134 (5%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQ--SSTTSYNRGIFSSIRQVYHEEGTKGLFRGN 83
           +  G   G V+  + SP E V+I LQ Q  S T +  +G    I+++ H    K L RG 
Sbjct: 124 YACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGL 180

Query: 84  GLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPL 143
               +R        F+VYEA      +      ++ +   +    GAL G    +  YPL
Sbjct: 181 TPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPL 240

Query: 144 DLIKTRLSIQTANL 157
           D+IK+   +QT NL
Sbjct: 241 DVIKS--VMQTDNL 252

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 34/81 (41%), Gaps = 1/81 (1%)

Query: 29  GGVAGAVSRTVVSPFERVKILLQVQS-STTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNC 87
           G ++G     +V P + +K ++Q  +     +   I S  + +Y   G    F+G G   
Sbjct: 226 GALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTM 285

Query: 88  IRIFPYSAVQFVVYEACKKKL 108
           +R  P +   F  +E   + L
Sbjct: 286 LRAAPANGATFATFELAMRLL 306

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 76/306 (24%), Positives = 126/306 (41%), Gaps = 42/306 (13%)

Query: 11  PNSIKDFLKQDSN---IAFLAGGVAGAVSRTVV-SPFERVKILLQVQSSTTSYNRGIFSS 66
           P  I D      N   I  L  G AG +++ +V  PF+  K+ LQ   ++T+  +     
Sbjct: 8   PQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK----V 63

Query: 67  IRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRL 126
           I+ +   EG  G ++G     + +    ++QF V EA K+  FH       + L+  Q  
Sbjct: 64  IKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKR-FFHTFDEAASQHLSLLQYY 122

Query: 127 FSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLN-RSKAKSISKPPGIWQLLSETXXXX 185
             G   G  +     P++ I+ RL  QT + ++   +     I K     QL+       
Sbjct: 123 ICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMR------ 176

Query: 186 XXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQ---PSWKSNLYKLTIGAI 242
                    + PT L       + F  YE L    V S   +   P+WK  L+    GA 
Sbjct: 177 --------GLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLF----GAA 224

Query: 243 SGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRA----EGVSGYYKGL 298
           SG +  T+ YP D+++   Q   +   + G       + ++T+GR     +GVSG +KG 
Sbjct: 225 SGTLLWTMVYPLDVIKSVMQTDNLKTPKNG-------NNILTVGRTIIARQGVSGLFKGF 277

Query: 299 AANLFK 304
           A  + +
Sbjct: 278 APTMLR 283

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 68.6 bits (166), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 146/315 (46%), Gaps = 52/315 (16%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQS---STTSYNRGIFSSIRQVYHE-EGTKGL-- 79
            ++G  AG ++  V  P + +K+ LQ+ +     +SY    ++ ++++  +  GT+ L  
Sbjct: 16  IISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSY----YNQVQRIIKDGSGTQQLLK 71

Query: 80  --FRGNGLNCIRIFPYSAVQFVVYEACKKKLFHV-------NGNNGQEQLTNTQRLFSGA 130
             +RG G+N I       + F +Y   K  ++ +       N      ++T++  L S  
Sbjct: 72  EAYRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAG 131

Query: 131 LCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXX 190
             G  + + T P+ +IKTR+      +S+  +S     S    I ++ +E          
Sbjct: 132 ASGLATALLTNPMWVIKTRI------MST--KSSQGYTSILNAITRIYTE---------E 174

Query: 191 XXXXVWPTSLGVVPYV------ALNFAVYEQLR-EFGVNSSDAQPSWKSNLYKLTIGAIS 243
                W    G+VP +      AL FA+Y+ L+ ++  + +D Q    + +  + I ++S
Sbjct: 175 GLKTFWR---GLVPSLFGVTQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLS 231

Query: 244 GGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALV-TIGRAEGVSGYYKGLAANL 302
             ++ +  YP  LL+   Q      NE      S  ++L+ +I    G++G+YKGL ANL
Sbjct: 232 KMISVSSVYPLQLLKTNLQTFRTEHNE-----NSKMNSLIRSIWHTNGIAGFYKGLFANL 286

Query: 303 FKVVPSTAVSWLVYE 317
            + +PST +++ VYE
Sbjct: 287 VRAIPSTCITFGVYE 301

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 83/201 (41%), Gaps = 14/201 (6%)

Query: 19  KQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKG 78
           K  S++  ++ G +G  +  + +P   +K  +    S+  Y   I ++I ++Y EEG K 
Sbjct: 120 KMTSSMYLVSAGASGLATALLTNPMWVIKTRIMSTKSSQGYT-SILNAITRIYTEEGLKT 178

Query: 79  LFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVV 138
            +RG   +   +    A+ F +Y+  K K  H   +  + +L   + +   +L    SV 
Sbjct: 179 FWRGLVPSLFGV-TQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVS 237

Query: 139 ATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPT 198
           + YPL L+KT L  QT        SK  S+ +   IW                   ++  
Sbjct: 238 SVYPLQLLKTNL--QTFRTEHNENSKMNSLIR--SIWH--------TNGIAGFYKGLFAN 285

Query: 199 SLGVVPYVALNFAVYEQLREF 219
            +  +P   + F VYE  +  
Sbjct: 286 LVRAIPSTCITFGVYEHFKHI 306

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 87/199 (43%), Gaps = 12/199 (6%)

Query: 124 QRLFSGALCGGCSVVATYPLDLIKTRLSIQTANL--SSLNRSKAKSISKPPGIWQLLSET 181
           + + SG   G  + + T+PLDLIK RL +   +L  SS      + I    G  QLL E 
Sbjct: 14  KEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKEA 73

Query: 182 XXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGV-NSSDAQPSWKSNLYKLTIG 240
                         W    G+  Y      VY    E  + N         S++Y ++ G
Sbjct: 74  YRGLGINIIGNAVAWGLYFGL--YRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAG 131

Query: 241 AISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAA 300
           A SG     +T P  +++ R  +++   ++    YTS+ +A+  I   EG+  +++GL  
Sbjct: 132 A-SGLATALLTNPMWVIKTR--IMSTKSSQ---GYTSILNAITRIYTEEGLKTFWRGLVP 185

Query: 301 NLFKVVPSTAVSWLVYEVV 319
           +LF V    A+ + +Y+ +
Sbjct: 186 SLFGVTQG-ALYFAIYDTL 203

>Scas_645.9
          Length = 391

 Score = 68.6 bits (166), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 122/284 (42%), Gaps = 34/284 (11%)

Query: 50  LQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLF 109
           L  ++S+  +N G   +  +++  EG   L+RG  +N +   P + V F  YE  +    
Sbjct: 120 LNCKNSSVRFN-GTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLR---- 174

Query: 110 HVNGNNGQEQLTNTQRLFSGALCGGCSVV----ATYPLDLIKTRLSIQTANLSSLNRSKA 165
                     L  +   F+  +CG  + +       PL+L+KT+L        S+ R  +
Sbjct: 175 ------DNSPLATSSPTFNPLMCGAIARILAASTVAPLELLKTKLQ-------SIPRV-S 220

Query: 166 KSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGV---VPYVALNFAVYEQLR-EFGV 221
           KS +    + +LL ET                  + +   VP+ A+ +  YE  +    +
Sbjct: 221 KSTTSWMMVKELLKETRQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWM 280

Query: 222 NSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGF-------R 274
           ++S +  +    +     G+ISG +A  +T+PFD+ + R+Q+  MG N+          +
Sbjct: 281 DTSKSHSNLTFFINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQ 340

Query: 275 YTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318
             +++  L  I + EG    Y GL   + K+ PS A+    YE+
Sbjct: 341 TKNMFKFLRNIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYEL 384

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 26/48 (54%)

Query: 274 RYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVCD 321
           R+    +A   I + EG++  ++G++ NL   +P+  V +  YE + D
Sbjct: 128 RFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLRD 175

>Kwal_33.12988
          Length = 303

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 73/323 (22%), Positives = 131/323 (40%), Gaps = 31/323 (9%)

Query: 1   MAEVLTVLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVV-SPFERVKILLQVQSSTTSY 59
           M++ LT+ +  + + D       +  +  G  G +++ +V  PF+  K+ LQ  S+ T+ 
Sbjct: 1   MSDELTMPQVVDDLTDKSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQTSSTPTTA 60

Query: 60  NRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQ 119
            R     ++ +   EG +G ++G  L  I +    + QF   EA K+  FH   N     
Sbjct: 61  LR----VVQDLVKNEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAMKR-YFHKRNNFQSTS 115

Query: 120 LTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLS 179
           L   +    G + G  +     P++ ++  L +QT +     R+ A+       I +LL 
Sbjct: 116 LRLPEYYACGFVSGCANAFLATPIEHVRILLQVQTKS-----RADAEYQGAMDCIKKLLK 170

Query: 180 ETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQL----REFGVNSSDAQPSWKSNLY 235
           E                PT L       + F  YE +    +  G+   D  P+WK  LY
Sbjct: 171 E--------GKLMRGFTPTILRTSHGFGVYFTSYEAMICSEQRKGIARKDI-PAWKLCLY 221

Query: 236 KLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYY 295
               GA SG +   + YPFD+++   Q   +     G   T+V+     I    G   + 
Sbjct: 222 ----GAFSGSLLWAMVYPFDVIKSVMQSDKLRTPVYG---TNVFQVAKNIYNERGPKAFV 274

Query: 296 KGLAANLFKVVPSTAVSWLVYEV 318
           KG    + + +P    ++  +E+
Sbjct: 275 KGFGPTMLRSLPVNGATFTAFEM 297

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 1/83 (1%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQS-STTSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85
           L G  +G++   +V PF+ +K ++Q     T  Y   +F   + +Y+E G K   +G G 
Sbjct: 220 LYGAFSGSLLWAMVYPFDVIKSVMQSDKLRTPVYGTNVFQVAKNIYNERGPKAFVKGFGP 279

Query: 86  NCIRIFPYSAVQFVVYEACKKKL 108
             +R  P +   F  +E   + L
Sbjct: 280 TMLRSLPVNGATFTAFEMAMRIL 302

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 128/311 (41%), Gaps = 46/311 (14%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQ----VYHEEGTKGLF 80
           +F+AGG+A  ++ TV +P E +KI +Q+Q   ++    ++ +  Q    ++  EG KGL 
Sbjct: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84

Query: 81  RGNGLNCIRIFP--YSAVQFVVYEACK---KKLFHVNGNNGQEQLTNTQRLFSGALCGGC 135
           +  GLN   I+    +  +   YE  +    +LF  +    + Q      +FSGA  G  
Sbjct: 85  K--GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGV-NVFSGAASGII 141

Query: 136 SVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLS---ETXXXXXXXXXXX 192
             V   PL L+KTRL   +  +      K    +   G+W  L    +T           
Sbjct: 142 GAVIGSPLFLVKTRLQSYSEFI------KIGEQTHYTGVWNGLVTIFKTEGVKGLFRGID 195

Query: 193 XXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYK------LTIGAISGGV 246
             +  T  G     ++   +Y   +   V         K++L K      LT   ISG  
Sbjct: 196 AAILRTGAG----SSVQLPIYNTAKNILV---------KNDLMKDGPALHLTASTISGLG 242

Query: 247 AQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVV 306
              +  P+D++  R        N+ G  Y    D LV   R EGV+  YKG AA +F++ 
Sbjct: 243 VAVVMNPWDVILTRIY------NQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIA 296

Query: 307 PSTAVSWLVYE 317
           P T +     E
Sbjct: 297 PHTIMCLTFME 307

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 62/143 (43%), Gaps = 9/143 (6%)

Query: 20  QDSNIAFLAGGVAGAVSRTVVSPFERVKILLQ-----VQSSTTSYNRGIFSSIRQVYHEE 74
           Q   +   +G  +G +   + SP   VK  LQ     ++    ++  G+++ +  ++  E
Sbjct: 126 QSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTE 185

Query: 75  GTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGG 134
           G KGLFRG     +R    S+VQ  +Y   K  L   +       L  T    SG    G
Sbjct: 186 GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGL---G 242

Query: 135 CSVVATYPLDLIKTRLSIQTANL 157
            +VV   P D+I TR+  Q  +L
Sbjct: 243 VAVVMN-PWDVILTRIYNQKGDL 264

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 129/305 (42%), Gaps = 41/305 (13%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTS----------YNRGIFSSIRQVYHEEG 75
           F++G VAG    TV+ P + VK   Q++ +T +          YN G+   ++++  +EG
Sbjct: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN-GVIDCLKKIVKKEG 74

Query: 76  TKGLFRGNGLNCIRIFPYSAVQFVV---YEACKKKLFHVNGNNGQEQLTNTQRLFSGALC 132
              L+RG     +   P  A +F     Y+   K LF+ N      + T    + +GA  
Sbjct: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTN------ETTQKISIAAGASA 128

Query: 133 GGCSVVATYPLDLIKTRL-SIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXX 191
           G        P +LIK R+  ++++ L  ++  K K+I K  GI  L              
Sbjct: 129 GMTEAAVIVPFELIKIRMQDVKSSYLGPMDCLK-KTI-KNEGIMGLYK----------GI 176

Query: 192 XXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTIT 251
              +W  +L    Y    F V  Q+R    +   A+   +     L  GAI G V   + 
Sbjct: 177 ESTMWRNALWNGGY----FGVIYQVRN---SMPVAKTKGQKTRNDLIAGAIGGTVGTMLN 229

Query: 252 YPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAV 311
            PFD+++ R Q +    + +  +Y     +L+ I R EG    YKG    + ++ P  ++
Sbjct: 230 TPFDVVKSRIQSVDAVSSAVK-KYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSL 288

Query: 312 SWLVY 316
             +V+
Sbjct: 289 MLVVF 293

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 7/97 (7%)

Query: 223 SSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQV------LAMGGNELGFRYT 276
           SSD+       +Y+   GA++G    T+ YP D+++ RFQ+       A  G ++  RY 
Sbjct: 2   SSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVE-RYN 60

Query: 277 SVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSW 313
            V D L  I + EG S  Y+G+++ +    P  A  +
Sbjct: 61  GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKF 97

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 74/180 (41%), Gaps = 12/180 (6%)

Query: 125 RLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXX 184
           +  SGA+ G   +   YPLD++KTR  ++    ++   +  K + +  G+   L +    
Sbjct: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAA--AVGKQVERYNGVIDCLKKIVKK 72

Query: 185 XXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISG 244
                       P  L   P  A  FA  +Q ++   N  +   +  +    +  GA +G
Sbjct: 73  EGFSRLYRGISSPM-LMEAPKRATKFACNDQYQKIFKNLFNTNET--TQKISIAAGASAG 129

Query: 245 GVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFK 304
                +  PF+L++ R Q       ++   Y    D L    + EG+ G YKG+ + +++
Sbjct: 130 MTEAAVIVPFELIKIRMQ-------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 9/141 (6%)

Query: 23  NIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRG 82
            I+  AG  AG     V+ PFE +KI  ++Q   +SY  G    +++    EG  GL++G
Sbjct: 119 KISIAAGASAGMTEAAVIVPFELIKI--RMQDVKSSY-LGPMDCLKKTIKNEGIMGLYKG 175

Query: 83  NGLNCIRIFPYSAVQF-VVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATY 141
                 R   ++   F V+Y+   +    V    GQ+   +   L +GA+ G    +   
Sbjct: 176 IESTMWRNALWNGGYFGVIYQV--RNSMPVAKTKGQKTRND---LIAGAIGGTVGTMLNT 230

Query: 142 PLDLIKTRLSIQTANLSSLNR 162
           P D++K+R+    A  S++ +
Sbjct: 231 PFDVVKSRIQSVDAVSSAVKK 251

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 67.0 bits (162), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 68/137 (49%), Gaps = 8/137 (5%)

Query: 25  AFLAGGVAGAVSRTVVS-PFERVKILLQVQSS------TTSYN-RGIFSSIRQVYHEEGT 76
           + LA G  G +  +VV  P E +K  LQ+Q         + YN RG+  ++R +   EG 
Sbjct: 150 SHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGV 209

Query: 77  KGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCS 136
             LF G      R  P+SA+QF  YE  +K  F +        L+ T  + +GA  GG +
Sbjct: 210 SALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLERKPVDGHLSFTAEVVTGASAGGLA 269

Query: 137 VVATYPLDLIKTRLSIQ 153
            + T PLD++KTR+  Q
Sbjct: 270 GIITTPLDVVKTRIQTQ 286

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 125/303 (41%), Gaps = 45/303 (14%)

Query: 38  TVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTK-GLFRGNGLNCIRIFPYSAV 96
           +V+   + VK   Q       Y R + S+ R +  EEG + GL+ G G   +  FP +AV
Sbjct: 69  SVMHSLDTVKTRQQGAPGEVKY-RHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAV 127

Query: 97  QFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTA- 155
            F  YE  K+++     N  Q   T +  L +G L    S V   P +++KTRL +Q   
Sbjct: 128 FFGTYEWVKRQMI----NEWQIHETYSH-LAAGFLGDLFSSVVYVPSEVLKTRLQLQGCY 182

Query: 156 ---------NLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYV 206
                    N   L+    ++I +  G+  L                         +P+ 
Sbjct: 183 NNRHFQSGYNYRGLS-DAVRTIVRTEGVSALFFGYKATLSRD--------------LPFS 227

Query: 207 ALNFAVYEQLREFGV----NSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQ 262
           AL FA YE+ R++         D   S+ +   ++  GA +GG+A  IT P D+++ R Q
Sbjct: 228 ALQFAFYERFRKWAFLLERKPVDGHLSFTA---EVVTGASAGGLAGIITTPLDVVKTRIQ 284

Query: 263 VLAMG------GNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVY 316
               G       +       S++ +L+ + R EG+ G + G+          +++  L+Y
Sbjct: 285 TQPRGSAGTPDASAPARLNGSIFRSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIMLLLY 344

Query: 317 EVV 319
           +  
Sbjct: 345 QTA 347

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 66.2 bits (160), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 73/308 (23%), Positives = 129/308 (41%), Gaps = 21/308 (6%)

Query: 15  KDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEE 74
           KD  K D   +F+AG +AGAV  ++  PFE  K  LQ+   ++  +R     I      +
Sbjct: 3   KDSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKTQ 62

Query: 75  GTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGG 134
           G   ++ G     +     +A +F+ Y+  +  L     +    +L+  + + +G   G 
Sbjct: 63  GVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLL----KDKKTGELSGPRGVLAGLGAGL 118

Query: 135 C-SVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXX 193
             SVVA  P + IKT L     ++    ++  +S+++      L+ +             
Sbjct: 119 LESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMAR--NYISLVKD-----EGFRGLYG 171

Query: 194 XVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLT--IGAISGGVAQTIT 251
            V P S+      A+    Y +++   V      P  K     LT  +GA SG V    T
Sbjct: 172 GVLPVSMRQAANQAVRLGCYNKIKVL-VQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYAT 230

Query: 252 YPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAV 311
            P D ++ R Q L         +Y+S  +   TI + EG+  ++KG    L +++ S  +
Sbjct: 231 MPIDTVKTRMQSLTAS------KYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGI 284

Query: 312 SWLVYEVV 319
            + +YE V
Sbjct: 285 VFTIYENV 292

>Kwal_23.4354
          Length = 343

 Score = 66.2 bits (160), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 123/290 (42%), Gaps = 39/290 (13%)

Query: 43  FERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYE 102
           FE V+     ++S   YN   + +  ++   EG + L+RG  +  +   P + V F+ YE
Sbjct: 72  FEDVR----CKTSPVRYN-STWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYE 126

Query: 103 ACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNR 162
           + + K      +  Q++      L  GAL    +     PL+L +TRL        S+ R
Sbjct: 127 SLRDK------SRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQ-------SIPR 173

Query: 163 SKAKSISKPPGIWQLLSETXXXXXXXXXXXX------XVWPTSLGVVPYVALNFAVYEQL 216
           S  KS +    I  L+ E+                   +W      VP+ ++ +  YE  
Sbjct: 174 SSPKSTTAM-MIKDLIKESRYEISKVGYKALFRGLEITLWRD----VPFSSIYWGCYEFY 228

Query: 217 R--------EFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGG 268
           +        +  VNSS++  +W   +     G+  G VA  +T+PFD+ + R Q+  +  
Sbjct: 229 KSNVSIDSEKSIVNSSNS--NWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNS 286

Query: 269 NELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318
                   +++  L  + ++EG++  Y GL   + K+ PS A+    YEV
Sbjct: 287 TLEKKPSKNMFKYLNQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEV 336

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 71/158 (44%), Gaps = 16/158 (10%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQV------QSSTTSYNRGIFSSIRQVYHEEGTKGL 79
            + G +A  ++ T V+P E  +  LQ       +S+T    + +    R    + G K L
Sbjct: 144 LMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEISKVGYKAL 203

Query: 80  FRGNGLNCIRIFPYSAVQFVVYEACK-------KKLFHVNGNNGQEQLTNTQRLFSGALC 132
           FRG  +   R  P+S++ +  YE  K       +K    + N+      N+     G+  
Sbjct: 204 FRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHFVNS--FVGGSFG 261

Query: 133 GGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISK 170
           G  + V T+P D+ KTR+ I   N S+L +  +K++ K
Sbjct: 262 GAVAAVLTHPFDVGKTRMQITYLN-STLEKKPSKNMFK 298

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 4/86 (4%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSY----NRGIFSSIRQVYHEEGTKGLF 80
           +F+ G   GAV+  +  PF+  K  +Q+    ++     ++ +F  + Q+   EG   L+
Sbjct: 254 SFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAALY 313

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKK 106
            G     I+I P  A+    YE CK+
Sbjct: 314 TGLVPRVIKIAPSCAIMISTYEVCKR 339

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%)

Query: 274 RYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVCD 321
           RY S WDA   I + EGV   ++GL+  L    P+  V ++ YE + D
Sbjct: 83  RYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRD 130

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 66.2 bits (160), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 74/314 (23%), Positives = 130/314 (41%), Gaps = 52/314 (16%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGI----FSSIRQVYHEEGTKGLF 80
           +F+AGG+A  ++ TV +PFE VK  +Q+Q   ++ N+ I    F ++  ++  EG KGL 
Sbjct: 26  SFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKGLQ 85

Query: 81  RG--------NGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQ-RLFSGAL 131
           RG         GLN  R+  Y  ++ V+     K  F     +   +L N    + +GA 
Sbjct: 86  RGLVSAYVYQIGLNGSRLGFYEPIRTVL----NKTFFP---ESDPHKLQNVAVNVTAGAT 138

Query: 132 CGGCSVVATYPLDLIKTRLSI--------QTANLSSLNRSKAKSISKPPGIWQLLSETXX 183
            G    +   PL L+KTR+          +  + +S++   A +I K  G+  L      
Sbjct: 139 SGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLA-TIFKKEGVLGLFR---- 193

Query: 184 XXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAIS 243
                      +  T  G     ++   +Y   + F + +   +     +L   T+  + 
Sbjct: 194 ------GVDAAILRTGAG----SSVQLPIYNTTKNFLLQNDIMKEGTALHLLSSTVTGLG 243

Query: 244 GGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLF 303
            G+   +  P+D++  R        N+ G  Y    D +    + EG+   YKG  A LF
Sbjct: 244 VGI---VMNPWDVVLTRVY------NQKGNTYKGPIDCMFKTIKIEGIGALYKGFGAQLF 294

Query: 304 KVVPSTAVSWLVYE 317
           ++ P T +     E
Sbjct: 295 RIAPHTILCLTFME 308

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 62/146 (42%), Gaps = 17/146 (11%)

Query: 20  QDSNIAFLAGGVAGAVSRTVVSPFERVKILLQV---------QSSTTSYNRGIFSSIRQV 70
           Q+  +   AG  +G +   V SP   VK  +Q          Q+  TS + G+ +    +
Sbjct: 127 QNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLAT----I 182

Query: 71  YHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGA 130
           + +EG  GLFRG     +R    S+VQ  +Y   K  L     N+  ++ T    L S  
Sbjct: 183 FKKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQ---NDIMKEGTALHLLSSTV 239

Query: 131 LCGGCSVVATYPLDLIKTRLSIQTAN 156
              G  +V   P D++ TR+  Q  N
Sbjct: 240 TGLGVGIVMN-PWDVVLTRVYNQKGN 264

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 66/319 (20%), Positives = 130/319 (40%), Gaps = 23/319 (7%)

Query: 1   MAEVLTVLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVV-SPFERVKILLQVQSSTTSY 59
           M++ LT  +  + + D L     I  +  G AG +++ +V  PF+  K+ +Q  + + + 
Sbjct: 1   MSDELTAPQVVDDLSDSLDYKRAIKDILSGTAGGIAQVLVGQPFDITKVRMQTSAGSATA 60

Query: 60  NRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQ 119
              + S I+     EG  G ++G     + +    + QF V EA K++   +NG+  +  
Sbjct: 61  VDVVTSLIK----NEGILGFYKGTLAPLVGVGACVSCQFGVNEAMKRRFRRMNGDPSKP- 115

Query: 120 LTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLS 179
           L+  Q    G   G  +     P++ ++ RL +QT +L++         ++  G    + 
Sbjct: 116 LSLKQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLAN---------AEYQGSLDCMR 166

Query: 180 ETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTI 239
           +              +  T  G   Y +   A+     + G+   D  P WK  ++    
Sbjct: 167 KLLKQGALMRGFTATLMRTCHGFGIYFSTYEALIANQHKKGIPRKDIAP-WKVCIF---- 221

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299
           GA SG     + YP D+++   Q   +     G   T+VW    +I    G   + KG  
Sbjct: 222 GAFSGACYWAMAYPIDVVKSIMQSDRLVSPVHG---TNVWQVAKSIYTTRGKRAFIKGFM 278

Query: 300 ANLFKVVPSTAVSWLVYEV 318
             + + +P    ++  +E+
Sbjct: 279 PAMLRSLPVNGATFATFEM 297

>Kwal_55.21335
          Length = 317

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 76/317 (23%), Positives = 125/317 (39%), Gaps = 48/317 (15%)

Query: 14  IKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHE 73
           I DF  +D+    L G +AGA  + +  P + +K+ LQ Q +        +S I+  Y +
Sbjct: 39  IMDF--KDALKDILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTS--WSCIKYTYQK 94

Query: 74  EG-TKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALC 132
           EG  KG ++G     +     +AV FV +   +  L        +     +Q + SGA  
Sbjct: 95  EGFVKGFYQGVASPLVGAALENAVLFVTFNRAQNFL-----QQYESVSPLSQTVLSGAFA 149

Query: 133 GGCSVVATYPLDLIKTRLSIQTANLSSLNRSK----AKSISKPPGI---WQLLSETXXXX 185
           G C+     P++LIK  L +     ++   SK     K I +  GI   WQ  S T    
Sbjct: 150 GACTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRE 209

Query: 186 XXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGG 245
                    VW             F  YE L+ +     +     +++ ++L     S G
Sbjct: 210 CAGGA----VW-------------FTTYESLKSYLARRRNDT---ENHTWELLASGASAG 249

Query: 246 VA-QTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFK 304
           VA     +P D ++   Q   +G          + DA   I    G +G Y+GL   L +
Sbjct: 250 VAFNASIFPADTIKSTAQTQHLG----------IVDATKRILARSGPAGLYRGLGITLIR 299

Query: 305 VVPSTAVSWLVYEVVCD 321
             P+ A+ +  YE + +
Sbjct: 300 AAPANAIVFYTYETLSN 316

>Scas_718.5
          Length = 324

 Score = 65.9 bits (159), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 124/299 (41%), Gaps = 34/299 (11%)

Query: 30  GVAGAVSRTVV-SPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCI 88
           G  G +S+ +V  PF+  K+ +Q    T++ + G    IR++   EG    ++G+ +  +
Sbjct: 46  GTCGGISQVIVGQPFDTTKVRMQ----TSAKSVGALDIIRKLVKNEGVWAFYKGSLIPIV 101

Query: 89  RIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCG-GCSVVATY---PLD 144
            +    +VQF V EA K+     N + G +    T +L    +CG    VV ++   P++
Sbjct: 102 GVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPIE 161

Query: 145 LIKTRLSIQTANLSSLNRSKAKSISKP-PGIWQLLSETXXXXXXXXXXXXXVWPTSLGVV 203
            ++ RL  QT N         +    P   I +L+ E              + P  L   
Sbjct: 162 HVRIRLQTQTGN------GNEREFKGPLDCIRKLVKEK--------SLMRGLRPMMLRAG 207

Query: 204 PYVALNFAVYEQLREFGVNSSDAQ---PSWKSNLYKLTIGAISGGVAQTITYPFDLLRRR 260
             +   F  YE L    +     +    SWK   Y    G++SG V     YP D+++  
Sbjct: 208 HGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSY----GSLSGVVLWLAIYPLDVVKSM 263

Query: 261 FQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVV 319
            Q   +          +V + L    R +G+S ++KG A  + +  P    +++ +E+V
Sbjct: 264 IQTDTLRNPRFKNSMKNVINHLY---REQGISAFFKGFAPTMLRAAPVNGATFVTFELV 319

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 58/131 (44%), Gaps = 7/131 (5%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN--RGIFSSIRQVYHEEGTKGLFRGN 83
           ++ G   G V+  + SP E V+I LQ Q+   +    +G    IR++  E   K L RG 
Sbjct: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGL 199

Query: 84  GLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPL 143
               +R        F+ YEA       +     + ++ + +    G+L G    +A YPL
Sbjct: 200 RPMMLRAGHGLGCYFLTYEALIAN--EIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPL 257

Query: 144 DLIKTRLSIQT 154
           D++K+ +   T
Sbjct: 258 DVVKSMIQTDT 268

 Score = 34.7 bits (78), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 34/75 (45%), Gaps = 1/75 (1%)

Query: 29  GGVAGAVSRTVVSPFERVKILLQVQS-STTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNC 87
           G ++G V    + P + VK ++Q  +     +   + + I  +Y E+G    F+G     
Sbjct: 243 GSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTM 302

Query: 88  IRIFPYSAVQFVVYE 102
           +R  P +   FV +E
Sbjct: 303 LRAAPVNGATFVTFE 317

>Scas_714.18
          Length = 305

 Score = 65.5 bits (158), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 78/321 (24%), Positives = 126/321 (39%), Gaps = 68/321 (21%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGT-KGLFRGNGL 85
           LAG +AGA+ + +  PF+ VK+ LQ Q +    +   +S I+  Y  EG  +G ++G   
Sbjct: 17  LAGSIAGAIGKFIEYPFDTVKVRLQTQEAYMFPST--WSCIKYTYENEGILEGFYQGIES 74

Query: 86  NCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDL 145
             I     +A+ F+ Y  C   L     N   E       L S    G C+     P++L
Sbjct: 75  PLIGAALENAILFLAYNQCSSFL-----NAFTEFSAFLIILISAGFAGSCASFVLTPVEL 129

Query: 146 IKTRLSIQTANLSSLNRSKA-------------------------KSISKPP---GIWQL 177
           IK +L I   + S  +                             KSI K     G+WQ 
Sbjct: 130 IKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLWQG 189

Query: 178 LSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVN-SSDAQPSWKSNLYK 236
            S T                 S+G V +    FA YE +++   +  S+   +W+     
Sbjct: 190 QSSTFIR-------------ESIGSVVW----FATYELMKQTLRDPKSEVNTTWQ----L 228

Query: 237 LTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYK 296
           L  GA +G       +P D ++   Q            + ++ + + +I   +GV+G+Y+
Sbjct: 229 LISGATAGLAFNGSVFPADTVKSIMQT----------EHLALMETVRSILERDGVAGFYR 278

Query: 297 GLAANLFKVVPSTAVSWLVYE 317
           GL   L + VPS A  +  YE
Sbjct: 279 GLGITLLRAVPSNAAVFYTYE 299

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 38/83 (45%), Gaps = 6/83 (7%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85
            ++G  AG      V P + VK ++Q +      +  +  ++R +   +G  G +RG G+
Sbjct: 229 LISGATAGLAFNGSVFPADTVKSIMQTE------HLALMETVRSILERDGVAGFYRGLGI 282

Query: 86  NCIRIFPYSAVQFVVYEACKKKL 108
             +R  P +A  F  YE   K L
Sbjct: 283 TLLRAVPSNAAVFYTYEKLSKIL 305

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 7/84 (8%)

Query: 234 LYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGV-S 292
           L ++  G+I+G + + I YPFD ++ R Q       +  + + S W  +      EG+  
Sbjct: 13  LREILAGSIAGAIGKFIEYPFDTVKVRLQ------TQEAYMFPSTWSCIKYTYENEGILE 66

Query: 293 GYYKGLAANLFKVVPSTAVSWLVY 316
           G+Y+G+ + L       A+ +L Y
Sbjct: 67  GFYQGIESPLIGAALENAILFLAY 90

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 65/163 (39%), Gaps = 27/163 (16%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRG--------------------- 62
           I  ++ G AG+ +  V++P E +K  LQ+ +   S +                       
Sbjct: 108 IILISAGFAGSCASFVLTPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRH 167

Query: 63  --IFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQL 120
             I  +I+ +  E+G  GL++G     IR    S V F  YE  K+ L     +   E  
Sbjct: 168 TRIIPTIKSIIKEKGLFGLWQGQSSTFIRESIGSVVWFATYELMKQTL----RDPKSEVN 223

Query: 121 TNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRS 163
           T  Q L SGA  G     + +P D +K+ +  +   L    RS
Sbjct: 224 TTWQLLISGATAGLAFNGSVFPADTVKSIMQTEHLALMETVRS 266

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 65.5 bits (158), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 73/323 (22%), Positives = 130/323 (40%), Gaps = 31/323 (9%)

Query: 1   MAEVLTVLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVV-SPFERVKILLQVQSSTTSY 59
           M++ LT  +  + + D  +    I  +  G +G +++ +V  PF+  K+ +Q  S + + 
Sbjct: 1   MSDELTTPQVVDDLSDAPEFRKAIKDIISGTSGGIAQVLVGQPFDITKVRMQTSSGSPT- 59

Query: 60  NRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQ 119
                  I+ +   EG    ++G  +  I +    + QF V EA K+    VNG   Q  
Sbjct: 60  ---AIEVIKNLVKNEGLLAFYKGTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKDQ-H 115

Query: 120 LTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLS 179
           L+  Q    G + G  +     P++ ++ RL +QT         KA + ++  G    + 
Sbjct: 116 LSLLQYYTCGFVSGSANAFLATPIEHVRIRLQLQT---------KALAKAEYRGSLDCMK 166

Query: 180 ETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQL----REFGVNSSDAQPSWKSNLY 235
           +              +  TS G   Y    F  YE L     + GV   D  P WK  ++
Sbjct: 167 KLLKQKALMRGFTATLMRTSHGFGVY----FLTYEALIMNQNKNGVLRKDI-PPWKVCVF 221

Query: 236 KLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYY 295
               GA SG     +TYPFD+++   Q   +     G    +V+    +I    G   + 
Sbjct: 222 ----GAFSGAFFWAMTYPFDVVKSIMQADRLVSPVHG---KNVFQVAKSIHATRGWGAFV 274

Query: 296 KGLAANLFKVVPSTAVSWLVYEV 318
           KG    + + +P    ++  +EV
Sbjct: 275 KGFVPTMLRSLPVNGATFATFEV 297

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/310 (22%), Positives = 125/310 (40%), Gaps = 61/310 (19%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGN 83
           ++ L+G  AG  +  V  P + +K  LQ +        G F++        G KG++RG 
Sbjct: 6   LSLLSGAAAGTSTDLVFFPIDTIKTRLQAKG-------GFFAN-------GGYKGIYRGL 51

Query: 84  GLNCIRIFPYSAVQFVVYEACK-------KKLFHVNGNNGQEQLTNTQ-RLFSGALCGGC 135
           G   +   P +++ F+ Y+  K        KL+    + G EQL +T   + S ++   C
Sbjct: 52  GSAVVASAPGASLFFISYDYMKVKSRPYISKLY----SQGSEQLIDTTTHMLSSSIGEIC 107

Query: 136 SVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXV 195
           + +   P +++K R  + + N S                WQ L                 
Sbjct: 108 ACLVRVPAEVVKQRTQVHSTNSS----------------WQTLQSILRNDNKEGLRKNLY 151

Query: 196 --WPTS-LGVVPYVALNFAVYEQLREFGVNS---SDAQPSWKSNLYKLTIGAISGGVAQT 249
             W T+ +  +P+  + F +YE L++    +   S  +P WK  +     G+I+GG+A  
Sbjct: 152 RGWSTTIMREIPFTCIQFPLYEYLKKTWAKANGQSQVEP-WKGAI----CGSIAGGIAAA 206

Query: 250 ITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPST 309
            T P D L+ R          L     S+   ++ I R EG + ++ G+      +    
Sbjct: 207 TTTPLDFLKTRLM--------LNKTTASLGSVIIRIYREEGPAVFFSGVGPRTMWISAGG 258

Query: 310 AVSWLVYEVV 319
           A+   +YE V
Sbjct: 259 AIFLGMYETV 268

 Score = 62.8 bits (151), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 71/143 (49%), Gaps = 8/143 (5%)

Query: 21  DSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEG-TKGL 79
           D+    L+  +    +  V  P E VK   QV S+ +S+      SI +  ++EG  K L
Sbjct: 93  DTTTHMLSSSIGEICACLVRVPAEVVKQRTQVHSTNSSWQ--TLQSILRNDNKEGLRKNL 150

Query: 80  FRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVA 139
           +RG     +R  P++ +QF +YE  KK     NG   Q Q+   +    G++ GG +   
Sbjct: 151 YRGWSTTIMREIPFTCIQFPLYEYLKKTWAKANG---QSQVEPWKGAICGSIAGGIAAAT 207

Query: 140 TYPLDLIKTRLSIQ--TANLSSL 160
           T PLD +KTRL +   TA+L S+
Sbjct: 208 TTPLDFLKTRLMLNKTTASLGSV 230

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 67/129 (51%), Gaps = 10/129 (7%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNC 87
           AG ++   +  V++P ERVK++LQ QS     N  + S+ + +    G + LFRG+    
Sbjct: 155 AGFISAIPTTLVMAPTERVKVVLQTQS-----NHSLGSAAKHILATGGVRSLFRGSLATL 209

Query: 88  IRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIK 147
            R  P SA+ F  YEA K    ++N  +G  +L+      +G + G    V  +P+D IK
Sbjct: 210 ARDGPGSALYFASYEATKA---YLNARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIK 266

Query: 148 TRLSIQTAN 156
           T L  Q++N
Sbjct: 267 TEL--QSSN 273

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEG-TKGLFRGNGL 85
           LAGG+AG      V P + +K   ++QSS T   + +  + R++Y+  G  KG F G G 
Sbjct: 246 LAGGMAGVSMWVGVFPIDTIKT--ELQSSNT--RQTMMEATRKIYNTRGGIKGFFPGIGP 301

Query: 86  NCIRIFPYSAVQFVVYE 102
             +R FP +A  F+  E
Sbjct: 302 ALLRSFPANAATFLGVE 318

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 41/92 (44%), Gaps = 11/92 (11%)

Query: 233 NLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVS 292
           N   L  GA+ G  A    +PFDLL+ R Q      N+      +V   LV      G+S
Sbjct: 47  NAKSLAAGAVGGVCAVLTGHPFDLLKVRCQ-----SNQASGTVDAVRKILVEARAQSGLS 101

Query: 293 ------GYYKGLAANLFKVVPSTAVSWLVYEV 318
                 G+YKG+   L  V P  AVS+  Y+V
Sbjct: 102 AVNMMRGFYKGVIPPLLGVTPIFAVSFWGYDV 133

 Score = 32.0 bits (71), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 83/221 (37%), Gaps = 30/221 (13%)

Query: 103 ACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNR 162
           A ++   HV          N + L +GA+ G C+V+  +P DL+K R     +N +S   
Sbjct: 28  AIEEPSVHVGTPKSNALYENAKSLAAGAVGGVCAVLTGHPFDLLKVRCQ---SNQASGTV 84

Query: 163 SKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVN 222
              + I         LS               V P  LGV P  A++F  Y+  ++    
Sbjct: 85  DAVRKILVEARAQSGLSAV----NMMRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKL--- 137

Query: 223 SSDAQPSWKSNLYKLTI------GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYT 276
                 +W  N  KLT       G IS      +  P + ++   Q      + LG    
Sbjct: 138 -----VTWNDNSGKLTTAQLATAGFISAIPTTLVMAPTERVKVVLQT--QSNHSLG---- 186

Query: 277 SVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
           S    ++  G   GV   ++G  A L +  P +A+ +  YE
Sbjct: 187 SAAKHILATG---GVRSLFRGSLATLARDGPGSALYFASYE 224

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 70/311 (22%), Positives = 122/311 (39%), Gaps = 41/311 (13%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSST------------TSYNRGIFSSIRQVYHE 73
           F AG +AG     V+ P + VK  +Q+Q +T              +  G+   + ++  +
Sbjct: 15  FTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKK 74

Query: 74  EGTKGLFRGNGLNCIRIFPYSAVQFV---VYEACKKKLFHVNGNNGQEQLTNTQRLFSGA 130
           EG   L++G     +   P  A++F     ++   KK+F     NG  ++T    ++SGA
Sbjct: 75  EGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPT--PNG--EMTQKIAIYSGA 130

Query: 131 LCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXX 190
             G        P +L+K RL    +   +       S+ K  G+  L +           
Sbjct: 131 SAGAVEAFVVAPFELVKIRLQDVNSQFKTPIEVVKNSVVK-GGVLSLFN----------G 179

Query: 191 XXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTI 250
               +W   L    Y  + F + + L         A+ S +     L  GAI G V   +
Sbjct: 180 LEATIWRHVLWNAGYFGIIFQIRKLL-------PAAKTSTEKTRNDLIAGAIGGTVGCLL 232

Query: 251 TYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTA 310
             PFD+++ R Q        L  +Y     +++ + R EG    YKG A  + ++ P   
Sbjct: 233 NTPFDVVKSRIQ---RSSGPLR-KYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGG 288

Query: 311 VSWLVYEVVCD 321
           +  +V+  V D
Sbjct: 289 LLLVVFTNVMD 299

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 8/88 (9%)

Query: 234 LYKLTIGAISGGVAQTITYPFDLLRRRFQV-LAMGGNELGF-------RYTSVWDALVTI 285
           +Y+ T GAI+G     + YP D+++ R Q+ +   G+            YT V D L  I
Sbjct: 12  IYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKI 71

Query: 286 GRAEGVSGYYKGLAANLFKVVPSTAVSW 313
            + EG S  YKG+ + +    P  A+ +
Sbjct: 72  VKKEGFSHLYKGITSPILMEAPKRAIKF 99

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 59/141 (41%), Gaps = 7/141 (4%)

Query: 23  NIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRG 82
            IA  +G  AGAV   VV+PFE VKI LQ      S  +     ++    + G   LF G
Sbjct: 123 KIAIYSGASAGAVEAFVVAPFELVKIRLQ---DVNSQFKTPIEVVKNSVVKGGVLSLFNG 179

Query: 83  NGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYP 142
                 R   ++A  F +    +K L         E+  N   L +GA+ G    +   P
Sbjct: 180 LEATIWRHVLWNAGYFGIIFQIRKLL--PAAKTSTEKTRND--LIAGAIGGTVGCLLNTP 235

Query: 143 LDLIKTRLSIQTANLSSLNRS 163
            D++K+R+   +  L   N S
Sbjct: 236 FDVVKSRIQRSSGPLRKYNWS 256

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 69/138 (50%), Gaps = 6/138 (4%)

Query: 28  AGGVAGAVSRTVVS-PFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLN 86
           A G   A+  T+V+ P ERVK++LQ    TT        + +Q+   +G + LF+G+   
Sbjct: 144 AAGFISAIPTTLVTAPTERVKVVLQ----TTQGKASFLDAAKQIVRTQGFQSLFKGSLAT 199

Query: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLI 146
             R  P SA+ F  YE CK+ L   +G+   E L+ T    SG + G    V  +P+D +
Sbjct: 200 LSRDGPGSALYFASYEICKEYLNKASGHTSGE-LSITNVCISGGMAGVSMWVVVFPIDTV 258

Query: 147 KTRLSIQTANLSSLNRSK 164
           KT+L   +   S L  ++
Sbjct: 259 KTQLQSSSKRQSMLEVTR 276

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 63/308 (20%), Positives = 121/308 (39%), Gaps = 46/308 (14%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN--RGIFSSIRQVYHE---EGTKGLFRG 82
           AGGV G  +     PF+ VK+  Q   + ++ +    I  + RQ          +G ++G
Sbjct: 34  AGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSHILQAARQAAGPTSLNAVRGFYKG 93

Query: 83  NGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNG------QEQLTNTQRLFSGALCGGCS 136
                + + P  AV F  Y+  KK +  V  +        + +LT +Q   +G +    +
Sbjct: 94  VVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQMAAAGFISAIPT 153

Query: 137 VVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVW 196
            + T P + +K  L       S L+   AK I +  G   L   +               
Sbjct: 154 TLVTAPTERVKVVLQTTQGKASFLD--AAKQIVRTQGFQSLFKGSLATLSRDG------- 204

Query: 197 PTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTI-GAISGGVAQTITYPFD 255
                  P  AL FA YE  +E+ +N +    S + ++  + I G ++G     + +P D
Sbjct: 205 -------PGSALYFASYEICKEY-LNKASGHTSGELSITNVCISGGMAGVSMWVVVFPID 256

Query: 256 LLRRRFQVLAMGGNELGFRYTSVWDALVTIGRA-----EGVSGYYKGLAANLFKVVPSTA 310
            ++ + Q             +S   +++ + R       G+ G++ G+   + +  P+ A
Sbjct: 257 TVKTQLQ------------SSSKRQSMLEVTRMIYNTRGGIKGFFPGVGPAILRSFPANA 304

Query: 311 VSWLVYEV 318
            ++L  E+
Sbjct: 305 ATFLGVEL 312

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEE-GTKGLFRGNGL 85
           ++GG+AG     VV P + VK  LQ    ++S  + +    R +Y+   G KG F G G 
Sbjct: 239 ISGGMAGVSMWVVVFPIDTVKTQLQ----SSSKRQSMLEVTRMIYNTRGGIKGFFPGVGP 294

Query: 86  NCIRIFPYSAVQFVVYE 102
             +R FP +A  F+  E
Sbjct: 295 AILRSFPANAATFLGVE 311

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 90/220 (40%), Gaps = 28/220 (12%)

Query: 110 HVNG-NNGQEQLT-NTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKS 167
           HVN  +  + QLT N + L +G + G C+V+  +P DL+K R        S+  RS   +
Sbjct: 14  HVNDVSQTKSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQ------SNQARSAMDA 67

Query: 168 ISKPPGIWQLLSETXXXXXXXXXXX--XXVWPTSLGVVPYVALNFAVYEQLREFGVNSSD 225
           +S    I Q   +                V P  LGV P  A++F  Y+  ++   +   
Sbjct: 68  VSH---ILQAARQAAGPTSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPS 124

Query: 226 AQPSWKSNLY-KLTI------GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSV 278
           +  S  + +  +LT+      G IS      +T P + ++   Q              S 
Sbjct: 125 SAASGAAAVEPELTLSQMAAAGFISAIPTTLVTAPTERVKVVLQTTQ--------GKASF 176

Query: 279 WDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318
            DA   I R +G    +KG  A L +  P +A+ +  YE+
Sbjct: 177 LDAAKQIVRTQGFQSLFKGSLATLSRDGPGSALYFASYEI 216

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 66/307 (21%), Positives = 130/307 (42%), Gaps = 33/307 (10%)

Query: 10  QPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTT---SYNRGIFSS 66
           QP++  +  + D  +  +AG   GA+S  +  P   +   +QV        + ++    +
Sbjct: 4   QPSNTANPAEVDELVHAVAGAGGGALSMALTMPLVTLATRMQVSEQDKEPGTRSKSKLEA 63

Query: 67  IRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRL 126
           +R++Y +EG  G + G       +   S   +  YE   +    V G+    +L  ++ +
Sbjct: 64  VREIYRKEGVVGFYYGLESAMYGMAANSLNYYYFYELAARATMRVRGS---RRLNTSEAI 120

Query: 127 FSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXX 186
            S A+ G  + +A+ P+ ++ TR+++  +  S+L  +    I +  G+  L +       
Sbjct: 121 LSSAVAGSMTAIASNPIWVVNTRMTVAKSEQSTL--AVLLDIVRKDGVTALFNGLR---- 174

Query: 187 XXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQ---PSWKSNLYKLTIGAIS 243
                       +L +V    + + V+EQL+   +  S +    PSW        +GA+ 
Sbjct: 175 -----------PALMLVSNPIIQYTVFEQLKNVVLKWSGSDVLLPSWA-----FLLGAVG 218

Query: 244 GGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLF 303
              A   TYP+  L+ R  +    G E      S+W  +V I + EG+ G Y G+   L 
Sbjct: 219 KLAATGSTYPYITLKTRMHL--AKGKEDADTQQSMWSLMVDIVKKEGIQGLYHGIGVKLT 276

Query: 304 KVVPSTA 310
           + + + A
Sbjct: 277 QSILTAA 283

 Score = 34.7 bits (78), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 46/98 (46%), Gaps = 1/98 (1%)

Query: 223 SSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDAL 282
           S+ A P+    L     GA  G ++  +T P   L  R QV +    E G R  S  +A+
Sbjct: 6   SNTANPAEVDELVHAVAGAGGGALSMALTMPLVTLATRMQV-SEQDKEPGTRSKSKLEAV 64

Query: 283 VTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVC 320
             I R EGV G+Y GL + ++ +  ++   +  YE+  
Sbjct: 65  REIYRKEGVVGFYYGLESAMYGMAANSLNYYYFYELAA 102

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 63.2 bits (152), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 67/276 (24%), Positives = 112/276 (40%), Gaps = 37/276 (13%)

Query: 61  RGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQL 120
           +G    +R++   EG   L+RG G+  +   P + V F  YEA +      + +    +L
Sbjct: 81  QGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALR------DNSPLASRL 134

Query: 121 TNTQRLFSGALCGGCSVVATYPLDLIKTRL-SIQTANLSSLNRSKAKSISKPPGIWQLLS 179
                L  GA     +     PL+L++TRL S+  A      R   ++I     I  LL 
Sbjct: 135 PVANPLVCGAFARILAATTIAPLELLRTRLQSVPRA------RDTERTIYL---IGDLLR 185

Query: 180 ETXXXXXXX------XXXXXXVWPTSLGVVPYVALNFAVYEQLR-EFGVNSSDAQ--PSW 230
           E                    +W      VP+ A+ +  YE  + +F    +      +W
Sbjct: 186 EMRHEVSVMGYRALFKGLEITLWRD----VPFSAIYWGTYEFCKTQFWARHAATHNASNW 241

Query: 231 KSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNEL--GFRYTSVWDA------L 282
              +     G++ G VA  +T+PFD+ + R Q+      +L  G + T   D+      L
Sbjct: 242 DHFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFL 301

Query: 283 VTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318
             I ++EG+   Y GL   + K+ PS A+    YE+
Sbjct: 302 NAIRKSEGIRALYTGLLPRVMKIAPSCAIMISTYEL 337

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 85/203 (41%), Gaps = 10/203 (4%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIF---SSIRQVYHE---EGTKGL 79
            + G  A  ++ T ++P E ++  LQ         R I+     +R++ HE    G + L
Sbjct: 140 LVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSVMGYRAL 199

Query: 80  FRGNGLNCIRIFPYSAVQFVVYEACKKKLF--HVNGNNGQEQLTNTQRLFSGALCGGCSV 137
           F+G  +   R  P+SA+ +  YE CK + +  H   +N             G++ G  + 
Sbjct: 200 FKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGSMGGAVAA 259

Query: 138 VATYPLDLIKTRLSIQTANLSSLN-RSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVW 196
           + T+P D+ KTR+ I  A+   L    KA       G++  L+               + 
Sbjct: 260 LLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGIRALYTGLL- 318

Query: 197 PTSLGVVPYVALNFAVYEQLREF 219
           P  + + P  A+  + YE  ++F
Sbjct: 319 PRVMKIAPSCAIMISTYELSKKF 341

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 12/94 (12%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVKILLQV------------QSSTTSYNRGIFSSIRQVYH 72
           +F  G + GAV+  +  PF+  K  +Q+            +++ T  +RG+FS +  +  
Sbjct: 247 SFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRK 306

Query: 73  EEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKK 106
            EG + L+ G     ++I P  A+    YE  KK
Sbjct: 307 SEGIRALYTGLLPRVMKIAPSCAIMISTYELSKK 340

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 78/313 (24%), Positives = 129/313 (41%), Gaps = 51/313 (16%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNG 84
           +FLAG +AGA    +  PFE  K  LQ+    +  +R     I +    +G   ++ G  
Sbjct: 15  SFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGIGSIYVGCP 74

Query: 85  LNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGC-SVVATYPL 143
              I     + ++F+ ++  K  L     ++   +L+ T+ + +G   G   SV A  P 
Sbjct: 75  AFIIGNTAKAGIRFLGFDTIKDMLR----DSETGELSGTRGVIAGLGAGLLESVAAVTPF 130

Query: 144 DLIKTRL--SIQTA-------------NLSSLNRSKAKSISKPPGIWQLLSETXXXXXXX 188
           + IKT L    Q+A             N SSL R K  S     G+++            
Sbjct: 131 EAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFS-----GLYR------------ 173

Query: 189 XXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLT--IGAISGGV 246
                 V P S+      A+    Y +++    + +D+ P  K     LT  +GA SG V
Sbjct: 174 -----GVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDS-PKDKPLSSGLTFLVGAFSGIV 227

Query: 247 AQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVV 306
               T P D ++ R Q L         +Y+S  +   TI + EG+  ++KG    L ++V
Sbjct: 228 TVYSTMPLDTVKTRMQSLD------STKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLV 281

Query: 307 PSTAVSWLVYEVV 319
            S  + + +YE V
Sbjct: 282 LSGGIVFTIYEKV 294

 Score = 32.3 bits (72), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 42/102 (41%), Gaps = 10/102 (9%)

Query: 223 SSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDAL 282
           SS A  S    L+    G+++G     ITYPF+  + R Q++            +  + L
Sbjct: 2   SSKATKSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASK-------ASRNPL 54

Query: 283 VTI---GRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVCD 321
           V I    + +G+   Y G  A +        + +L ++ + D
Sbjct: 55  VLIYKTAKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKD 96

>Scas_489.4
          Length = 297

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 127/309 (41%), Gaps = 35/309 (11%)

Query: 21  DSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLF 80
           D   +F+AG +AGA+  ++  PFE  K  LQ+   T++ +R     I      +GT  ++
Sbjct: 9   DPLHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVLIYNTAKTQGTGAIY 68

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFH-VNGNNGQEQLTNTQRLFSGALCGGC-SVV 138
            G     +     + ++F+ ++  K  L   V G     +L+  + + +G   G   SVV
Sbjct: 69  VGCPAFIVGNTAKAGIRFLGFDTIKNMLRDPVTG-----ELSGPRGVVAGLGAGLLESVV 123

Query: 139 ATYPLDLIKTRLSIQTANLSSLNRSKAK-------SISKPPGIWQLLSETXXXXXXXXXX 191
           A  P + IKT L      L    ++  +       S+ +  GI  L              
Sbjct: 124 AVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYR------------ 171

Query: 192 XXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWK-SNLYKLTIGAISGGVAQTI 250
              V P S+      A+    Y +++    + ++A      S+     +GA SG V    
Sbjct: 172 --GVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYT 229

Query: 251 TYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTA 310
           T P D ++ R Q L         +YTS  +    I + EG+  ++KG    L +++ S  
Sbjct: 230 TMPIDTVKTRMQSLD------ATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGG 283

Query: 311 VSWLVYEVV 319
           + + +YE V
Sbjct: 284 IVFTIYENV 292

>Kwal_26.7967
          Length = 297

 Score = 62.0 bits (149), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 73/301 (24%), Positives = 130/301 (43%), Gaps = 27/301 (8%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNG 84
           +FLAG +AGAV  ++  PFE  K  LQ+   +++ +R   + I +    +G   ++ G  
Sbjct: 12  SFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQGLGAVYVGCP 71

Query: 85  LNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGC-SVVATYPL 143
              +     + V+F+ ++A K  L     +    +L+  + + +G   G   SVVA  P 
Sbjct: 72  AFIVGNTAKAGVRFLGFDAIKNILR----DPTTGELSGPRGIVAGLGAGLLESVVAVTPF 127

Query: 144 DLIKTRL--SIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLG 201
           + IKT L    Q+A+    N  +        G+ +  S +             V P S+ 
Sbjct: 128 EAIKTALIDDKQSASPKYHNNGR--------GMLRNYS-SLVYDKGFSGLYRGVLPVSMR 178

Query: 202 VVPYVALNFAVYEQLREF---GVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLR 258
                A+    Y +++       NS+  +P   S+     +GA SG V    T P D ++
Sbjct: 179 QAANQAVRLGCYNKIKTMIQDYTNSAKDKP--LSSGMTFVVGAFSGIVTVYTTMPIDTVK 236

Query: 259 RRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318
            R Q L         +Y+S  +   T+ R EG+  ++KG    L +++ S  + + +YE 
Sbjct: 237 TRMQSLDSS------KYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIYEK 290

Query: 319 V 319
           V
Sbjct: 291 V 291

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 20/31 (64%)

Query: 234 LYKLTIGAISGGVAQTITYPFDLLRRRFQVL 264
           L+    G+++G V  +ITYPF+  + R Q++
Sbjct: 10  LHSFLAGSLAGAVEASITYPFEFAKTRLQLV 40

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 62.4 bits (150), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 127/285 (44%), Gaps = 37/285 (12%)

Query: 50  LQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLF 109
           L +Q++T  + +   S I  VY +EG + LF+G G N + + P  ++ F  Y    K ++
Sbjct: 112 LTLQAAT--HFKETVSIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFFTY-GTTKDIY 168

Query: 110 HVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSK---AK 166
               NNGQE       L + A  G  +  AT P+ ++KTR+ +  A  +   ++     K
Sbjct: 169 SKAFNNGQE--APWIHLMAAATAGWATATATNPIWMVKTRVQLDKAGKTRTYKNSYDCLK 226

Query: 167 SISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDA 226
           SI +  GI+ L                    + LG V  + L + +YEQL+      S  
Sbjct: 227 SILRNEGIYGLYRGLSA--------------SYLGSVEGI-LQWLLYEQLKHLIKKRSIE 271

Query: 227 QPSWKSNLYKLTIGAI------SGG------VAQTITYPFDLLRRRFQVLAMGGNELGFR 274
           +          T   I      SGG      +A  +TYP +++R R +   +   ++  +
Sbjct: 272 KFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVVRTRLRQSPLENGKV--K 329

Query: 275 YTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVV 319
           YT +  +   I + EG++  Y GL  +L + VP++ + +  +EVV
Sbjct: 330 YTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEVV 374

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 38/94 (40%), Gaps = 22/94 (23%)

Query: 250 ITYPFDLLRRRFQ-------------VLAMGGNE-----LGFRYTSVWDALVTI----GR 287
           +T PFDL++ R Q              L M         L  +  + +   V+I     R
Sbjct: 73  VTCPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYR 132

Query: 288 AEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVCD 321
            EG    +KGL  NL  V+P+ ++++  Y    D
Sbjct: 133 QEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKD 166

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 116/259 (44%), Gaps = 31/259 (11%)

Query: 67  IRQVYH-EEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNG-----QEQL 120
           IR ++  ++  + L+RG G+N +      A+ F  Y   K       GN         +L
Sbjct: 52  IRDIFERQQWGRELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRL 111

Query: 121 TNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSI-SKPPGIWQLLS 179
                + +    G  + V T P+ +IKTR+         +  S+A    S   G+++L  
Sbjct: 112 PAHAYMLAAGSSGIATAVLTNPIWVIKTRI---------MATSRAGPYKSTFDGVYKLYQ 162

Query: 180 ETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLT- 238
                          V P+ LGV    A+ FA+Y+ L+   ++SS  +   + ++ ++  
Sbjct: 163 -----TEGVLAFWRGVVPSLLGV-SQGAIYFALYDTLKFHYLHSSTDKAERRLSVSEIIG 216

Query: 239 IGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGL 298
           I  IS  ++ T  YPF LL+ + Q             + +   + T+   EG+ G+Y+GL
Sbjct: 217 ITCISKMISVTSVYPFQLLKSKLQDFGAP--------SGITQLVQTVYSREGIRGFYRGL 268

Query: 299 AANLFKVVPSTAVSWLVYE 317
           +ANL + VP+T +++ VYE
Sbjct: 269 SANLLRAVPATCITFFVYE 287

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 4/78 (5%)

Query: 31  VAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRI 90
           ++  +S T V PF+ +K  LQ   + +    GI   ++ VY  EG +G +RG   N +R 
Sbjct: 220 ISKMISVTSVYPFQLLKSKLQDFGAPS----GITQLVQTVYSREGIRGFYRGLSANLLRA 275

Query: 91  FPYSAVQFVVYEACKKKL 108
            P + + F VYE  K +L
Sbjct: 276 VPATCITFFVYENIKYRL 293

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/266 (26%), Positives = 120/266 (45%), Gaps = 29/266 (10%)

Query: 67  IRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRL 126
           I  VY +EG + LF+G G N + + P  ++ F  Y    K ++    NNGQE  T    L
Sbjct: 123 IGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTY-GTTKDMYAKAFNNGQE--TPMIHL 179

Query: 127 FSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXX 186
            + A  G  +  AT P+ LIKTR+ +  A  +S+ + K          W  L ++     
Sbjct: 180 MAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNS--------WDCL-KSVIRNE 230

Query: 187 XXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAI---- 242
                   +  + LG V  + L + +YEQ++      S  +  +++   K T   +    
Sbjct: 231 GFTGLYKGLSASYLGSVEGI-LQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWC 289

Query: 243 ----SGGVAQTI----TYPFDLLRRRFQVLAMGGNELGFR-YTSVWDALVTIGRAEGVSG 293
               S G+A+ +    TYP +++R R   L     E G R YT +  +   I + EG+  
Sbjct: 290 QRSGSAGLAKFVASIATYPHEVVRTR---LRQTPKENGKRKYTGLVQSFKVIIKEEGLFS 346

Query: 294 YYKGLAANLFKVVPSTAVSWLVYEVV 319
            Y GL  +L + VP++ + +  +E+V
Sbjct: 347 MYSGLTPHLMRTVPNSIIMFGTWEIV 372

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 37/94 (39%), Gaps = 22/94 (23%)

Query: 250 ITYPFDLLRRRFQV-------------LAMGGN---------ELGFRYTSVWDALVTIGR 287
           +T PFDL++ R Q              ++ G           + G  +      +  + +
Sbjct: 69  VTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVYK 128

Query: 288 AEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVCD 321
            EG    +KGL  NL  V+P+ ++++  Y    D
Sbjct: 129 QEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKD 162

>Scas_697.47
          Length = 328

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/317 (23%), Positives = 128/317 (40%), Gaps = 39/317 (12%)

Query: 12  NSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQV--QSSTTSYNRGIFSSIRQ 69
           N+I+D LK     + +AGGV G  +     PF+ +K+  Q    SST    + I    R 
Sbjct: 31  NAIRDNLK-----SLVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARA 85

Query: 70  VYHE----EGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQR 125
           +          KG ++G     + + P  AV F  Y+  KK +     ++   QLT  Q 
Sbjct: 86  IPTSNMLVNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIV--TRSDSSSAQLTMGQM 143

Query: 126 LFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXX 185
             +G +    + + T P + IK  L    AN  +     AK+I K  G+  L   +    
Sbjct: 144 AAAGFISAIPTTLVTAPTERIKVVLQTAGANSKTSFIGAAKNIVKDGGVKSLFKGSLATL 203

Query: 186 XXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGG 245
                             P  AL FA YE  ++F +N  +A    K+    +    ++GG
Sbjct: 204 ARDG--------------PGSALYFASYEISKKF-LNDRNATAESKTGEVNIANVCLAGG 248

Query: 246 VAQT----ITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAAN 301
           +A      + +P D ++ + Q      +  G +        + + R  G+ G++ GL   
Sbjct: 249 IAGMSMWLVVFPIDTIKTKLQ------SSSGSQSMVAATREIYVKRG-GIKGFFPGLGPA 301

Query: 302 LFKVVPSTAVSWLVYEV 318
           L +  P+ A ++L  E+
Sbjct: 302 LLRSFPANAATFLGVEL 318

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 49/98 (50%), Gaps = 7/98 (7%)

Query: 8   LEQPNSIKDFLKQDSNIA--FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFS 65
           L   N+  +    + NIA   LAGG+AG     VV P + +K  LQ  S + S    + +
Sbjct: 224 LNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQSSSGSQS----MVA 279

Query: 66  SIRQVYHEE-GTKGLFRGNGLNCIRIFPYSAVQFVVYE 102
           + R++Y +  G KG F G G   +R FP +A  F+  E
Sbjct: 280 ATREIYVKRGGIKGFFPGLGPALLRSFPANAATFLGVE 317

>Kwal_26.7653
          Length = 325

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 122/302 (40%), Gaps = 44/302 (14%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFS----SIRQVYHEEGTKGLF 80
           +F+AGG+A  ++ TV +P E VK  +Q+Q   ++  + I+     +++ ++  EG +GL 
Sbjct: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86

Query: 81  RG--------NGLNCIRIFPYSAVQFVVYEACKKKLFH--VNGNNGQEQLTNTQRLFSGA 130
           +G         GLN  R+  Y  ++ V+      K F+  ++ +  Q    N   + SGA
Sbjct: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVL-----NKTFYPAMDPHKVQNVAVN---VVSGA 138

Query: 131 LCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXX 190
             G    +   PL LIKTR+       S  N  +    +    IW  LS           
Sbjct: 139 TSGIIGAIMGSPLFLIKTRMQ------SYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGL 192

Query: 191 ---XXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVA 247
                  +  T  G     ++   +Y   + F +     +     +L   T+     GV 
Sbjct: 193 YRGVDAAILRTGAG----SSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGV- 247

Query: 248 QTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVP 307
             +  P+D++  R        N+ G  Y    D  V   R EG+   YKG  A +F++ P
Sbjct: 248 --VMNPWDVILTRVY------NQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299

Query: 308 ST 309
            T
Sbjct: 300 HT 301

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 88/214 (41%), Gaps = 34/214 (15%)

Query: 118 EQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNR------SKAKSISKP 171
           ++++ T    +G +    +V  T P++L+KTR+ +Q    +   R         K I K 
Sbjct: 20  QKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKN 79

Query: 172 PGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALN---FAVYEQLREFGVNSS---D 225
            GI  L                     S   +  + LN      YE +R   +N +    
Sbjct: 80  EGIRGLQKGL-----------------SCAYIYQIGLNGSRLGFYEPIRSV-LNKTFYPA 121

Query: 226 AQPSWKSNL-YKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELG--FRYTSVWDAL 282
             P    N+   +  GA SG +   +  P  L++ R Q  +    ++G    YTS+W+ L
Sbjct: 122 MDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYS-NAIQIGQQTHYTSIWNGL 180

Query: 283 VTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVY 316
            +I RAEG  G Y+G+ A + +    ++V   +Y
Sbjct: 181 SSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIY 214

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 64/143 (44%), Gaps = 9/143 (6%)

Query: 20  QDSNIAFLAGGVAGAVSRTVVSPFERVKILLQ-----VQSSTTSYNRGIFSSIRQVYHEE 74
           Q+  +  ++G  +G +   + SP   +K  +Q     +Q    ++   I++ +  +Y  E
Sbjct: 128 QNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAE 187

Query: 75  GTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGG 134
           G KGL+RG     +R    S+VQ  +Y   K  L     ++  ++ T    + S     G
Sbjct: 188 GFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLK---HDLMKEGTGLHLVASTVSGFG 244

Query: 135 CSVVATYPLDLIKTRLSIQTANL 157
             VV   P D+I TR+  Q  NL
Sbjct: 245 VGVVMN-PWDVILTRVYNQKGNL 266

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 71/318 (22%), Positives = 126/318 (39%), Gaps = 33/318 (10%)

Query: 7   VLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSS 66
           V+E    +  F K   ++   +G V G     V  PF+ +K+ LQ    T   N   + +
Sbjct: 11  VVEDLTDLHGFRKTLKDV--FSGTVGGVAQVLVGQPFDIIKVRLQ----TMPGNATAWEA 64

Query: 67  IRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNG--QEQLTNTQ 124
           I  +   EG  G ++G     + +    + QF + EA K+    +N + G     L+  Q
Sbjct: 65  ITDLVKYEGFMGFYKGTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQ 124

Query: 125 RLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXX 184
               G + G  + +   P++ ++ RL +Q   L++         ++     +LL +    
Sbjct: 125 YYTCGFVSGSANALLATPIEHVRIRLQLQKEALANAEYKSTLDCTE-----KLLKQ---- 175

Query: 185 XXXXXXXXXXVWPTSLGVVPYVALNFAVYEQL----REFGVNSSDAQPSWKSNLYKLTIG 240
                     +  TS G   Y    F  YE L       G    D   +WK+ ++    G
Sbjct: 176 GSLMRGFTATLMRTSHGFGIY----FLTYETLIASQLAHGFRREDIS-AWKACMF----G 226

Query: 241 AISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAA 300
           A+SG     +TYPFD+++   Q   +     G   T+V      I R  G+  + KG   
Sbjct: 227 ALSGAFFWAMTYPFDVVKSVMQADKLVNPAYG---TNVVQVAKNIYRERGLRAFTKGFMP 283

Query: 301 NLFKVVPSTAVSWLVYEV 318
            + + +P    ++  +EV
Sbjct: 284 TMLRSLPVNGATFAAFEV 301

 Score = 31.6 bits (70), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 39/201 (19%), Positives = 77/201 (38%), Gaps = 28/201 (13%)

Query: 124 QRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXX 183
           + +FSG + G   V+   P D+IK RL     N ++               W+ +++   
Sbjct: 26  KDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNATA---------------WEAITDLVK 70

Query: 184 XXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNL---YKLTIG 240
                      + P  +GV   V+  F + E ++ +  + + ++  + + L      T G
Sbjct: 71  YEGFMGFYKGTMAPL-VGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCG 129

Query: 241 AISGGVAQTITYPFDLLRRRFQVL--AMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGL 298
            +SG     +  P + +R R Q+   A+   E    Y S  D    + +   +    +G 
Sbjct: 130 FVSGSANALLATPIEHVRIRLQLQKEALANAE----YKSTLDCTEKLLKQGSL---MRGF 182

Query: 299 AANLFKVVPSTAVSWLVYEVV 319
            A L +      + +L YE +
Sbjct: 183 TATLMRTSHGFGIYFLTYETL 203

>Kwal_0.232
          Length = 274

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 73/141 (51%), Gaps = 15/141 (10%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKG----LFRGN 83
           AG +A  + R    P E +K   Q   S +S       +++++   E  +G    L+RG 
Sbjct: 104 AGEIAACMVRV---PAEVIKQRTQTHKSDSS-----LQTLKKLLQNENGEGIRRNLYRGW 155

Query: 84  GLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPL 143
               +R  P++ +QF +YE  KK+ + ++G  G+EQ+   Q  F G + GG +   T PL
Sbjct: 156 STTVMREIPFTCIQFPLYEFLKKQ-WAISG--GREQVAPWQGAFCGCVAGGIAAATTTPL 212

Query: 144 DLIKTRLSIQTANLSSLNRSK 164
           D++KTRL +   ++  L+ ++
Sbjct: 213 DVLKTRLMLSHTSVPVLHLAR 233

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/246 (21%), Positives = 100/246 (40%), Gaps = 40/246 (16%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNG 84
           + LAG  AG  +     P + +K  LQ          G F++        G  G++RG G
Sbjct: 9   SLLAGAAAGTSTDLFFFPIDTLKTRLQAAG-------GFFAN-------GGYLGVYRGLG 54

Query: 85  LNCIRIFPYSAVQFVVYEACK---KKLFHVNGNNGQEQLTNTQ-RLFSGALCGGCSVVAT 140
              +   P +++ FV Y+  K   + +F+ N     +Q+  T   +FS +     + +  
Sbjct: 55  SAVVASAPSASLFFVTYDGMKSYSRPIFN-NLITSSDQVAETATHMFSSSAGEIAACMVR 113

Query: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTS- 199
            P ++IK R     ++ S     K        GI + L                 W T+ 
Sbjct: 114 VPAEVIKQRTQTHKSDSSLQTLKKLLQNENGEGIRRNLYRG--------------WSTTV 159

Query: 200 LGVVPYVALNFAVYEQLR-EFGVNSSDAQPS-WKSNLYKLTIGAISGGVAQTITYPFDLL 257
           +  +P+  + F +YE L+ ++ ++    Q + W+        G ++GG+A   T P D+L
Sbjct: 160 MREIPFTCIQFPLYEFLKKQWAISGGREQVAPWQGAF----CGCVAGGIAAATTTPLDVL 215

Query: 258 RRRFQV 263
           + R  +
Sbjct: 216 KTRLML 221

>Kwal_55.21338
          Length = 323

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 115/279 (41%), Gaps = 29/279 (10%)

Query: 35  VSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYS 94
           +S T+  P   V   LQ Q +       +  +I+ +Y ++G  G F G           +
Sbjct: 35  ISMTLTYPLIVVTTKLQTQDAKGE-KLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSN 93

Query: 95  AVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQT 154
            V +  YEA  + +         ++LT  + +  G++ G  +  A  PL +  TR+++Q 
Sbjct: 94  FVYYYCYEASSRCVLRARHT---QRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQK 150

Query: 155 ANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYE 214
           ++  +L  S    I K  GI  L                   P  + V+  + + + VYE
Sbjct: 151 SDRGTL--STIFDIVKDEGISGLFKGLN--------------PALILVINPI-IQYTVYE 193

Query: 215 QLREFGVNSSDAQ---PSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNEL 271
           QL+ + ++S   +   PSW        +GA+    A   TYP+  ++ R  +L    +  
Sbjct: 194 QLKNWILSSRQTRTLSPSWA-----FILGAVGKLAATGSTYPYVTMKARMHLLGEHKSST 248

Query: 272 GFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTA 310
                S+   +  I + +G+ G Y+G+   L + + + A
Sbjct: 249 AAPPRSLLSLMAEIIKKDGILGLYRGIGIKLVQSILTAA 287

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 246 VAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKV 305
           ++ T+TYP  ++  + Q     G +L     S+ D +  I R +G  G++ GL + LF  
Sbjct: 35  ISMTLTYPLIVVTTKLQTQDAKGEKL-----SLADTIKDIYRKDGAMGFFAGLESALFGT 89

Query: 306 VPSTAVSWLVYE 317
             S  V +  YE
Sbjct: 90  TLSNFVYYYCYE 101

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 4/82 (4%)

Query: 25  AFLAGGVAGAVSRTVVSPF----ERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLF 80
           AF+ G V    +     P+     R+ +L + +SST +  R + S + ++  ++G  GL+
Sbjct: 213 AFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPPRSLLSLMAEIIKKDGILGLY 272

Query: 81  RGNGLNCIRIFPYSAVQFVVYE 102
           RG G+  ++    +A  F   E
Sbjct: 273 RGIGIKLVQSILTAAFLFFFKE 294

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 118/301 (39%), Gaps = 30/301 (9%)

Query: 26  FLAGGVAGAVSRTVVSPFERVK--ILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGN 83
           F AG VAG     V+ P + VK  + LQVQ     +  G+   ++++   EG   L++G 
Sbjct: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74

Query: 84  GLNCIRIFPYSAVQFVV---YEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
               +   P  A +F     ++   K+ F      G E+L+    + +GA  G       
Sbjct: 75  SSPILMEAPKRATKFACNDEFQKLYKQAF------GVEKLSQPLSMLAGASAGCVEAFVV 128

Query: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSL 200
            P +L+K RL           +  + S   P  + + +                +W  +L
Sbjct: 129 VPFELVKIRL-----------QDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHAL 177

Query: 201 GVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRR 260
               Y    F +  Q R     + +      ++L   +IG   G +  T   PFD+++ R
Sbjct: 178 WNGGY----FGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST---PFDVVKSR 230

Query: 261 FQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVC 320
            Q  A+    +  +Y     +L+TI R EG    YKG    + ++ P   +  +V+  V 
Sbjct: 231 IQNTAVIPGVVR-KYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVL 289

Query: 321 D 321
           D
Sbjct: 290 D 290

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 234 LYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSG 293
           LY+   GA++G     + YP D+++ R Q+   GG   G  YT V D L  I   EGV  
Sbjct: 12  LYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGA--GPHYTGVVDCLKKIVAGEGVGR 69

Query: 294 YYKGLAANLFKVVPSTAVSW 313
            YKG+++ +    P  A  +
Sbjct: 70  LYKGISSPILMEAPKRATKF 89

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 70/135 (51%), Gaps = 13/135 (9%)

Query: 19  KQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKG 78
           K    ++ LAG  AG V   VV PFE VKI  ++Q +++SY +G    +R++   EG   
Sbjct: 107 KLSQPLSMLAGASAGCVEAFVVVPFELVKI--RLQDASSSY-KGPVDVVRKIVAREGVLA 163

Query: 79  LFRGNGLNCIRIFPYSAVQF-VVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSV 137
           ++ G      R   ++   F ++++A   +      +N  + +TN   L S ++  GCS+
Sbjct: 164 MYNGLESTLWRHALWNGGYFGIIFQA---RALLPAAHNKTQCITND--LISDSI--GCSI 216

Query: 138 --VATYPLDLIKTRL 150
             + + P D++K+R+
Sbjct: 217 GCMLSTPFDVVKSRI 231

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 74/185 (40%), Gaps = 29/185 (15%)

Query: 125 RLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXX 184
           + F+GA+ G   ++  YPLD++KTR+ +Q    +  + +         G+   L +    
Sbjct: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYT---------GVVDCLKKIVAG 64

Query: 185 XXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLRE-----FGVNSSDAQPSWKSNLYKLTI 239
                       P  L   P  A  FA  ++ ++     FGV    +QP        +  
Sbjct: 65  EGVGRLYKGISSPI-LMEAPKRATKFACNDEFQKLYKQAFGVEKL-SQP------LSMLA 116

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299
           GA +G V   +  PF+L++ R Q       +    Y    D +  I   EGV   Y GL 
Sbjct: 117 GASAGCVEAFVVVPFELVKIRLQ-------DASSSYKGPVDVVRKIVAREGVLAMYNGLE 169

Query: 300 ANLFK 304
           + L++
Sbjct: 170 STLWR 174

>Kwal_27.12599
          Length = 304

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 71/323 (21%), Positives = 124/323 (38%), Gaps = 53/323 (16%)

Query: 9   EQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIR 68
           +QP+     LK       LAG   G     V  PF+  K+ LQ  ++ T+        ++
Sbjct: 16  QQPHDSGRVLKD-----LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTT----AVEVVK 66

Query: 69  QVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFS 128
           ++   EG +G ++G     + +    + QF V EA  K+ F  +  +  + LT  Q    
Sbjct: 67  KLVKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAM-KRFFRGSSADPHKTLTLPQYYIC 125

Query: 129 GALCGGCSVVATYPLDLIKTRLSIQTAN---------LSSLNRSKAKSISKPPGIWQLLS 179
           G + G  +     P++ ++ RL  QTA+         L  +N+ +A        + + LS
Sbjct: 126 GFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRANG-----ALMRGLS 180

Query: 180 ETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLRE----FGVNSSDAQPSWKSNLY 235
                            PT L      A  F  YE L       G+  SD  P+WK  L+
Sbjct: 181 -----------------PTILREAQGCATYFLTYEALVANQIGKGIARSDV-PAWKLCLF 222

Query: 236 KLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYY 295
               GA+SG       YP D+++   Q   +       R  ++      +    G   ++
Sbjct: 223 ----GAVSGVTLWLTVYPLDVIKSLMQTDNLKNP---VRGKNIIQVARLVNAKYGWKSFF 275

Query: 296 KGLAANLFKVVPSTAVSWLVYEV 318
           KG    + +  P+   ++  +E+
Sbjct: 276 KGFGPTMLRAAPANGATFATFEL 298

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 127/309 (41%), Gaps = 35/309 (11%)

Query: 21  DSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLF 80
           D + +F+AG +AGAV  +V  PFE  K  LQ+    +  +R     I      +G   ++
Sbjct: 8   DPSKSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKTQGIGSVY 67

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGC-SVVA 139
            G     +     + V+F+ ++  K  L     +    +L+  + + +G   G   SVVA
Sbjct: 68  VGCPAFIVGNTAKAGVRFLGFDTIKNLLR----DPKTGELSGPRGVIAGLGAGLLESVVA 123

Query: 140 TYPLDLIKTRL--SIQTANLSSLNRSKA-----KSISKPPGIWQLLSETXXXXXXXXXXX 192
             P + IKT L    Q+A     N  K       ++ +  G+  L               
Sbjct: 124 VTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYR------------- 170

Query: 193 XXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWK--SNLYKLTIGAISGGVAQTI 250
             V P S+      A+    Y +++    + ++A P  K  S+     +GA SG V    
Sbjct: 171 -GVLPVSMRQAANQAVRLGCYNKIKVMVQDYTNA-PKDKPLSSGLTFVVGAFSGIVTVYT 228

Query: 251 TYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTA 310
           T P D ++ R Q L         RY+S  +   TI + EG+  ++KG    L ++  S  
Sbjct: 229 TMPIDTVKTRMQSLDSK------RYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGG 282

Query: 311 VSWLVYEVV 319
           + + VYE V
Sbjct: 283 IVFTVYEKV 291

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 60.1 bits (144), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 117/291 (40%), Gaps = 41/291 (14%)

Query: 50  LQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLF 109
           +Q ++S   +N   + +  ++   EG   L+RG  +  +   P + V F  YE  +    
Sbjct: 88  IQCKNSALRFN-STWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFR---- 142

Query: 110 HVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSIS 169
             + +  ++   +   LF GA     +     PL+LIKTRL        S+ RS+ K  +
Sbjct: 143 --DHSPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQ-------SIPRSR-KDTT 192

Query: 170 KPPGIWQLLSETXXXXXX------XXXXXXXVWPTSLGVVPYVALNFAVYEQLRE-FGVN 222
                  LL ET                   +W      VP+ A+ +  YE  ++ F ++
Sbjct: 193 TQMMFKDLLKETRNEIRSGGYKVLFKGLEITLWRD----VPFSAIYWGSYEFYKKNFWID 248

Query: 223 SSDA------QPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYT 276
            S+        P+W   +     G++SG  A  +T+PFD+ + R Q+     N+      
Sbjct: 249 FSEQCLRWNLSPNWDFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLV 308

Query: 277 S---------VWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318
           S         ++  L  I + EG    Y GL   + K+ PS A+    YE+
Sbjct: 309 SPKKRVSARGMFKFLYNIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYEL 359

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%)

Query: 272 GFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVCD 321
             R+ S W+A   I   EG++  ++GL+  L   +P+  V +  YE+  D
Sbjct: 94  ALRFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFRD 143

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 46/100 (46%), Gaps = 14/100 (14%)

Query: 25  AFLAGGVAGAVSRTVVSPFE----RVKILLQVQSSTTSY---------NRGIFSSIRQVY 71
           +F+ G V+G+ +  +  PF+    R++I + +++   +           RG+F  +  + 
Sbjct: 268 SFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIK 327

Query: 72  HEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHV 111
             EG   L+ G     ++I P  A+    YE   K+LF V
Sbjct: 328 QTEGYGALYTGLIPRVMKIAPSCAIMISTYE-LSKRLFAV 366

>Scas_721.129
          Length = 323

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 71/309 (22%), Positives = 123/309 (39%), Gaps = 42/309 (13%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQ----VYHEEGTKGLF 80
           +F+AGG+A  ++ T  +P E VKI +Q+Q    +  + ++ +  Q    ++  EG +GL 
Sbjct: 24  SFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRGLQ 83

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKL---FHVNGNNGQEQLTNTQRLFSGALCGGCSV 137
           +G     I     +  +   YE  +  L   F+ N  + + Q  +   + +GA  G    
Sbjct: 84  KGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSIN-VAAGASSGIIGA 142

Query: 138 VATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLS---ETXXXXXXXXXXXXX 194
           V   PL L+KTR+   +  +    ++  ++      +W  LS    T             
Sbjct: 143 VIGSPLFLVKTRMQSYSDAIKIGEQTHYRN------VWNGLSTIARTEGFKGLFRGIDAA 196

Query: 195 VWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYK------LTIGAISGGVAQ 248
           +  T  G     ++   +Y   + F           K++L K      LT   ISG    
Sbjct: 197 ILRTGAG----SSVQLPIYNTAKNF---------LLKNDLMKDGPGLHLTASTISGLGVA 243

Query: 249 TITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPS 308
            +  P+D++  R        N+ G  Y    D  V   R EG+S  YKG  A + ++ P 
Sbjct: 244 VVMNPWDVILTRIY------NQKGNLYKGPVDCFVKTVRTEGISALYKGFQAQILRIAPH 297

Query: 309 TAVSWLVYE 317
           T +     E
Sbjct: 298 TIICLTFME 306

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 19/96 (19%), Positives = 41/96 (42%), Gaps = 2/96 (2%)

Query: 16  DFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEG 75
           D +K    +   A  ++G     V++P++   IL ++ +   +  +G      +    EG
Sbjct: 222 DLMKDGPGLHLTASTISGLGVAVVMNPWD--VILTRIYNQKGNLYKGPVDCFVKTVRTEG 279

Query: 76  TKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHV 111
              L++G     +RI P++ +     E   K ++ V
Sbjct: 280 ISALYKGFQAQILRIAPHTIICLTFMEQTMKLVYSV 315

>Kwal_23.3529
          Length = 395

 Score = 60.1 bits (144), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 128/299 (42%), Gaps = 38/299 (12%)

Query: 38  TVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTK-GLFRGNGLNCIRIFPYSAV 96
           +V+   + VK   Q   +   Y R + S+ ++++ EEG + GL+ G     +  FP +A+
Sbjct: 101 SVMHSLDTVKTRQQGAPNAPKY-RNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAI 159

Query: 97  QFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTA- 155
            F  YE  K+KL    G N  E L++     SG L      V   P +++KTRL +Q   
Sbjct: 160 FFGTYELTKRKLIDDWGVN--ETLSHLTAGLSGDLVSSVVYV---PSEVLKTRLQLQGCY 214

Query: 156 ---------NLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYV 206
                    N  +L R    +I +  G WQ L                   T    +P+ 
Sbjct: 215 NNPHFHSGYNYRNL-RDAITAIVRLEG-WQTL-------------FFGYKATLCRDLPFS 259

Query: 207 ALNFAVYEQLREFGVNSSDAQPSWK-SNLYKLTIGAISGGVAQTITYPFDLLRRRFQ--- 262
           A  FA YE+ R++        PS   S L +L  GA +GG+A  IT P D+++ R Q   
Sbjct: 260 AFQFAFYEKFRQWAFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQM 319

Query: 263 --VLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVV 319
              +A     L     S+   L  + R+EG  G++ G+          +++  L+Y+V 
Sbjct: 320 PSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLYQVT 378

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 69/141 (48%), Gaps = 8/141 (5%)

Query: 21  DSNIAFLAGGVAGA-VSRTVVSPFERVKILLQVQSS------TTSYN-RGIFSSIRQVYH 72
           +  ++ L  G++G  VS  V  P E +K  LQ+Q         + YN R +  +I  +  
Sbjct: 178 NETLSHLTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIVR 237

Query: 73  EEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALC 132
            EG + LF G      R  P+SA QF  YE  ++  F + G    + L+    L +GA  
Sbjct: 238 LEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTLEGKTPSQDLSLLNELLTGAAA 297

Query: 133 GGCSVVATYPLDLIKTRLSIQ 153
           GG + + T P+D+IKTR+  Q
Sbjct: 298 GGLAGIITTPMDVIKTRIQTQ 318

 Score = 28.5 bits (62), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 32/79 (40%), Gaps = 9/79 (11%)

Query: 39  VVSPFERVKILLQVQSSTT---------SYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIR 89
           + +P + +K  +Q Q  +T              +   +  VY  EGT G F G G   I 
Sbjct: 304 ITTPMDVIKTRIQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIW 363

Query: 90  IFPYSAVQFVVYEACKKKL 108
               S++  ++Y+   K L
Sbjct: 364 TSIQSSIMLLLYQVTLKSL 382

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 75/318 (23%), Positives = 124/318 (38%), Gaps = 52/318 (16%)

Query: 22  SNIAFLAGGVAGAVSRTV-VSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLF 80
           S+   L GG AG +S  V + P + +K   Q     T     ++ +++ +   +    L+
Sbjct: 3   SSTGHLIGGFAGGLSSAVALQPLDLLKTRFQQTKGGT-----LWQTVKSL---DTPWQLW 54

Query: 81  RGNGLNCIRI-----FPYSAVQFVVYEACKKKLFH-----VNGNNGQ-EQLTNTQRLFSG 129
           RG   + IR         S++  +     K+K F      V G +    QL+  + L +G
Sbjct: 55  RGTLPSAIRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTG 114

Query: 130 ALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXX 189
           A   G     T P+ +IK R      N  S+  + AKSI+   GI               
Sbjct: 115 AFARGTVGYITMPITIIKVRYESTLYNYKSIAEA-AKSIAAQEGIRGFFR---------- 163

Query: 190 XXXXXVWPTSLGVVPYVALNFAVYEQLRE----------FGVNSSDAQPSWKSNLYKLTI 239
                  PT L   PY  L   +YE+L+             ++S     ++ S     T 
Sbjct: 164 ----GFGPTCLRDAPYSGLYVLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTS 219

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299
             +S  +A T+T PFD ++ R Q+          ++ + W  L TI   E     + GL+
Sbjct: 220 AILSASMATTVTAPFDTIKTRMQLEPT-------KFKTFWSTLTTIVTQEHPIKIFSGLS 272

Query: 300 ANLFKVVPSTAVSWLVYE 317
             L +   S  ++W +YE
Sbjct: 273 MRLTRKALSAGIAWGIYE 290

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 59.3 bits (142), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 76/308 (24%), Positives = 122/308 (39%), Gaps = 33/308 (10%)

Query: 21  DSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLF 80
           D   +FLAG +AGA+  ++  PFE  K  LQ+    +  +R     I       G   ++
Sbjct: 89  DPFHSFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSIY 148

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCG-GC---- 135
            G     +     + ++F+ ++  K  L        +++ T     F G + G G     
Sbjct: 149 VGCPAFIVGNTAKAGIRFLGFDTIKNLL--------RDKKTGELSGFRGVVAGLGAGLLE 200

Query: 136 SVVATYPLDLIKTRL--SIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXX 193
           SVVA  P + IKT L    Q A     N  K           +LLS+             
Sbjct: 201 SVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMV----SNYAKLLSD-----QGFSGLYR 251

Query: 194 XVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWK--SNLYKLTIGAISGGVAQTIT 251
            V P S+      A+    Y +++   V      P  K  S+     +GA SG V    T
Sbjct: 252 GVLPVSMRQAANQAVRLGCYNKIKTL-VQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTT 310

Query: 252 YPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAV 311
            P D ++ R Q L  G      +Y+S  +   TI + EG+  ++KG    L +++ S  +
Sbjct: 311 MPIDTVKTRMQSLNAG------QYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGI 364

Query: 312 SWLVYEVV 319
            + +YE V
Sbjct: 365 VFTIYEKV 372

>Kwal_56.23011
          Length = 303

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 77/325 (23%), Positives = 127/325 (39%), Gaps = 35/325 (10%)

Query: 1   MAEVLT---VLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTT 57
           M+E LT   V++      DF +   ++    G V G     V  PF+  K+ LQ     T
Sbjct: 1   MSEELTSPQVVDDLVDTHDFKQALKDV--FCGTVGGVAQVLVGQPFDITKVRLQTSPVPT 58

Query: 58  SYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQ 117
           +  + I S ++     EG    ++G       +    + QF V EA KK     +GN  Q
Sbjct: 59  TAAQVIKSLVK----NEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQ 114

Query: 118 EQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQL 177
             L   Q    G + G  +     P++ ++ RL +QTA+ S+     +   ++     +L
Sbjct: 115 P-LALRQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCAR-----KL 168

Query: 178 LSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQL----REFGVNSSDAQPSWKSN 233
           L +                 T+L       + F  YE L       GV   +  P+WK  
Sbjct: 169 LKQGALMRGFTA--------TTLRTSHGFGIYFLTYETLIANQAHHGVLRENI-PAWKVC 219

Query: 234 LYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSG 293
           +Y    GA SG     +TYPFD+++   Q   +     G    +V  A   I R  G   
Sbjct: 220 VY----GAFSGAFFWAMTYPFDVVKSVMQADKLKNPVYGRNPLAVAKA---IYRERGPRA 272

Query: 294 YYKGLAANLFKVVPSTAVSWLVYEV 318
           + KG    + + +P    ++  +E+
Sbjct: 273 FTKGFTPTMLRSLPVNGATFAAFEI 297

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 62/137 (45%), Gaps = 3/137 (2%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNC 87
           AG ++   +  V +P ER+K++LQ  S    +      + + +    G K LF G+    
Sbjct: 138 AGFISAIPTTLVTAPTERIKVVLQTNSE---FKGSFIKAAKHIVSTGGVKSLFNGSLATL 194

Query: 88  IRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIK 147
            R  P SA+ F  YE  K  L        ++++       +G + G    +  +P+D IK
Sbjct: 195 ARDGPGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIK 254

Query: 148 TRLSIQTANLSSLNRSK 164
           TRL + T  +S +  +K
Sbjct: 255 TRLQVATTPISMVQATK 271

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/311 (22%), Positives = 123/311 (39%), Gaps = 44/311 (14%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVK----------------ILLQVQSSTTSYNRGIFSSIR 68
           A +AGGV G  +     PF+ +K                I+L+   S ++ N  + +S+ 
Sbjct: 24  ALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGSLTTSL- 82

Query: 69  QVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFS 128
             + +   KG ++G     I + P  AV F  Y+  K+ +     ++    LT  Q   +
Sbjct: 83  --FFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQASDA--PLTTAQMATA 138

Query: 129 GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXX 188
           G +    + + T P + IK  L   +    S  ++ AK I    G+  L + +       
Sbjct: 139 GFISAIPTTLVTAPTERIKVVLQTNSEFKGSFIKA-AKHIVSTGGVKSLFNGSLATLARD 197

Query: 189 XXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTI-GAISGGVA 247
                          P  AL FA YE  + F   S   +   + NL  + + G I+G   
Sbjct: 198 G--------------PGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSM 243

Query: 248 QTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVP 307
             + +P D ++ R QV     + +     +  D  +  G   G+ G++ GL   L +  P
Sbjct: 244 WLVVFPIDTIKTRLQVATTPISMV----QATKDIYIQRG---GIKGFFPGLGPALLRSFP 296

Query: 308 STAVSWLVYEV 318
           + A ++L  E+
Sbjct: 297 ANAATFLGVEL 307

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 45/87 (51%), Gaps = 7/87 (8%)

Query: 19  KQDSNIA--FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEE-G 75
           K + N+A   LAGG+AG     VV P + +K  LQV ++  S    +  + + +Y +  G
Sbjct: 224 KDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRLQVATTPIS----MVQATKDIYIQRGG 279

Query: 76  TKGLFRGNGLNCIRIFPYSAVQFVVYE 102
            KG F G G   +R FP +A  F+  E
Sbjct: 280 IKGFFPGLGPALLRSFPANAATFLGVE 306

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 83/201 (41%), Gaps = 15/201 (7%)

Query: 122 NTQRLFSGALCGGCSVVATYPLDLIKTRL----SIQTANLSSLNRSKAKSISKPPGIWQL 177
           N + L +G + G C+V+  +P DLIK R     +  T +  S+   +A+S+S   G    
Sbjct: 21  NMKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGS--- 77

Query: 178 LSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKL 237
           L+ +             V P  +GV P  A++F  Y+  +   V    A  +  +     
Sbjct: 78  LTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRL-VTWKQASDAPLTTAQMA 136

Query: 238 TIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKG 297
           T G IS      +T P      R +V+    +E    +      +V+ G   GV   + G
Sbjct: 137 TAGFISAIPTTLVTAP----TERIKVVLQTNSEFKGSFIKAAKHIVSTG---GVKSLFNG 189

Query: 298 LAANLFKVVPSTAVSWLVYEV 318
             A L +  P +A+ +  YE+
Sbjct: 190 SLATLARDGPGSALYFASYEL 210

 Score = 32.3 bits (72), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 43/108 (39%), Gaps = 27/108 (25%)

Query: 229 SWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGR- 287
           +++ N+  L  G + G  A    +PFDL++ R Q           +  S  DA+  I + 
Sbjct: 17  AFRENMKALVAGGVGGVCAVLTGHPFDLIKVRCQ---------SNQAKSTMDAVSIILKE 67

Query: 288 -----------------AEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318
                               V G+YKG+   L  V P  AVS+  Y++
Sbjct: 68  ARSLSTVNGSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDI 115

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/299 (21%), Positives = 121/299 (40%), Gaps = 31/299 (10%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLN 86
            AG + G     V  PF+  K+ LQ    T+    G+   ++ +   EG    ++G    
Sbjct: 31  FAGTMGGVAQVLVGQPFDTTKVRLQ----TSKTKIGVIEVVQNLLRNEGALAFYKGMLTP 86

Query: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCG-GCSVVATY---P 142
            + +    +VQF V E+ K+     N +    Q      L    LCG    VV ++   P
Sbjct: 87  LLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAP 146

Query: 143 LDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGV 202
           ++ ++ RL  QT+      +   +    P    + L++              + PT +  
Sbjct: 147 IEHVRIRLQTQTS------QGNERQFKGPFDCIKKLAKAKALMRG-------LLPTMIRA 193

Query: 203 VPYVALNFAVYEQL--REFGVNSSDAQ-PSWKSNLYKLTIGAISGGVAQTITYPFDLLRR 259
              +   FA YE L  +EF   +   Q P+WK      + GA+SG +     YP D+++ 
Sbjct: 194 GHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKL----CSFGALSGTILWLTVYPVDVVKS 249

Query: 260 RFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318
             Q  ++   +      S+  A   + +  G+  ++KG    + +  P+ A +++ +E+
Sbjct: 250 VLQTDSIENPKYK---NSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEM 305

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 57/131 (43%), Gaps = 7/131 (5%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN--RGIFSSIRQVYHEEGTKGLFRGN 83
           +L G   G V+  + +P E V+I LQ Q+S  +    +G F  I+++      K L RG 
Sbjct: 130 YLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK---AKALMRGL 186

Query: 84  GLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPL 143
               IR        F  YEA   K F       + Q+   +    GAL G    +  YP+
Sbjct: 187 LPTMIRAGHGLGTYFAAYEALVVKEFE--KGTPRNQIPAWKLCSFGALSGTILWLTVYPV 244

Query: 144 DLIKTRLSIQT 154
           D++K+ L   +
Sbjct: 245 DVVKSVLQTDS 255

 Score = 34.7 bits (78), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 39/201 (19%), Positives = 76/201 (37%), Gaps = 26/201 (12%)

Query: 124 QRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXX 183
           + +F+G + G   V+   P D  K RL      +               G+ +++     
Sbjct: 28  KDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---------------GVIEVVQNLLR 72

Query: 184 XXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREF----GVNSSDAQPSWKSNLYKLTI 239
                      + P  LGV   V++ F V E ++ F      +  D Q      L++  +
Sbjct: 73  NEGALAFYKGMLTPL-LGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYL 131

Query: 240 GAISGGVAQT-ITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGL 298
             ++GGV  + +  P + +R R Q     GNE  F+    +D +  + +A+ +    +GL
Sbjct: 132 CGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFK--GPFDCIKKLAKAKAL---MRGL 186

Query: 299 AANLFKVVPSTAVSWLVYEVV 319
              + +        +  YE +
Sbjct: 187 LPTMIRAGHGLGTYFAAYEAL 207

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 61/306 (19%), Positives = 121/306 (39%), Gaps = 55/306 (17%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGN 83
           I+ L+G  AG  +  V  P + +K  LQ +                 +   G +G++RG 
Sbjct: 7   ISLLSGAAAGTSTDLVFFPIDTLKTRLQAKGG--------------FFRNGGYRGVYRGL 52

Query: 84  GLNCIRIFPYSAVQFVVYEACK---KKLFH--VNGNNGQEQLTNTQRLFSGALCGGCSVV 138
           G   +   P +++ F+ Y+ CK   +  F   +  +N  + +T+   +FS ++    + +
Sbjct: 53  GSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTH---MFSSSMGEIAACM 109

Query: 139 ATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXV--W 196
              P +++K R     ++ S                W+ L E                 W
Sbjct: 110 VRVPAEVVKQRSQTHASHSS----------------WETLREILKNENGEGVRRNLYRGW 153

Query: 197 PTS-LGVVPYVALNFAVYEQLREF--GVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYP 253
            T+ +  +P+  + F +YE +++    ++ SD    WK  +     G+I+GG+A   T P
Sbjct: 154 STTIMREIPFTCIQFPLYEYMKKVWAELDESDRVEPWKGAV----CGSIAGGIAAATTTP 209

Query: 254 FDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSW 313
            D L+ R  +          +   +   + TI + EG   ++ G+      +    A+  
Sbjct: 210 LDFLKTRLMLCK--------KSIPLGTLVSTIYKEEGFKVFFSGVGPRTMWISAGGAIFL 261

Query: 314 LVYEVV 319
            +YE V
Sbjct: 262 GIYETV 267

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 69/272 (25%), Positives = 111/272 (40%), Gaps = 30/272 (11%)

Query: 62  GIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLT 121
           G   +  ++   EG   L+RG  +  +   P + V F  YE  + +    +  NG     
Sbjct: 112 GTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDR----SPLNGLYPTI 167

Query: 122 NTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSET 181
           N   L  GA     +  +  PL+LIKT+L  Q+   SS+   K  S+     ++  +   
Sbjct: 168 NP--LICGAFARTLAATSVAPLELIKTKL--QSIPSSSM---KNGSVIMYRDLFNEIKSE 220

Query: 182 XXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLRE---------FGVNSSDAQPSWKS 232
                        +  T    VP+ A+ +A YE  +          F  NSS+    W  
Sbjct: 221 IAMRGVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSN----WFH 276

Query: 233 NLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELG---FRYTS---VWDALVTIG 286
                  G ISG +A   T+PFD+ + R Q+  +   +L     +Y S   ++  L  I 
Sbjct: 277 FTNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIR 336

Query: 287 RAEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318
           + EG+   Y GLA  + K+ PS A+    YE+
Sbjct: 337 KTEGIGALYTGLAPRVAKIAPSCAIMISSYEL 368

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 25/48 (52%)

Query: 274 RYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVCD 321
           ++    +A   I + EGV+  ++G++  L   +P+  V +  YE V D
Sbjct: 109 KFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRD 156

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 129/306 (42%), Gaps = 38/306 (12%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHE-EGT------K 77
           +F+AGGV G  +     PF+ +K+  Q      S    I + I++   + +GT      K
Sbjct: 38  SFVAGGVGGVCAVFTGHPFDLIKVRCQ-NGQANSTVHAITNIIKEAKTQVKGTLFTNSVK 96

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSV 137
           G ++G     + + P  AV F  Y+  KK +   N   G  +LT  Q   +G +    + 
Sbjct: 97  GFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGFISAIPTT 156

Query: 138 VATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWP 197
           + T P + +K  L  QT++  S  ++ AK+I K  GI  L   +                
Sbjct: 157 LVTAPTERVKVVL--QTSSKGSFIQA-AKTIVKEGGIASLFKGSLATLARDG-------- 205

Query: 198 TSLGVVPYVALNFAVYEQLREFGVNS----SDAQPSWKSNLYKLTI-GAISGGVAQTITY 252
                 P  AL FA YE  + + +NS     DA      N+  + + G I+G       +
Sbjct: 206 ------PGSALYFASYEISKNY-LNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVF 258

Query: 253 PFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVS 312
           P D ++ + Q  +   N L    ++  +  +  G   G+ G++ GL   L +  P+ A +
Sbjct: 259 PIDTIKTKLQASSTRQNML----SATKEIYLQRG---GIKGFFPGLGPALLRSFPANAAT 311

Query: 313 WLVYEV 318
           +L  E+
Sbjct: 312 FLGVEM 317

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 48/107 (44%), Gaps = 17/107 (15%)

Query: 224 SDAQPSWKSNLYKLTI-----GAISGGVAQTITYPFDLLRRRFQ-------VLAMGGNEL 271
           + ++P  KSN  +  I     G + G  A    +PFDL++ R Q       V A+  N +
Sbjct: 21  TKSRPPIKSNPVRENIKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAI-TNII 79

Query: 272 GFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318
               T V   L T      V G+YKG+   L  V P  AVS+  Y+V
Sbjct: 80  KEAKTQVKGTLFT----NSVKGFYKGVIPPLLGVTPIFAVSFWGYDV 122

>Kwal_27.11419
          Length = 298

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 75/314 (23%), Positives = 118/314 (37%), Gaps = 55/314 (17%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85
           F+ G V G  S  ++ PF+ +K  LQ   S+      +   +R +   E    L++G   
Sbjct: 11  FIGGFVGGLTSAVILQPFDLLKTRLQQNKSSN-----LLDVVRSI---ETPGQLWKGTLP 62

Query: 86  NCIRI-----FPYSAVQFVVYEACKKKLFHVNGNNGQE----QLTNTQRLFSGALCGGCS 136
           + +R         S +  V      K++  + G NG      QL+  + L SGA+     
Sbjct: 63  SALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAV 122

Query: 137 VVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVW 196
            VAT P+ ++K R      N  SL  + A  I +  GI  L S                 
Sbjct: 123 GVATMPITVLKVRFESTMYNYKSLGEA-ATHIYRSEGIRGLFSGCGA------------- 168

Query: 197 PTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSW-----KSNLYKLTIGAI--------S 243
            T +   PY  L    YEQ +   +      P W     +S ++      I        S
Sbjct: 169 -TVMRDAPYAGLYVLFYEQSK---LQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSS 224

Query: 244 GGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLF 303
             +A TIT PFD ++ R Q+          +Y        +I R E     + GL+  L 
Sbjct: 225 ASLATTITSPFDTIKTRMQLNPS-------QYYGFIQTFKSIIRYERPRNLFDGLSLRLS 277

Query: 304 KVVPSTAVSWLVYE 317
           +   S  ++W +YE
Sbjct: 278 RKALSAGIAWGIYE 291

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 67/151 (44%), Gaps = 13/151 (8%)

Query: 12  NSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN-RGIFSSIRQV 70
           N    FL Q S    L   ++GA++R  V        +L+V+  +T YN + +  +   +
Sbjct: 97  NGSSSFLPQLSMYENL---ISGAITRAAVGVATMPITVLKVRFESTMYNYKSLGEAATHI 153

Query: 71  YHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKL------FHVNGNNGQEQLTNTQ 124
           Y  EG +GLF G G   +R  PY+ +  + YE  K +L      + V  N      T T 
Sbjct: 154 YRSEGIRGLFSGCGATVMRDAPYAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTS 213

Query: 125 RLFSGALCGGCSVVATY---PLDLIKTRLSI 152
            + +       + +AT    P D IKTR+ +
Sbjct: 214 TIINSIAAFSSASLATTITSPFDTIKTRMQL 244

>Scas_558.2
          Length = 289

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 68/138 (49%), Gaps = 5/138 (3%)

Query: 21  DSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGT-KGL 79
           D+ +  +A  +    +  V  P E +K   QV S+ +S+    F +I +  ++EG  + L
Sbjct: 98  DTIVHMIASSMGELAACLVRVPAEVIKQRTQVHSTNSSWQ--TFRTILKNENQEGIIRNL 155

Query: 80  FRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVA 139
           +RG     +R  P++ +QF +YE  KK+    +   G   L   +    G++ GG +   
Sbjct: 156 YRGWSTTIMREIPFTCIQFPLYEFMKKEWALYDNEVGH--LKPWKGAICGSIAGGIAAAT 213

Query: 140 TYPLDLIKTRLSIQTANL 157
           T PLD +KTRL +   ++
Sbjct: 214 TTPLDFLKTRLMLNKDSI 231

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/251 (19%), Positives = 98/251 (39%), Gaps = 43/251 (17%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGN 83
           ++ L+G  AG  +  V  P + +K  LQ +                 +   G  G++RG 
Sbjct: 8   MSLLSGAAAGTSTDLVFFPIDTLKTRLQAKGG--------------FFQNGGYHGIYRGL 53

Query: 84  GLNCIRIFPYSAVQFVVYEACK-------KKLFHVNGNNGQEQLTNTQRLFSGALCGGCS 136
           G   +   P +++ FV Y++ K       +++ + +G      +     + + ++    +
Sbjct: 54  GSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGELAA 113

Query: 137 VVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVW 196
            +   P ++IK R  + + N S              GI + L                 W
Sbjct: 114 CLVRVPAEVIKQRTQVHSTNSSWQTFRTILKNENQEGIIRNLYRG--------------W 159

Query: 197 PTS-LGVVPYVALNFAVYEQLR-EFGV--NSSDAQPSWKSNLYKLTIGAISGGVAQTITY 252
            T+ +  +P+  + F +YE ++ E+ +  N       WK  +     G+I+GG+A   T 
Sbjct: 160 STTIMREIPFTCIQFPLYEFMKKEWALYDNEVGHLKPWKGAI----CGSIAGGIAAATTT 215

Query: 253 PFDLLRRRFQV 263
           P D L+ R  +
Sbjct: 216 PLDFLKTRLML 226

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/319 (21%), Positives = 127/319 (39%), Gaps = 46/319 (14%)

Query: 19  KQDSNIAFLAGGVAGA-VSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTK 77
           +Q      L GG +G  VS  ++ PF+ +K  LQ   ++T     ++ +++ +   E   
Sbjct: 3   EQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQQDKTST-----LWKTLKSI---ETPS 54

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFH-----VNGNNGQEQLTNTQRLFSGALC 132
            L+RG   +CIR    SA+   +  + ++ +         G++   QL   + +FSGA+ 
Sbjct: 55  QLWRGALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVT 114

Query: 133 GGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXX 192
              + + T P+ +IK R        +SL R     I +  G+                  
Sbjct: 115 RALTGLITMPITVIKVRYESTLYQYTSL-RYATSHIFRTEGLRGFF-------------- 159

Query: 193 XXVWPTSLGVVPYVALNFAVYEQLREF----------GVNSSDAQPSWKSNLYKLTIGAI 242
                T+L   PY  L    Y++++             +NS +   ++ S L   +    
Sbjct: 160 RGFGATALRDAPYAGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFS 219

Query: 243 SGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANL 302
           +  +A +IT PFD ++ R Q+          ++ S       I   E V   + G++  L
Sbjct: 220 AAVIATSITAPFDTVKTRMQLEPA-------KFHSFTSTFWHIATKESVRNLFAGISLRL 272

Query: 303 FKVVPSTAVSWLVYEVVCD 321
            +   S  ++W +YE +  
Sbjct: 273 TRKAFSAGIAWGIYEEIVK 291

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 117/304 (38%), Gaps = 39/304 (12%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQ-----SSTTSYNRGIFSSIRQVYHEEGTKGLF 80
           F++G  AG     V+ P + VK  +Q+Q      S  +YN G+   + Q+   EG   L+
Sbjct: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYN-GVIDCLGQIVKREGFSRLY 70

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
           +G     +   P  A +F   ++ +K    + G    ++LT    + SG+L G       
Sbjct: 71  KGISSPMLMEAPKRATKFACNDSYQKMFKDLYG---VDKLTQQISILSGSLAGVTEACVI 127

Query: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSL 200
            P +L+K RL    +  +       K+I +  GI  L +               +W  + 
Sbjct: 128 VPFELVKIRLQDVNSKFNGPMEVVFKTI-RETGILSLYN----------GLESTMWRNAF 176

Query: 201 GVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYP-----FD 255
               Y    F V  Q+R          P  K+N  K T   I+G +     Y        
Sbjct: 177 WNGGY----FGVIFQIRAL-------LPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILS 225

Query: 256 LLRRRFQVLA---MGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVS 312
           +++ R Q  A   +    +  +Y   W +L  I   EG +  YKG    + ++ P   + 
Sbjct: 226 VVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIM 285

Query: 313 WLVY 316
            +V+
Sbjct: 286 LVVF 289

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 62/144 (43%), Gaps = 12/144 (8%)

Query: 19  KQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQ-VQSSTTSYNRGIFSSIRQVYHEEGTK 77
           K    I+ L+G +AG     V+ PFE VKI LQ V S        +F +IR    E G  
Sbjct: 106 KLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIR----ETGIL 161

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSV 137
            L+ G      R   ++   F V    +  L     N   E+ TN   L +G + G C  
Sbjct: 162 SLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNT--EKTTND--LIAGTIGGYCRY 217

Query: 138 VATYP-LDLIKTRLSIQTANLSSL 160
              +  L ++K+R  IQ+   ++L
Sbjct: 218 STEHTILSVVKSR--IQSGATTTL 239

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 73/324 (22%), Positives = 125/324 (38%), Gaps = 39/324 (12%)

Query: 11  PNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQV 70
           PN  ++           AG + G     V  PF+  K+ LQ  ++ T+        +R +
Sbjct: 23  PNEKRELSSNRVLKDIFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTT----TLEVLRNL 78

Query: 71  YHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQ--------LTN 122
              EG    ++G     + +    +VQF V EA K+   + N +              +N
Sbjct: 79  VKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSN 138

Query: 123 TQRLFSGALCG-GCSVVATY---PLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLL 178
           T  L    +CG    VV ++   P++ I+ RL  QT+N         +    P   W  +
Sbjct: 139 TLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSN------GGDREFKGP---WDCI 189

Query: 179 SETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQL--REFGVN-SSDAQPSWKSNLY 235
            +              ++PT +     +   F VYE L  RE G   + +  P WK  L+
Sbjct: 190 KK----LKAQGGLMRGLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLF 245

Query: 236 KLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYY 295
               GA SG +     YP D+++   Q   +   +      S+     TI   EG+  ++
Sbjct: 246 ----GAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKY---KNSISYVAKTIYAKEGIRAFF 298

Query: 296 KGLAANLFKVVPSTAVSWLVYEVV 319
           KG    + +  P    ++L +E+V
Sbjct: 299 KGFGPTMVRSAPVNGATFLTFELV 322

>Kwal_23.2913
          Length = 320

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 59/124 (47%), Gaps = 8/124 (6%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLN 86
           LAG  +   +  + +P ERVK++LQ     TS +     + R +  E G + LF+G    
Sbjct: 146 LAGFFSAIPTTLITAPTERVKVVLQ-----TSESGSFLGAARTLIREGGVRSLFQGTLAT 200

Query: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLI 146
             R  P SA+ F  YE  K+ L   + N   + L+      +G + G    +  +P+D I
Sbjct: 201 LARDGPGSALYFASYEVSKRFL---SRNQDTDALSVVSICVAGGVAGMSMWIGVFPIDTI 257

Query: 147 KTRL 150
           KT+L
Sbjct: 258 KTKL 261

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 73/320 (22%), Positives = 125/320 (39%), Gaps = 58/320 (18%)

Query: 20  QDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGT--- 76
           +DS  +  AGGV G  +     PF+ +K+  Q   ++     G   +I +V HE  +   
Sbjct: 26  RDSFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQAS-----GTLDAISRVLHEAKSKSG 80

Query: 77  -------KGLFRGNGLNCIRIFPYSAVQFVVYEACKK-------KLFHVNGNNGQ-EQLT 121
                  KG +RG     + + P  AV F  Y+  K+        +  + G++ +   LT
Sbjct: 81  PLPLNQIKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLT 140

Query: 122 NTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSET 181
            +Q   +G      + + T P + +K  L  QT+   S     A+++ +  G+  L   T
Sbjct: 141 TSQLALAGFFSAIPTTLITAPTERVKVVL--QTSESGSF-LGAARTLIREGGVRSLFQGT 197

Query: 182 XXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGA 241
                                 P  AL FA YE  + F   + D        L  ++I  
Sbjct: 198 LATLARDG--------------PGSALYFASYEVSKRFLSRNQDTD-----ALSVVSI-C 237

Query: 242 ISGGVAQTI----TYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKG 297
           ++GGVA        +P D ++ + Q  +        R  S+  A   I    G+ G++ G
Sbjct: 238 VAGGVAGMSMWIGVFPIDTIKTKLQSSS--------RSQSMVQAAREIYTRAGLRGFFPG 289

Query: 298 LAANLFKVVPSTAVSWLVYE 317
           L   L +  P+ A ++L  E
Sbjct: 290 LGPALMRSFPANAATFLGVE 309

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 90/221 (40%), Gaps = 40/221 (18%)

Query: 118 EQLTNT-------QRLFSGALCGGCSVVATYPLDLIKTRLSIQTAN--LSSLNR--SKAK 166
           EQ +N+       + L +G + G C+V+  +P DL+K R     A+  L +++R   +AK
Sbjct: 17  EQASNSHTLRDSFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRVLHEAK 76

Query: 167 SISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYE---QLREFGVNS 223
           S S P  + Q+                 V P  LGV P  A++F  Y+   +L  +G N 
Sbjct: 77  SKSGPLPLNQI-----------KGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNP 125

Query: 224 SDAQPSWKSNLYKLTI------GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTS 277
                   S L  LT       G  S      IT P + ++   Q    G         S
Sbjct: 126 VTDIAGSSSKLTPLTTSQLALAGFFSAIPTTLITAPTERVKVVLQTSESG---------S 176

Query: 278 VWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318
              A  T+ R  GV   ++G  A L +  P +A+ +  YEV
Sbjct: 177 FLGAARTLIREGGVRSLFQGTLATLARDGPGSALYFASYEV 217

>Scas_673.17
          Length = 314

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 72/316 (22%), Positives = 121/316 (38%), Gaps = 30/316 (9%)

Query: 6   TVLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFS 65
           T     + I D+   D     LAG +    + + + P + VK  +Q++   T YN+G+  
Sbjct: 4   TTTTDAHKIPDYAASDYFKFALAGAIGCGTTHSSLVPVDVVKTRIQLEP--TVYNKGMVG 61

Query: 66  SIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQR 125
           S +++  +EG   L  G G   +      A +F  YE  KK      G        N+  
Sbjct: 62  SFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVY 121

Query: 126 LFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXX 185
           + S A+    + +A  PL+  + RL  Q    + L    ++ I K  G+    S      
Sbjct: 122 MGSAAVAEFLADIALCPLEATRIRLVSQPTFANGLVGGFSR-ILKEEGVGSFYS------ 174

Query: 186 XXXXXXXXXVWPTSLGVVPYVALNFAVYEQLRE--FGVNSSDAQPSWKSNL-YKLTIGAI 242
                      P     +PY    F V+E+  E  +G+  +    S  +N    L  G  
Sbjct: 175 --------GFTPILFKQIPYNIAKFLVFERASEVYYGIVGAKETLSDMTNTGINLLSGLT 226

Query: 243 SGGVAQTITYPFDLLRRRFQVL--AMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAA 300
           +G  A  ++ P D L  +      A G + +G         L  + +  GV G + GL  
Sbjct: 227 AGFAAAFVSQPADTLLSKVNKTKKAPGQSTIGL--------LAQLAKQLGVIGSFAGLPT 278

Query: 301 NLFKVVPSTAVSWLVY 316
            L  V   T++ + +Y
Sbjct: 279 RLIMVGTLTSLQFAIY 294

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 78/193 (40%), Gaps = 24/193 (12%)

Query: 127 FSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXX 186
            +GA+  G +  +  P+D++KTR+ ++    +       K I    G   LL+       
Sbjct: 25  LAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNKGMVGSFKKIIADEGAGALLT------- 77

Query: 187 XXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPS--WKSNLYKLTIGAISG 244
                     PT LG     A  F  YE  ++  +++   + +  +K+++Y +   A++ 
Sbjct: 78  -------GFGPTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVY-MGSAAVAE 129

Query: 245 GVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFK 304
            +A     P +  R R        N L   ++ +        + EGV  +Y G    LFK
Sbjct: 130 FLADIALCPLEATRIRLVSQPTFANGLVGGFSRIL-------KEEGVGSFYSGFTPILFK 182

Query: 305 VVPSTAVSWLVYE 317
            +P     +LV+E
Sbjct: 183 QIPYNIAKFLVFE 195

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 70/309 (22%), Positives = 120/309 (38%), Gaps = 42/309 (13%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQ----VYHEEGTKGLF 80
           +F+AGG+A  ++ TV +PF+ VK  +Q+Q    +    ++++  Q    ++  EG  GL 
Sbjct: 23  SFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQ 82

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACK---KKLFHVNGNNGQEQLTNTQRLFSGALCGGCSV 137
           +G     +     +  +   YE  +     +F+ N  + + Q      + +GA  G    
Sbjct: 83  KGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGIN-VAAGATSGVVGA 141

Query: 138 VATYPLDLIKTRLSI---------QTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXX 188
               PL L+KTR+           QT   S+ N     +I +  GI  L           
Sbjct: 142 FIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFN--GLATIFRSEGIKGLFRGV------- 192

Query: 189 XXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQ 248
                 +  T +G     A+   +Y   + F +           +L   TI     GVA 
Sbjct: 193 ---DAAMLRTGIG----SAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGFGVGVAM 245

Query: 249 TITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPS 308
               P+D++  R        N+ G  Y+   D  +   R EG+S  YKG  A + ++ P 
Sbjct: 246 N---PWDVVLTRVY------NQKGNLYSGPIDCFIKTVRNEGLSALYKGFGAQILRIGPH 296

Query: 309 TAVSWLVYE 317
           T +     E
Sbjct: 297 TVLCLTFME 305

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 66/155 (42%), Gaps = 12/155 (7%)

Query: 11  PNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSST------TSYNRGIF 64
           PN ++    Q   I   AG  +G V   + SP   VK  +Q  S+       T Y    F
Sbjct: 116 PN-VESHKVQHIGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSA-F 173

Query: 65  SSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQ 124
           + +  ++  EG KGLFRG     +R    SAVQ  +Y  CK  L   +  N    L    
Sbjct: 174 NGLATIFRSEGIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTGL---- 229

Query: 125 RLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSS 159
            L S  + G    VA  P D++ TR+  Q  NL S
Sbjct: 230 HLLSSTIAGFGVGVAMNPWDVVLTRVYNQKGNLYS 264

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 88/203 (43%), Gaps = 28/203 (13%)

Query: 128 SGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXX 187
           +G L    +V  T P D +KTR+ +Q      L+ + AK  + P   + ++ +       
Sbjct: 26  AGGLAACIAVTVTNPFDCVKTRMQLQ----GELHANAAKVYTNPIQAFGVIFKNEGIAGL 81

Query: 188 XXXXXXXVWPTSLGVVPYVALN---FAVYEQLREFGVNSSDAQPSWKSNLYK-----LTI 239
                          +  +ALN      YE +R  G+ ++   P+ +S+  +     +  
Sbjct: 82  QKGLAS-------AYLYQIALNGSRLGFYEPIR--GILNNVFYPNVESHKVQHIGINVAA 132

Query: 240 GAISGGVAQTITYPFDLLRRRFQ----VLAMGGNELGFRYTSVWDALVTIGRAEGVSGYY 295
           GA SG V   I  P  L++ R Q     + +G       YTS ++ L TI R+EG+ G +
Sbjct: 133 GATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQT---HYTSAFNGLATIFRSEGIKGLF 189

Query: 296 KGLAANLFKVVPSTAVSWLVYEV 318
           +G+ A + +    +AV   +Y +
Sbjct: 190 RGVDAAMLRTGIGSAVQLPIYNI 212

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/299 (21%), Positives = 122/299 (40%), Gaps = 43/299 (14%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNG 84
           + ++G  AG  +  V  P + +K  LQ +                 +H  G +G++RG G
Sbjct: 8   SLVSGAAAGTSTDVVFFPIDTLKTRLQAKGG--------------FFHNGGYRGIYRGLG 53

Query: 85  LNCIRIFPYSAVQFVVYEACKKKLFHVNGN-NGQEQLTNT-QRLFSGALCGGCSVVATYP 142
              +   P +++ FV Y++ K++L  V G     EQL      + S +L    + +   P
Sbjct: 54  SAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVRVP 113

Query: 143 LDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGV 202
            ++IK R   QT + +S  ++    +  P G                      W T +  
Sbjct: 114 AEVIKQR--TQTHHTNSSLQTLRLILRDPTG-----------EGVVRGLYRGWWTTIMRE 160

Query: 203 VPYVALNFAVYEQLREFGVNSSDAQ--PSWKSNLYKLTIGAISGGVAQTITYPFDLLRRR 260
           +P+  + F +YE L++     ++ +   +W+  +     G+++GG+A   T P D+L+ R
Sbjct: 161 IPFTCIQFPLYEYLKKKWAAYAEIERVSAWQGAV----CGSLAGGIAAAATTPLDVLKTR 216

Query: 261 FQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVV 319
                     L  R   +     T+ R EG   +++G+      +    A+   VYE V
Sbjct: 217 MM--------LHERRVPMLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAV 267

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 63/140 (45%), Gaps = 13/140 (9%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSS----------IRQVYHEEGTK 77
           AG +   +S  V  P E +K  LQ+Q     YN   F S          +  +   EG  
Sbjct: 156 AGFLGDFISSFVYVPSEVLKTRLQLQGR---YNNPFFRSGYNYKNLTDAVTTIVRREGWP 212

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSV 137
            LF G      R  P+S +QF  YE  ++  F V      E L+ +  + +GA  GG + 
Sbjct: 213 TLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVENKTFDEDLSLSNEIITGAAAGGLAG 272

Query: 138 VATYPLDLIKTRLSIQTANL 157
           + T PLD++KTR+  Q  ++
Sbjct: 273 IITTPLDVVKTRIQTQLPDI 292

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 68/303 (22%), Positives = 119/303 (39%), Gaps = 42/303 (13%)

Query: 38  TVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEG-TKGLFRGNGLNCIRIFPYSAV 96
           + +   + VK   Q   ST  Y + +  + R +  EEG  KGL+ G     +  FP +A+
Sbjct: 71  SAMHSLDTVKTRQQGAPSTVKY-KNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAI 129

Query: 97  QFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTAN 156
            F  YE  K+K+    G N  E  ++   L +G L    S     P +++KTRL +Q   
Sbjct: 130 FFATYEYTKRKMIGEWGIN--ETFSH---LTAGFLGDFISSFVYVPSEVLKTRLQLQGRY 184

Query: 157 LSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSL--------GVVPYVAL 208
            +   RS     +    +  ++                 WPT            +P+  L
Sbjct: 185 NNPFFRSGYNYKNLTDAVTTIVRREG-------------WPTLFFGYKATLSRDLPFSGL 231

Query: 209 NFAVYEQLRE--FGVNSS--DAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVL 264
            FA YE+ R+  F V +   D   S  + +          G+   IT P D+++ R Q  
Sbjct: 232 QFAFYEKFRQLAFAVENKTFDEDLSLSNEIITGAAAGGLAGI---ITTPLDVVKTRIQTQ 288

Query: 265 AMGGNELGFR-------YTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
                E   +         S+   ++T+ + EG++G + G+          +++  L+Y+
Sbjct: 289 LPDIPENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLYQ 348

Query: 318 VVC 320
           V  
Sbjct: 349 VAL 351

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 113/295 (38%), Gaps = 32/295 (10%)

Query: 29  GGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCI 88
           GG AG  +     P +  K+ LQ           I   +R +   EG  GL+ G   + +
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQAAPIPKP---TIVQMLRSILKNEGIVGLYAGLSASLL 69

Query: 89  RIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLF-----SGALCGGCSVVATYPL 143
           R   Y+  +F +Y+A K+ +        +++LTN   L      SGAL G     A    
Sbjct: 70  RQCTYTTARFGMYDALKEHVI------PRDKLTNMWYLLGASMVSGALGGLAGNFA---- 119

Query: 144 DLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVW-PTSLGV 202
           DLI  R+   +A      R+   +I     I++                   W P  +  
Sbjct: 120 DLINIRMQNDSALPLDKRRNYKNAIDGMVKIYK--------AEGAKSLFLTGWKPNMVRG 171

Query: 203 VPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQ 262
           V   A     Y+  + F V   +  P  K N   LT   ++G VA T+  P D+++    
Sbjct: 172 VLMTASQVVTYDMFKNFLVTKYNMDP--KKNSTHLTSSLLAGFVATTVCSPADVIK---T 226

Query: 263 VLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
           ++     + G  + S +  L+     EG S  ++G   +  ++ P T + +   E
Sbjct: 227 IVMNAHKKPGHNHDSSFKILMEAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAME 281

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 31  VAGAVSRTVVSPFERVKILLQVQSSTTSYNR-GIFSSIRQVYHEEGTKGLFRGNGLNCIR 89
           +AG V+ TV SP + +K ++        +N    F  + +  ++EG   +FRG   +  R
Sbjct: 209 LAGFVATTVCSPADVIKTIVMNAHKKPGHNHDSSFKILMEAINKEGPSFMFRGWVPSFTR 268

Query: 90  IFPYSAVQFVVYEACKK 106
           + P++ + F   E  KK
Sbjct: 269 LAPFTMLIFFAMEQLKK 285

 Score = 31.2 bits (69), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 38/82 (46%), Gaps = 7/82 (8%)

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299
           G  +G  A   T+P DL + R Q   +          ++   L +I + EG+ G Y GL+
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQAAPIPK-------PTIVQMLRSILKNEGIVGLYAGLS 65

Query: 300 ANLFKVVPSTAVSWLVYEVVCD 321
           A+L +    T   + +Y+ + +
Sbjct: 66  ASLLRQCTYTTARFGMYDALKE 87

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 116/307 (37%), Gaps = 31/307 (10%)

Query: 13  SIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYH 72
           S+ D++K       LAG +    + + + P + VK  +Q++   T YN+G+  S +Q+  
Sbjct: 13  SVSDYMKFA-----LAGAIGCGSTHSSMVPIDVVKTRIQLEP--TVYNKGMVGSFKQIIA 65

Query: 73  EEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALC 132
            EG   L  G G   +      A +F  YE  KK      G +   +  N+  + S A+ 
Sbjct: 66  GEGAGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMA 125

Query: 133 GGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXX 192
              + +A  PL+  + RL  Q    + L    ++ I K  GI    S             
Sbjct: 126 EFLADIALCPLEATRIRLVSQPQFANGLVGGFSR-ILKEEGIGSFYS------------- 171

Query: 193 XXVWPTSLGVVPYVALNFAVYEQLREF---GVNSSDAQPSWKSNLYKLTIGAISGGVAQT 249
               P     +PY    F V+E+  EF        +   S  + L  L  G  +G  A  
Sbjct: 172 -GFTPILFKQIPYNIAKFLVFERASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAI 230

Query: 250 ITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPST 309
           ++ P D L  +         +      S    L  + +  G  G + GL   L  V   T
Sbjct: 231 VSQPADTLLSKVNKTKKAPGQ------STVGLLAQLAKQLGFFGSFAGLPTRLVMVGTLT 284

Query: 310 AVSWLVY 316
           ++ + +Y
Sbjct: 285 SLQFGIY 291

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 78/192 (40%), Gaps = 24/192 (12%)

Query: 128 SGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXX 187
           +GA+  G +  +  P+D++KTR+ ++    +       K I    G   LL+        
Sbjct: 23  AGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGAGALLT-------- 74

Query: 188 XXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNS--SDAQPSWKSNLYKLTIGAISGG 245
                    PT LG     A  F  YE  ++F +++   D    +K+++Y +   A++  
Sbjct: 75  ------GFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVY-MGSAAMAEF 127

Query: 246 VAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKV 305
           +A     P +  R R        N L   ++ +        + EG+  +Y G    LFK 
Sbjct: 128 LADIALCPLEATRIRLVSQPQFANGLVGGFSRIL-------KEEGIGSFYSGFTPILFKQ 180

Query: 306 VPSTAVSWLVYE 317
           +P     +LV+E
Sbjct: 181 IPYNIAKFLVFE 192

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 63/138 (45%), Gaps = 12/138 (8%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85
            L G ++ A    V  P   +K+  + +S+  +YN G+  + R ++  EG +G F+G   
Sbjct: 108 LLTGALSRAAVGLVTMPITVIKV--RYESTLYAYN-GLAEATRHIWRSEGARGFFKGAAA 164

Query: 86  NCIRIFPYSAVQFVVYEACKKKLFH-----VNGNNGQEQLTNTQRLF----SGALCGGCS 136
             +R  PY+ +  ++YE  K+ L       + G +   +LT          S  L    +
Sbjct: 165 TTLRDAPYAGLYVLLYEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLA 224

Query: 137 VVATYPLDLIKTRLSIQT 154
              T P D IKTR+ +Q+
Sbjct: 225 TTLTAPFDTIKTRMQLQS 242

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 79/193 (40%), Gaps = 24/193 (12%)

Query: 126 LFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXX 185
           L SG   G  SV A  PLDL+KTRL  Q A  SSL RS  + +     +W+         
Sbjct: 12  LVSGFFGGLASVCALQPLDLLKTRL--QQAQASSL-RSVLREVRTTRELWR--------- 59

Query: 186 XXXXXXXXXVWPTSLGVVPYVAL-NFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISG 244
                       TS+G   Y++L N++     R     +  +      +   L  GA+S 
Sbjct: 60  ----GTLPSALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSR 115

Query: 245 GVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFK 304
                +T P  +++ R++      N L      +W       R+EG  G++KG AA   +
Sbjct: 116 AAVGLVTMPITVIKVRYESTLYAYNGLAEATRHIW-------RSEGARGFFKGAAATTLR 168

Query: 305 VVPSTAVSWLVYE 317
             P   +  L+YE
Sbjct: 169 DAPYAGLYVLLYE 181

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 71/309 (22%), Positives = 116/309 (37%), Gaps = 51/309 (16%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHE-EGTKGLFRGNG 84
            ++G   G  S   + P + +K  LQ   +         SS+R V  E   T+ L+RG  
Sbjct: 12  LVSGFFGGLASVCALQPLDLLKTRLQQAQA---------SSLRSVLREVRTTRELWRGTL 62

Query: 85  LNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQ------LTNTQRLFSGALCGGCSVV 138
            + +R    SA+   +    +  L    G+  + +      L + Q L +GAL      +
Sbjct: 63  PSALRTSIGSALYLSLLNYSRSAL--ARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGL 120

Query: 139 ATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPT 198
            T P+ +IK R        + L  +          IW+  SE                 T
Sbjct: 121 VTMPITVIKVRYESTLYAYNGLAEATRH-------IWR--SEGARGFFKGAAA------T 165

Query: 199 SLGVVPYVALNFAVYEQLRE----------FGVNSSDAQPSWKSNLYKLTIGAISGGVAQ 248
           +L   PY  L   +YEQ +E           G + S    +  S +       +S  +A 
Sbjct: 166 TLRDAPYAGLYVLLYEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLAT 225

Query: 249 TITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPS 308
           T+T PFD ++ R Q   +  + +GF  T     L  I   E     + GL+  L +   S
Sbjct: 226 TLTAPFDTIKTRMQ---LQSHPVGFVQT-----LRHIVCEERARTLFDGLSLRLCRKAMS 277

Query: 309 TAVSWLVYE 317
             ++W +YE
Sbjct: 278 ACIAWGIYE 286

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 9/86 (10%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNG 84
           AFL+  +A     T+ +PF+ +K  +Q+Q    S+  G   ++R +  EE  + LF G  
Sbjct: 217 AFLSASLAT----TLTAPFDTIKTRMQLQ----SHPVGFVQTLRHIVCEERARTLFDGLS 268

Query: 85  LNCIRIFPYSAVQFVVYEACKKKLFH 110
           L   R    + + + +YE    KL H
Sbjct: 269 LRLCRKAMSACIAWGIYEEL-LKLLH 293

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 72/327 (22%), Positives = 125/327 (38%), Gaps = 75/327 (22%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQ--------------------------------- 53
           L+G VA A++ TVV P + VK L+Q Q                                 
Sbjct: 8   LSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPIKL 67

Query: 54  --SSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHV 111
             ++   YN   F +I ++Y +EG +GL++G   + +  F  +   F  Y   +K  F V
Sbjct: 68  NENNYLQYN-STFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRV 126

Query: 112 NG-NNGQEQLTNTQRLFSGALCGGCSVVATYPLDLI----KTRLSIQTAN-LSSLNRSKA 165
              N    + T  + L  G +    S + T P+ LI    +TR  I   N   ++ +   
Sbjct: 127 KLINRKNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDFLTVAKEIY 186

Query: 166 KSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLRE--FGVNS 223
           K      G W+ L                    SL +    ++ +  YE+L++  F  ++
Sbjct: 187 KEQRSIKGFWKGLK------------------VSLMLTINPSITYTSYEKLKDALFTTDT 228

Query: 224 SDAQP------SWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTS 277
            + +       S  S     T+G +S  ++  IT P  + +   Q         G  ++S
Sbjct: 229 MNLKKELVDSSSQLSPYQNFTLGVLSKMISAIITMPLIISKAWLQ-------RNGSNFSS 281

Query: 278 VWDALVTIGRAEGVSGYYKGLAANLFK 304
               L  + + EG+  ++KGL+  L K
Sbjct: 282 FQQVLYYLYKNEGLRSWWKGLSPQLAK 308

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 114/295 (38%), Gaps = 36/295 (12%)

Query: 29  GGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCI 88
           GG AG  +  V  P +  K+ LQ           +F  +  +   EG  GL+ G     +
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMPKP---TLFRMLESILANEGVVGLYSGLSAAVL 76

Query: 89  RIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRL-----FSGALCGGCSVVATYPL 143
           R   Y+ V+F  Y+  K+ +        +EQLTN   L     FSGA+ G     A    
Sbjct: 77  RQCTYTTVRFGAYDLLKENVIP------REQLTNMAYLLPCSMFSGAIGGLAGNFA---- 126

Query: 144 DLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVW-PTSLGV 202
           D++  R+   +A  ++  R+   +I    G++++                  W P  +  
Sbjct: 127 DVVNIRMQNDSALEAAKRRNYKNAID---GVYKIYRYEGGLKTLFTG-----WKPNMVRG 178

Query: 203 VPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQ 262
           +   A     Y+  + + V   D   S   N   LT   ++G VA T+  P D+++ R  
Sbjct: 179 ILMTASQVVTYDVFKNYLVTKLDFDAS--KNYTHLTASLLAGLVATTVCSPADVMKTRI- 235

Query: 263 VLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
              M G+     +      L    R EG S  ++G   +  ++ P T + +   E
Sbjct: 236 ---MNGSG---DHQPALKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIE 284

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 47/98 (47%), Gaps = 8/98 (8%)

Query: 223 SSDAQPSWKSNL-YKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDA 281
           S++A+ S   N+ Y    G  +G  A  +T+P DL + R Q   M    L FR       
Sbjct: 2   STNAKESAGKNIKYPWWYGGAAGIFATMVTHPLDLAKVRLQAAPMPKPTL-FR------M 54

Query: 282 LVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVV 319
           L +I   EGV G Y GL+A + +    T V +  Y+++
Sbjct: 55  LESILANEGVVGLYSGLSAAVLRQCTYTTVRFGAYDLL 92

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 114/307 (37%), Gaps = 26/307 (8%)

Query: 13  SIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYH 72
           +I D+   D     LAG +    + + + P + VK  +Q++   T YN+G+ SS +Q+  
Sbjct: 4   AIPDYSLSDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLEP--TVYNKGMISSFKQIIS 61

Query: 73  EEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALC 132
            EG   L  G G   +      + +F  YE  KK    V G +      N+  + S A+ 
Sbjct: 62  SEGAGALLTGFGPTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIA 121

Query: 133 GGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXX 192
              + +A  PL+  + RL  Q    + L            G  ++L E            
Sbjct: 122 EFFADIALCPLEATRIRLVSQPTFANGLVG----------GFSRILKEE-----GAGSFY 166

Query: 193 XXVWPTSLGVVPYVALNFAVYEQLRE--FGVNSSDAQPSWKSNL-YKLTIGAISGGVAQT 249
               P     +PY    F V+E+  E  FG+       S  S     L  G  +G  A  
Sbjct: 167 NGFTPILFKQIPYNIAKFLVFERAAEVYFGMAGPKESLSTASTTGINLLSGLTAGLAAAI 226

Query: 250 ITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPST 309
           ++ P D L  +         +      S    L  + +  G  G + GL   L  V   T
Sbjct: 227 VSQPADTLLSKVNKTKKAPGQ------STIGLLAQLAKQLGFVGSFAGLPTRLVMVGTLT 280

Query: 310 AVSWLVY 316
           ++ + +Y
Sbjct: 281 SLQFGIY 287

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 76/193 (39%), Gaps = 24/193 (12%)

Query: 127 FSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXX 186
            +GA+  G +  A  P+D++KTR+ ++    +    S  K I    G   LL+       
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLT------- 70

Query: 187 XXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVN--SSDAQPSWKSNLYKLTIGAISG 244
                     PT LG     +  F  YE  ++  ++    D   ++K+++Y +   AI+ 
Sbjct: 71  -------GFGPTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIY-IGSAAIAE 122

Query: 245 GVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFK 304
             A     P +  R R        N L   ++ +        + EG   +Y G    LFK
Sbjct: 123 FFADIALCPLEATRIRLVSQPTFANGLVGGFSRIL-------KEEGAGSFYNGFTPILFK 175

Query: 305 VVPSTAVSWLVYE 317
            +P     +LV+E
Sbjct: 176 QIPYNIAKFLVFE 188

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 114/308 (37%), Gaps = 46/308 (14%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85
            + G V G  S  V+ PF+ +K  LQ    TT +  G    IR        K L+RG   
Sbjct: 11  LIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLW--GTLKEIRS------PKQLWRGALP 62

Query: 86  NCIRIFPYSAVQFVVYEA-----CKKKLFHVN-GNNGQEQLTNTQRLFSGALCGGCSVVA 139
           + +R    SA+             K K   +N G++   QLT  + L SGA   G     
Sbjct: 63  SSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGFI 122

Query: 140 TYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTS 199
           T P+ +IK R      +  SL  +  + I    GI    +                  T 
Sbjct: 123 TMPITIIKVRYESTMYSYKSLGEA-TRHIYSTEGIRGFFNGCGA--------------TV 167

Query: 200 LGVVPYVALNFAVYEQLR----------EFGVNSSDAQPSWKSNLYKLTIGAISGGVAQT 249
           +   PY  L   +YE+ +              + +    ++ S +       +S  +A T
Sbjct: 168 MRDAPYAGLYVLLYEKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATT 227

Query: 250 ITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPST 309
           IT PFD ++ R Q+          +++  +  LV I   E     + GL   L +   S 
Sbjct: 228 ITSPFDTIKTRMQLDPT-------KFSGFYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSA 280

Query: 310 AVSWLVYE 317
            ++W +YE
Sbjct: 281 GIAWGIYE 288

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 77/207 (37%), Gaps = 34/207 (16%)

Query: 118 EQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQL 177
           E+   +  L  G + G  S +   P DL+KTRL     N  +      K I  P  +W+ 
Sbjct: 3   ERPKTSSHLIGGFVGGLTSAIVLQPFDLLKTRLQ---QNKDTTLWGTLKEIRSPKQLWR- 58

Query: 178 LSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLRE-FGVNSSDAQPSWKSNLYK 236
                              P+SL      AL  +     R       +       S L +
Sbjct: 59  ----------------GALPSSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQ 102

Query: 237 LTI------GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEG 290
           LT+      GA + GV   IT P  +++ R++          + Y S+ +A   I   EG
Sbjct: 103 LTMYENLASGAFTRGVVGFITMPITIIKVRYESTM-------YSYKSLGEATRHIYSTEG 155

Query: 291 VSGYYKGLAANLFKVVPSTAVSWLVYE 317
           + G++ G  A + +  P   +  L+YE
Sbjct: 156 IRGFFNGCGATVMRDAPYAGLYVLLYE 182

>Scas_687.15*
          Length = 328

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 74/193 (38%), Gaps = 53/193 (27%)

Query: 7   VLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILL---------------- 50
           +L  PN  KD L +   +  LAG + GAV    + PFE VK+ +                
Sbjct: 85  ILRDPNLPKDSLLKGPRL-LLAGILTGAVESLCIIPFENVKVTMIENSLQLSESKPTEKE 143

Query: 51  --------------------------QVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNG 84
                                     QV S   S N  IFS ++++Y   G +G  +G  
Sbjct: 144 IAGTLKKKVTFHVAKPKQLSPQEQWRQVYSKYPSSN--IFSVVKEIYLTRGLRGFAQGAM 201

Query: 85  LNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVA-TYPL 143
               R    S V+F  Y   K+ +          Q  N    F   L   C+VVA T P+
Sbjct: 202 PTVFRQVSNSTVRFTAYTTLKQLI-------SPTQPLNEVYAFGIGLFSSCAVVALTQPI 254

Query: 144 DLIKTRLSIQTAN 156
           D++KTR+  +TA+
Sbjct: 255 DVVKTRMQSKTAH 267

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 77/335 (22%), Positives = 124/335 (37%), Gaps = 54/335 (16%)

Query: 17  FLKQ-DSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEG 75
            LKQ D  I  LAG  A     T+  PFE +K   Q+   T       F ++R +     
Sbjct: 2   LLKQTDVPIQILAGSAAAVFETTLTYPFEFLKTGFQLHRRTVGAKP--FEALRPI----- 54

Query: 76  TKGLFRG-NGLNCIRIFPYSAVQFVVYE-ACKKKLFHVNGNNGQEQLTNTQRLF-SGALC 132
            K  F G   LN   I   ++V+F  ++ AC+      + N  ++ L    RL  +G L 
Sbjct: 55  -KVYFAGCTALNLSAIVK-TSVRFATFDKACQ---ILRDPNLPKDSLLKGPRLLLAGILT 109

Query: 133 GGCSVVATYPLDLIKTRLSIQTANLS-----------SLNRSKAKSISKPPGI-----W- 175
           G    +   P + +K  +   +  LS           +L +     ++KP  +     W 
Sbjct: 110 GAVESLCIIPFENVKVTMIENSLQLSESKPTEKEIAGTLKKKVTFHVAKPKQLSPQEQWR 169

Query: 176 QLLSETXXXXXXXXXXXXXV-----------WPTSLGVVPYVALNFAVYEQLREFGVNSS 224
           Q+ S+              +            PT    V    + F  Y  L++     S
Sbjct: 170 QVYSKYPSSNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQL---IS 226

Query: 225 DAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVT 284
             QP   + +Y   IG  S      +T P D+++ R Q          + Y +  +    
Sbjct: 227 PTQPL--NEVYAFGIGLFSSCAVVALTQPIDVVKTRMQ-----SKTAHYFYKNSLNCAYR 279

Query: 285 IGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVV 319
           +   EG+   +KG    LFKV  S  +S+ VY+ V
Sbjct: 280 VFVEEGMVSLWKGWLPRLFKVGLSGGISFGVYQYV 314

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 76/192 (39%), Gaps = 23/192 (11%)

Query: 129 GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKP--PGIWQLLSETXXXXX 186
           G   G  + VAT+PLDL K RL    A   +L R  ++ +     PG++  L+       
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPTLVRMASQILRNEGVPGLYSGLTAAI---- 70

Query: 187 XXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGV 246
                        L    Y    F VY+ ++E  +     +    S LY L     SG V
Sbjct: 71  -------------LRQCTYTTARFGVYDFVKERYI----PKEYLNSMLYLLPCSMFSGAV 113

Query: 247 AQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVV 306
              I  P D++  R Q  +    EL   Y +  D L  I   EGV+  + G   NL + +
Sbjct: 114 GGLIGNPADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGI 173

Query: 307 PSTAVSWLVYEV 318
             T+   + Y++
Sbjct: 174 LMTSSQVVTYDI 185

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 63/293 (21%), Positives = 117/293 (39%), Gaps = 32/293 (10%)

Query: 29  GGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCI 88
           GG  G V+     P +  K+ LQ   +       +     Q+   EG  GL+ G     +
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKP---TLVRMASQILRNEGVPGLYSGLTAAIL 71

Query: 89  RIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKT 148
           R   Y+  +F VY+  K++       N    L     +FSGA+ G    +   P D++  
Sbjct: 72  RQCTYTTARFGVYDFVKERYIPKEYLNSMLYLLPCS-MFSGAVGG----LIGNPADVVNI 126

Query: 149 RLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXX---XXXXXXVWPTSLGVVPY 205
           R+   ++  + L R+   +     G++++ S                  +  TS  VV Y
Sbjct: 127 RMQNDSSLPAELRRNYKNAAD---GLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTY 183

Query: 206 -VALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVL 264
            +A N+ V    +  G++  +    + S+L       ++G VA T+  P D+++ R    
Sbjct: 184 DIAKNYLV----QNVGLDKDNKSTHFASSL-------LAGLVATTVCSPADVIKTRVM-- 230

Query: 265 AMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
               N     + S    L+   + EG S  ++G   +  ++ P+T + +L  E
Sbjct: 231 ----NAHKHSHDSAVRILLDAVKQEGPSFMFRGWLPSFVRLGPNTILIFLTVE 279

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 33/80 (41%), Gaps = 7/80 (8%)

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299
           G   G VA   T+P DL + R Q        L  R  S       I R EGV G Y GL 
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPTL-VRMAS------QILRNEGVPGLYSGLT 67

Query: 300 ANLFKVVPSTAVSWLVYEVV 319
           A + +    T   + VY+ V
Sbjct: 68  AAILRQCTYTTARFGVYDFV 87

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 46/91 (50%), Gaps = 6/91 (6%)

Query: 19  KQDSNIAFLAGGVAGAVSRTVVSPFERVK--ILLQVQSSTTSYNRGIFSSIRQVYHEEGT 76
           K + +  F +  +AG V+ TV SP + +K  ++   + S  S  R +  +++Q    EG 
Sbjct: 198 KDNKSTHFASSLLAGLVATTVCSPADVIKTRVMNAHKHSHDSAVRILLDAVKQ----EGP 253

Query: 77  KGLFRGNGLNCIRIFPYSAVQFVVYEACKKK 107
             +FRG   + +R+ P + + F+  E  +K 
Sbjct: 254 SFMFRGWLPSFVRLGPNTILIFLTVEQLRKH 284

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 60/120 (50%), Gaps = 7/120 (5%)

Query: 33  GAVSRTVVS-PFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGT-KGLFRGNGLNCIRI 90
           G VS  +V  P E +K   Q   + +S+    F+ I Q  + EG  + L+RG     +R 
Sbjct: 105 GEVSACLVRVPAEVIKQRTQTHKTNSSWQ--TFTKILQNENGEGVLRNLYRGWNTTIMRE 162

Query: 91  FPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRL 150
            P++ +QF +YE  KK        NGQ+ +   Q    G++ G  +   T PLD++KTRL
Sbjct: 163 IPFTCIQFPLYEFLKKTWAK---RNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRL 219

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 67/305 (21%), Positives = 120/305 (39%), Gaps = 52/305 (17%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGN 83
           ++  +G  AG  +     P + +K  LQ +        G F++        G KG++RG 
Sbjct: 8   VSLASGAAAGTSTDLAFFPIDTLKTRLQAKG-------GFFAN-------GGYKGVYRGL 53

Query: 84  GLNCIRIFPYSAVQFVVYEACK---KKLF--HVNGNNGQEQLTNT-QRLFSGALCGGCSV 137
           G   I   P +++ FV Y++ K   K +   +V  NN   Q+ +T   +FS ++    + 
Sbjct: 54  GSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNN---QMADTLSHMFSSSIGEVSAC 110

Query: 138 VATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWP 197
           +   P ++IK R      N S    +K        G+ + L                 W 
Sbjct: 111 LVRVPAEVIKQRTQTHKTNSSWQTFTKILQNENGEGVLRNLYRG--------------WN 156

Query: 198 TS-LGVVPYVALNFAVYEQLREFGV--NSSDAQPSWKSNLYKLTIGAISGGVAQTITYPF 254
           T+ +  +P+  + F +YE L++     N  D    W+ ++     G+++G +A   T P 
Sbjct: 157 TTIMREIPFTCIQFPLYEFLKKTWAKRNGQDHVAPWQGSV----CGSVAGAIAAATTTPL 212

Query: 255 DLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWL 314
           D+L+ R          L  +   V      I   EG   ++ G+      +    A+   
Sbjct: 213 DVLKTRLM--------LSHKSIPVAQLAKNIYAEEGFKVFFSGVGPRTMWISAGGAIFLG 264

Query: 315 VYEVV 319
           VYE V
Sbjct: 265 VYETV 269

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 115/297 (38%), Gaps = 34/297 (11%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLN 86
           LAG +    + + + P + VK  +Q++   T YN+G+  S R++  EEG   L  G G  
Sbjct: 18  LAGAIGCGSTHSSMVPIDVVKTRIQLEP--TVYNKGMVGSFRKIIAEEGAGALLTGFGPT 75

Query: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLI 146
            +      A +F  YE  KK      G +   +  N+  + S A     + +A  PL+  
Sbjct: 76  LLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEAT 135

Query: 147 KTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYV 206
           + RL  Q    + L    ++ I K  G+    S                 P     +PY 
Sbjct: 136 RIRLVSQPTFANGLVGGFSR-ILKEEGVGSFYS--------------GFTPILFKQIPYN 180

Query: 207 ALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAI-------SGGVAQTITYPFDLLRR 259
              F V+E+  E  +  S A P  K  L + ++ AI       +G  A  ++ P D L  
Sbjct: 181 IAKFLVFERASE--LYFSLAPP--KDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLS 236

Query: 260 RFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVY 316
           +    +    +      S    L  + +  G  G + GL   L  V   T++ + +Y
Sbjct: 237 KVNKTSKAPGQ------STVGLLFQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIY 287

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 78/194 (40%), Gaps = 28/194 (14%)

Query: 128 SGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXX 187
           +GA+  G +  +  P+D++KTR+ ++    +       + I    G   LL+        
Sbjct: 19  AGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEGAGALLT-------- 70

Query: 188 XXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNS--SDAQPSWKSNLYKLTIGAISGG 245
                    PT LG     A  F  YE  ++F +++   D    +K+++Y   IG+ +  
Sbjct: 71  ------GFGPTLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVY---IGSAAAA 121

Query: 246 --VAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLF 303
             +A     P +  R R        N L   ++ +        + EGV  +Y G    LF
Sbjct: 122 EFLADIALCPLEATRIRLVSQPTFANGLVGGFSRIL-------KEEGVGSFYSGFTPILF 174

Query: 304 KVVPSTAVSWLVYE 317
           K +P     +LV+E
Sbjct: 175 KQIPYNIAKFLVFE 188

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 58/127 (45%), Gaps = 2/127 (1%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLN 86
           LAG +   ++ + + P + VK  +Q++   T YN+G+ SS +Q+   EG   L  G G  
Sbjct: 18  LAGAIGCGITHSSMVPIDVVKTRIQLEP--TVYNKGMVSSFKQIISSEGAGALLTGFGPT 75

Query: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLI 146
            +      + +F  YE  KK      G +      NT  + S A+    + +A  PL+  
Sbjct: 76  LLGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEAT 135

Query: 147 KTRLSIQ 153
           + RL  Q
Sbjct: 136 RIRLVSQ 142

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 75/192 (39%), Gaps = 24/192 (12%)

Query: 128 SGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXX 187
           +GA+  G +  +  P+D++KTR+ ++    +    S  K I    G   LL+        
Sbjct: 19  AGAIGCGITHSSMVPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLT-------- 70

Query: 188 XXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSS--DAQPSWKSNLYKLTIGAISGG 245
                    PT LG     +  F  YE  ++  +++   D   ++K+ +Y +   AI+  
Sbjct: 71  ------GFGPTLLGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIY-IGSAAIAEF 123

Query: 246 VAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKV 305
            A     P +  R R        N L       +     I + EGV  +Y G    LFK 
Sbjct: 124 FADIALCPLEATRIRLVSQPTFANGL-------FGGFSRILKEEGVGSFYNGFTPILFKQ 176

Query: 306 VPSTAVSWLVYE 317
           +P     + V+E
Sbjct: 177 IPYNIAKFFVFE 188

>Kwal_33.15597
          Length = 305

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 57/127 (44%), Gaps = 2/127 (1%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLN 86
           LAG +    + + + P + VK  +Q++   T YN+G+ SS +Q+   EG   L  G G  
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEP--TVYNKGMISSFKQIISSEGAGALLTGFGPT 75

Query: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLI 146
            +      + +F  YE  KK      G +      N+  + S A+    + +A  PL+  
Sbjct: 76  LLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEAT 135

Query: 147 KTRLSIQ 153
           + RL  Q
Sbjct: 136 RIRLVSQ 142

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 79/193 (40%), Gaps = 24/193 (12%)

Query: 127 FSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXX 186
            +GA+  G +  A  P+D++KTR+ ++    +    S  K I    G   LL+       
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLT------- 70

Query: 187 XXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNS--SDAQPSWKSNLYKLTIGAISG 244
                     PT LG     +  F  YE  ++  +++   D   ++K+++Y +   AI+ 
Sbjct: 71  -------GFGPTLLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIY-IGSAAIAE 122

Query: 245 GVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFK 304
             A     P +  R R        N L   ++ +        + EG+S +Y G    LFK
Sbjct: 123 FFADIALCPLEATRIRLVSQPTFANGLVGGFSRIL-------KEEGLSSFYNGFTPILFK 175

Query: 305 VVPSTAVSWLVYE 317
            +P     +LV+E
Sbjct: 176 QIPYNIAKFLVFE 188

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 68/133 (51%), Gaps = 5/133 (3%)

Query: 33  GAVSRTVVS-PFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIF 91
           G +S  +V  P E +K   Q   + +S    + + +R    E   + L+RG     +R  
Sbjct: 106 GEISACMVRVPAEVIKQRTQTHRTNSSLQT-LQALLRNENGEGLRRNLYRGWSTTIMREI 164

Query: 92  PYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLS 151
           P++ +QF +YE  KK+   V G   +E+    Q    G + GG +  AT PLD++KTR+ 
Sbjct: 165 PFTCIQFPLYEYMKKRWAEVQG---KERAAPWQGSVCGCIAGGIAAAATTPLDVLKTRIM 221

Query: 152 IQTANLSSLNRSK 164
           +   ++S+L+ +K
Sbjct: 222 LHHKSVSALHLAK 234

 Score = 35.8 bits (81), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 64/302 (21%), Positives = 116/302 (38%), Gaps = 47/302 (15%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNG 84
           + ++G  AG  +     P + +K  LQ +        G F++        G KG++RG G
Sbjct: 9   SLVSGAAAGTSTDLAFFPIDTLKTRLQAKG-------GFFAN-------GGYKGVYRGLG 54

Query: 85  LNCIRIFPYSAVQFVVYEACKKKLFHVNGN---NGQEQLTNT-QRLFSGALCGGCSVVAT 140
              +   P +++ FV Y++ K     V G     G++Q  +T   + S +     + +  
Sbjct: 55  SAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISACMVR 114

Query: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTS- 199
            P ++IK R      N SSL   +A           L +E               W T+ 
Sbjct: 115 VPAEVIKQRTQTHRTN-SSLQTLQA----------LLRNENGEGLRRNLYRG---WSTTI 160

Query: 200 LGVVPYVALNFAVYEQLRE--FGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLL 257
           +  +P+  + F +YE +++    V   +    W+ ++     G     +A   T P D+L
Sbjct: 161 MREIPFTCIQFPLYEYMKKRWAEVQGKERAAPWQGSVCGCIAGG----IAAAATTPLDVL 216

Query: 258 RRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
           + R          L  +  S      T+ + EGV  ++ G+      +    A+   VYE
Sbjct: 217 KTRIM--------LHHKSVSALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYE 268

Query: 318 VV 319
            V
Sbjct: 269 TV 270

>Scas_198.1
          Length = 72

 Score = 41.6 bits (96), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 6/50 (12%)

Query: 4  VLTVLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQ 53
          ++ V EQP+S   F+       FL GGV+ A+++T  +P ERVKIL+Q Q
Sbjct: 3  IMVVKEQPHS-SSFVTD-----FLMGGVSAAIAKTGAAPIERVKILMQNQ 46

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 63/306 (20%), Positives = 121/306 (39%), Gaps = 55/306 (17%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQ---SSTTSYNRG----------IFSSIRQVYHE 73
           L G VA A++   V P +  K ++Q Q   SS+   N G          +   +  ++ E
Sbjct: 8   LTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKE 67

Query: 74  EGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKK--------LFHVNGNNGQEQLTNTQR 125
           +G  GL++G  +  +  F  + V F  Y   +K         L  +   +G    +  + 
Sbjct: 68  KGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPSTIEE 127

Query: 126 LFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKP-----PGIWQLLSE 180
           L  G      S + T P+ ++ TR     +  S+   +  K I +         W+ L  
Sbjct: 128 LVLGVAAASISQLFTSPMAVVATRQQTVHSAESAKFTNVIKDIYRENNGDITAFWKGLR- 186

Query: 181 TXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLRE--FGVNSSDAQPSWKSNLYKLT 238
                            T L +    ++ +A +++L+E  F  +S+DA     S +    
Sbjct: 187 -----------------TGLALTINPSITYASFQRLKEVFFHDHSNDAGS--LSAVQNFI 227

Query: 239 IGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGL 298
           +G +S  ++  +T P  + +   Q         G ++T+  +AL+ + + EG+   +KG+
Sbjct: 228 LGVLSKMISTLVTQPLIVAKAMLQ-------SAGSKFTTFQEALLYLYKNEGLKSLWKGV 280

Query: 299 AANLFK 304
              L K
Sbjct: 281 LPQLTK 286

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 54/117 (46%), Gaps = 13/117 (11%)

Query: 40  VSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFV 99
           +SP ER  + L  +   TS     FS+++++Y   G +G  +G      R    SAV+F 
Sbjct: 252 ISPRER--LFLHYEEHPTS---RFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFT 306

Query: 100 VYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVA-TYPLDLIKTRLSIQTA 155
            Y + K+ +          +  N    F       C+VVA T P+D+IKTR+  + A
Sbjct: 307 TYTSLKQLI-------SPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYA 356

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 78/336 (23%), Positives = 128/336 (38%), Gaps = 58/336 (17%)

Query: 20  QDSNIAFLAGGVAGAVSRTVVS-PFERVKILLQVQSSTTSYNRGIFSSIRQV-YHEEGTK 77
           Q+S +A +  G   +V +T +S PFE +K  LQ+  S    N   F+ + Q  Y+  G  
Sbjct: 91  QNSLLAPIVAGSCASVFQTTISYPFEFLKTGLQLHRSLP--NAHPFNMMHQFKYYFSGCA 148

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYE-ACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCS 136
            L  G     +        +F  +E AC+      + ++    ++  + L +GA+ G   
Sbjct: 149 ALNVGTLFKTV-------TRFTTFEKACQ---LLKDPSSPSAFISGPRLLMAGAITGFME 198

Query: 137 VVATYPLDLIKTRLSIQTANLSSL------NRSKAKSISK----------PPGIWQ---- 176
            +   P + IKT +      LS        ++ KA++ SK           PGI      
Sbjct: 199 SLWVVPFENIKTTMVENALVLSGRFQKEIEDKGKAETGSKREVRATFHKQTPGISPRERL 258

Query: 177 LLSETXXXXXXXXXXXXXVWPTS------LGVVPYV-------ALNFAVYEQLREFGVNS 223
            L                ++ T        G  P +       A+ F  Y  L++     
Sbjct: 259 FLHYEEHPTSRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQL---I 315

Query: 224 SDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALV 283
           S  +P   +  Y   +G IS      +T P D+++ R Q      N     Y +  +   
Sbjct: 316 SPNKPL--NEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWAN-----YKNSLNCAY 368

Query: 284 TIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVV 319
            I   EG+  ++KG A  L KV  S  VS+ VY+ V
Sbjct: 369 RIFVEEGIPKFWKGWAPRLMKVGLSGGVSFGVYQYV 404

>Kwal_33.15446
          Length = 305

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 66/311 (21%), Positives = 118/311 (37%), Gaps = 51/311 (16%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGN 83
           + F++G  +G     V  PF+ +K+ LQ    T  + +G    + Q   ++G +G + G 
Sbjct: 20  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRF-KGPLDCVYQTMRQQGIRGFYLGF 78

Query: 84  GLNCIRIFPYSAVQFVV---YEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
               +      +V       Y    KK  + +    +E+L  +  + SG L G       
Sbjct: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQH----EEKLPLSGCILSGVLAGWSVSFIA 134

Query: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSISKP------PGIWQLLSETXXXXXXXXXXXXX 194
            P++L K +L +Q    ++  R     I K        G+++ L  T             
Sbjct: 135 APVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVST------------- 181

Query: 195 VWPTSLGVVPYVALNFAVYEQL-REFGVNSSDAQPSWKSNLYKLTIGAISGGVAQ----- 248
                L    +    +  YE L R F  N         +NL    I   +GG +      
Sbjct: 182 -----LIFRTHFVYWWGSYELLTRWFKAN---------TNLSDTAINFWAGGFSASFGFW 227

Query: 249 TITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPS 308
           T  YP D+++   QV+ +  ++      S  +A   I R  G+ G++KG   +  +  P+
Sbjct: 228 TTAYPSDVIK---QVI-LCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPA 283

Query: 309 TAVSWLVYEVV 319
            A +   +E V
Sbjct: 284 NAAALASFEFV 294

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 36/83 (43%), Gaps = 1/83 (1%)

Query: 21  DSNIAFLAGGVAGAVS-RTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGL 79
           D+ I F AGG + +    T   P + +K ++          R   ++   ++   G +G 
Sbjct: 210 DTAINFWAGGFSASFGFWTTAYPSDVIKQVILCNDKYDGSLRSWRNAASDIWRTRGIRGF 269

Query: 80  FRGNGLNCIRIFPYSAVQFVVYE 102
           F+G   + +R FP +A     +E
Sbjct: 270 FKGFVPSFLRSFPANAAALASFE 292

>Scas_328.1
          Length = 227

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 54/117 (46%), Gaps = 12/117 (10%)

Query: 197 PTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNL--YKLTIGAISGGVAQTITYPF 254
           P+ +G++ Y  L F +Y+ L+   +  S       S L  + +TI A       T +YP 
Sbjct: 104 PSVVGIMVYRGLYFGLYDSLKPVLLTGSFENAFLPSFLLGWAVTISA------STTSYPL 157

Query: 255 DLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAV 311
           D +RRR  ++   G  +  +Y    D    I   EGV   +KG  AN+F+ V +  V
Sbjct: 158 DTVRRR--MMMTSGQAV--KYKGAIDCFQQIVSQEGVYSLFKGCGANIFRGVAAAGV 210

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 28/65 (43%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNG 84
           +FL G      + T   P + V+  + + S      +G     +Q+  +EG   LF+G G
Sbjct: 139 SFLLGWAVTISASTTSYPLDTVRRRMMMTSGQAVKYKGAIDCFQQIVSQEGVYSLFKGCG 198

Query: 85  LNCIR 89
            N  R
Sbjct: 199 ANIFR 203

>Kwal_47.19228
          Length = 281

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 45/92 (48%), Gaps = 8/92 (8%)

Query: 60  NRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQ 119
           +R   ++++++Y   G +G  +G     IR    SAV+F  Y + K+ +          +
Sbjct: 128 SRQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMI-------SPNK 180

Query: 120 LTNTQRLFSGALCGGCSVVA-TYPLDLIKTRL 150
             N    F+      C+VVA T P+D+IKTR+
Sbjct: 181 PLNEYYAFALGFISSCAVVAVTQPIDVIKTRM 212

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 52/123 (42%), Gaps = 10/123 (8%)

Query: 197 PTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDL 256
           PT +      A+ F  Y  L++     S  +P   +  Y   +G IS      +T P D+
Sbjct: 153 PTIIRQTSNSAVRFTTYTSLKQM---ISPNKPL--NEYYAFALGFISSCAVVAVTQPIDV 207

Query: 257 LRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVY 316
           ++ R Q      N     Y +  +    I   EG + ++KG A  L KV  S  VS+ VY
Sbjct: 208 IKTRMQSKYTWSN-----YKNSLNCAYRIFVEEGFTKFWKGWAPRLMKVGLSGGVSFGVY 262

Query: 317 EVV 319
           + V
Sbjct: 263 QYV 265

 Score = 28.5 bits (62), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 40/89 (44%), Gaps = 1/89 (1%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNG 84
           AF  G ++      V  P + +K  +Q + + ++Y   +  + R ++ EEG    ++G  
Sbjct: 187 AFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYR-IFVEEGFTKFWKGWA 245

Query: 85  LNCIRIFPYSAVQFVVYEACKKKLFHVNG 113
              +++     V F VY+     +  VNG
Sbjct: 246 PRLMKVGLSGGVSFGVYQYVDNLMKAVNG 274

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 57/129 (44%), Gaps = 14/129 (10%)

Query: 36  SRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSA 95
           +R V +  ER   LL  +   +S+  G   ++ ++Y   G +G  +G      R    S 
Sbjct: 173 ARPVQTAHER--WLLHYERQPSSHFAG---TVLEIYRTRGVRGFLQGAMPTIFRQLGNSV 227

Query: 96  VQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTA 155
           V+F  Y    + L      +  + L   Q   +GAL     V  T P+D+IKTR+  +TA
Sbjct: 228 VRFTTYAWIVQSL------SPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTA 281

Query: 156 NL---SSLN 161
                SSLN
Sbjct: 282 WFTYKSSLN 290

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 5/80 (6%)

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299
           GA+S      +T P D+++ R Q          F Y S  +    I   EG    +KG  
Sbjct: 255 GALSSAAVVALTQPIDVIKTRMQ-----SKTAWFTYKSSLNCAYRIFVEEGFRYMWKGWV 309

Query: 300 ANLFKVVPSTAVSWLVYEVV 319
             LFKV  S  +S+ VY+ V
Sbjct: 310 PRLFKVSLSGGISFGVYQYV 329

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 69/302 (22%), Positives = 119/302 (39%), Gaps = 26/302 (8%)

Query: 21  DSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLF 80
           D+  +F+AG  AGA+   V  PFE  K  LQ+    +  +R     + +    +G   L+
Sbjct: 9   DAARSFVAGAAAGAIEGCVTYPFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQGAGALY 68

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGC-SVVA 139
            G     +     + V+F+ ++A ++ L    G      L+  + + +G   G   SV+A
Sbjct: 69  VGCPAFVVGNTCKAGVRFLGFDALRRALQDERGA-----LSGPRGMLAGLGAGLLESVLA 123

Query: 140 TYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTS 199
             P + +KT L      +     ++ +      G  +  +               V P +
Sbjct: 124 VTPFEAVKTAL------IDDRQAARPRYQHNGRGAARNYALLLRELGLRGLYGGLV-PVA 176

Query: 200 LGVVPYVALNFAVYEQLRE----FGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFD 255
           L      A+ F  Y QL++    +    +D QP      +   +GA+SG V    T P D
Sbjct: 177 LRQASNQAVRFGCYTQLKQAVQRYAGTPAD-QPLGSGQTF--LVGALSGIVTVYATMPVD 233

Query: 256 LLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLV 315
            ++ R Q L         RY S       + R EGV   ++G    L ++V S  + +  
Sbjct: 234 TVKTRMQALDAA------RYGSTVGCFRAVVREEGVRALWRGATPRLGRLVLSGGIVFTA 287

Query: 316 YE 317
           YE
Sbjct: 288 YE 289

>Scas_702.10
          Length = 302

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 108/291 (37%), Gaps = 27/291 (9%)

Query: 29  GGVAGAVSRTVVSPFERVKILLQVQS-STTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNC 87
           GG AG  +  +  P +  K+ LQ       +  R + + +R     E   GL+ G     
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRMLTTILRN----ENVMGLYSGLSAAV 71

Query: 88  IRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIK 147
           +R   Y+ V+F  Y+  K+ L      N    L     +FSGA+ G     A    D++ 
Sbjct: 72  LRQCTYTTVRFGAYDLMKENLIPQGHINDMVYLLPCS-MFSGAIGGLVGNFA----DVVN 126

Query: 148 TRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVW-PTSLGVVPYV 206
            R+   +A    L R+   +I    G++++                  W P  +  V   
Sbjct: 127 IRMQNDSALKPELRRNYRNAID---GVYKIYMHEGGIKTLLTG-----WKPNMVRGVLMT 178

Query: 207 ALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAM 266
           A     Y+  + + V      P  K N   L+   ++G VA TI  P D+++ R      
Sbjct: 179 ASQVVTYDVFKNYLVTKLSFDP--KKNSTHLSASLLAGLVATTICSPADVIKTRIM---- 232

Query: 267 GGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
             N       S    L +  + EG S  ++G      ++ P T + +   E
Sbjct: 233 --NAHKTESESAIKILTSAIKKEGPSFMFRGWLPIFTRLGPFTMLIFFAIE 281

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 7/80 (8%)

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLA 299
           G  +G  A  +T+P DL + R Q   +    LG         L TI R E V G Y GL+
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLG-------RMLTTILRNENVMGLYSGLS 68

Query: 300 ANLFKVVPSTAVSWLVYEVV 319
           A + +    T V +  Y+++
Sbjct: 69  AAVLRQCTYTTVRFGAYDLM 88

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 62/149 (41%), Gaps = 8/149 (5%)

Query: 6   TVLEQPN-SIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIF 64
           T  + PN S+ D+ K       LAG +    + + + P + VK  +Q++     Y+ G+ 
Sbjct: 3   TSYQVPNYSLSDYAKFA-----LAGAIGCGATHSAMVPIDVVKTRIQLEP--LKYSSGMV 55

Query: 65  SSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQ 124
            S R++  EEG   L  G G   +      A +F  YE  KK      G     Q     
Sbjct: 56  GSFRKIVGEEGAAALLTGFGPTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPI 115

Query: 125 RLFSGALCGGCSVVATYPLDLIKTRLSIQ 153
            + S A+    + +A  PL+  + RL  Q
Sbjct: 116 YIGSAAIAEFFADIALCPLEATRIRLVSQ 144

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 75/192 (39%), Gaps = 24/192 (12%)

Query: 128 SGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXX 187
           +GA+  G +  A  P+D++KTR+ ++    SS      + I    G   LL+        
Sbjct: 21  AGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGAAALLT-------- 72

Query: 188 XXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPS--WKSNLYKLTIGAISGG 245
                    PT LG     A  F  YE  ++  V++   + +  +++ +Y +   AI+  
Sbjct: 73  ------GFGPTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIY-IGSAAIAEF 125

Query: 246 VAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKV 305
            A     P +  R R        N L             I + EG+  +Y G    LFK 
Sbjct: 126 FADIALCPLEATRIRLVSQPTFANGL-------VGGFARILKEEGIGSFYNGFTPILFKQ 178

Query: 306 VPSTAVSWLVYE 317
           +P     ++V+E
Sbjct: 179 IPYNIAKFVVFE 190

>Kwal_55.21106
          Length = 328

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 67/315 (21%), Positives = 116/315 (36%), Gaps = 66/315 (20%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTS--------------------YNRGIFSS 66
           + G VA +++  VV P + VK L+Q Q+   +                    Y   + + 
Sbjct: 8   ITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDAL 67

Query: 67  IRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQ-EQLTNTQR 125
           I+ ++  +G  GL++G   + I  F  S   F  Y   +K  F      G+  + +  + 
Sbjct: 68  IK-IFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPEE 126

Query: 126 LFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSI----SKPPGIWQLLSET 181
           L  G +    S + T P+ +I TR    T+      R     I    +   G W+     
Sbjct: 127 LLLGIVAAAVSQIFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQNNITGFWR----- 181

Query: 182 XXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDA------------QPS 229
                         +  SL +    ++ FA YE+L++  + S  A            Q S
Sbjct: 182 -------------GFKVSLILTVNPSITFASYEKLQDIFITSKRAVDENGQLLETSGQLS 228

Query: 230 WKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAE 289
            + N     +G  S  ++  IT P  + +   Q         G  + S    L+ + + E
Sbjct: 229 PRQNFL---LGVFSKVISTLITQPLIVSKAYLQ-------RTGSNFQSFQQVLLYLYKQE 278

Query: 290 GVSGYYKGLAANLFK 304
           G+   +KGLA  L K
Sbjct: 279 GLISLWKGLAPQLSK 293

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 120 LTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTAN 156
           +T+ +   +GA+    + V  YPLDL+KT   IQT N
Sbjct: 1   MTSLESAITGAVASSLANVVVYPLDLVKTL--IQTQN 35

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 81/216 (37%), Gaps = 32/216 (14%)

Query: 112 NGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKP 171
           N ++   +LT  + L +GA   G     T P+ +IK R      N SSL  +     +K 
Sbjct: 107 NKSSSLPRLTMYENLLTGAFARGLVGYITMPITVIKVRYESTLYNYSSLKEAITHIYTK- 165

Query: 172 PGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREF----------GV 221
                                     T L   PY  L   +YE+ ++             
Sbjct: 166 --------------EGLFGFFRGFGATCLRDAPYAGLYVLLYEKSKQLLPMVLPSRFIHY 211

Query: 222 NSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDA 281
           N      ++ S     T   +S  +A T+T PFD ++ R Q+          ++T+ ++ 
Sbjct: 212 NPEGGFTTYTSTTVNTTSAVLSASLATTVTAPFDTIKTRMQLEPS-------KFTNSFNT 264

Query: 282 LVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
             +I + E V   + GL+  L +   S  ++W +YE
Sbjct: 265 FTSIVKNENVLKLFSGLSMRLARKAFSAGIAWGIYE 300

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 70/163 (42%), Gaps = 21/163 (12%)

Query: 18  LKQDSNIAFLAGG-----------VAGAVSRTVVSPFERVKILLQVQSSTTSYN-RGIFS 65
           L  DSNI +               + GA +R +V        +++V+  +T YN   +  
Sbjct: 98  LTNDSNIVYNKSSSLPRLTMYENLLTGAFARGLVGYITMPITVIKVRYESTLYNYSSLKE 157

Query: 66  SIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKK--------KLFHVNGNNG- 116
           +I  +Y +EG  G FRG G  C+R  PY+ +  ++YE  K+        +  H N   G 
Sbjct: 158 AITHIYTKEGLFGFFRGFGATCLRDAPYAGLYVLLYEKSKQLLPMVLPSRFIHYNPEGGF 217

Query: 117 QEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSS 159
               + T    S  L    +   T P D IKTR+ ++ +  ++
Sbjct: 218 TTYTSTTVNTTSAVLSASLATTVTAPFDTIKTRMQLEPSKFTN 260

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 88/212 (41%), Gaps = 43/212 (20%)

Query: 122 NTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSET 181
           N+  L  G   G  S VA  PLDL+KTR  IQ    ++L ++  K I  P  +W+     
Sbjct: 10  NSSHLIGGFFGGLTSAVALQPLDLLKTR--IQQDKKATLWKN-LKEIDSPLQLWR----- 61

Query: 182 XXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSW----------K 231
                          P++L      AL  +    +R       +A PS            
Sbjct: 62  ------------GTLPSALRTSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKS 109

Query: 232 SNLYKLTI------GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTI 285
           S+L +LT+      GA + G+   IT P  +++ R++          + Y+S+ +A+  I
Sbjct: 110 SSLPRLTMYENLLTGAFARGLVGYITMPITVIKVRYESTL-------YNYSSLKEAITHI 162

Query: 286 GRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
              EG+ G+++G  A   +  P   +  L+YE
Sbjct: 163 YTKEGLFGFFRGFGATCLRDAPYAGLYVLLYE 194

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 58/309 (18%), Positives = 122/309 (39%), Gaps = 47/309 (15%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGN 83
           + F+AG  +G     V  PF+ +K+ LQ   + T + +G    + + +  +G +G + G 
Sbjct: 25  MGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRF-KGPLDCVYKTFRNQGIRGFYLG- 82

Query: 84  GLNCIRIFPYSAVQFVVYEACK-------KKLFHVNGNNGQEQLTNTQRLFSGALCGGCS 136
                  F    V +++ ++         + L H       E+L  +  + SG L G   
Sbjct: 83  -------FTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSV 135

Query: 137 VVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVW 196
                P++L K +L +Q    ++  +     I K      + S               ++
Sbjct: 136 SFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKK------IYSAQGIRGLYKGLISTLIF 189

Query: 197 PTSLGVVPYVALNFAVYEQL-REFGVNSSDAQPSWKSNLYKLTIGAISGGVAQ-----TI 250
            T      +    +  YE L R F  N+  ++ +         I   +GG +      T 
Sbjct: 190 RT------HFVYWWGSYELLTRWFRENTKMSEAA---------INFWAGGFSASFGFWTT 234

Query: 251 TYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTA 310
            YP D++++    + +  ++    + S   A+  I +++G++G++KG   +  +  P+ A
Sbjct: 235 AYPSDVVKQ----VVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPANA 290

Query: 311 VSWLVYEVV 319
            +   +E V
Sbjct: 291 AALAAFEFV 299

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

Query: 21  DSNIAFLAGGVAGAVS-RTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGL 79
           ++ I F AGG + +    T   P + VK ++          +   ++++ +Y  +G  G 
Sbjct: 215 EAAINFWAGGFSASFGFWTTAYPSDVVKQVVLCNDKYDGSFKSWRTAVKDIYQSKGINGF 274

Query: 80  FRGNGLNCIRIFPYSAVQFVVYE 102
           F+G   + +R FP +A     +E
Sbjct: 275 FKGFVPSFLRSFPANAAALAAFE 297

>Scas_613.24
          Length = 177

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 79/186 (42%), Gaps = 26/186 (13%)

Query: 125 RLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXX 184
            L SG + G  S V   PLDL+KTR  IQ    ++L  S  K I  P   W+        
Sbjct: 11  HLVSGFIGGLSSAVTLQPLDLLKTR--IQQHKGATL-WSAIKDIKDPIQFWR-------- 59

Query: 185 XXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLY---KLTIGA 241
                        TS+G   Y++    +  QL      S+ ++ S    L     L  GA
Sbjct: 60  -----GTLPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGA 114

Query: 242 ISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAAN 301
           ++ G+   IT P  +L+ R++          + Y S+ +A+  I + EG+SG++KG    
Sbjct: 115 MARGLVGYITMPITILKVRYE-------STYYSYKSMNEAIKDIYKMEGISGFFKGFGPT 167

Query: 302 LFKVVP 307
           +   +P
Sbjct: 168 VGIGIP 173

 Score = 32.3 bits (72), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 66/159 (41%), Gaps = 15/159 (9%)

Query: 22  SNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFR 81
           +++  ++G + G  S   + P + +K  +Q     T     ++S+I+ +   +     +R
Sbjct: 8   TSVHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGAT-----LWSAIKDI---KDPIQFWR 59

Query: 82  GNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQ------EQLTNTQRLFSGALCGGC 135
           G   + +R    SA+        + +L H    +         QLT  + L +GA+  G 
Sbjct: 60  GTLPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGL 119

Query: 136 SVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGI 174
               T P+ ++K R      +  S+N +  K I K  GI
Sbjct: 120 VGYITMPITILKVRYESTYYSYKSMNEA-IKDIYKMEGI 157

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 50/107 (46%), Gaps = 3/107 (2%)

Query: 45  RVK-ILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEA 103
           R+K I L+   +   Y +G   +++++Y  EG  GL+RG G + +  F  S   F  Y  
Sbjct: 57  RIKPIALRSPQAAEQY-KGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTL 115

Query: 104 CKKKLFHV-NGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTR 149
            +K  F +     G  + +  + L  G +    S +   P++++ TR
Sbjct: 116 VRKHYFRLKQARGGDARFSTPEELVLGIVAAATSQLFVNPINVVATR 162

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/289 (18%), Positives = 115/289 (39%), Gaps = 39/289 (13%)

Query: 36  SRTVVSPFERVKILLQVQSSTTSYN-RGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYS 94
           S  +  P   +   LQ Q +  +   +    +I+++Y ++G  G + G       +   +
Sbjct: 27  SMALTYPLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTN 86

Query: 95  AVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQT 154
            V +  YE   + +  V  +   ++L   + + +G + G  + +A+ P+ +  TR+++  
Sbjct: 87  FVYYYFYELTSRNVLKVRKH---KKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTK 143

Query: 155 ANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYE 214
           +  ++L             I +++ +              V    L + P V   + V+E
Sbjct: 144 SEKTAL-----------ATIIEIVKKDSAKTLFNGLKPALV----LVMNPIV--QYTVFE 186

Query: 215 QLREFGV---NSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGN-- 269
           QL+   +         PSW        +GA+    A   TYP+  L+ R  +   G +  
Sbjct: 187 QLKNLVLAWNKQGILSPSW-----AFLLGALGKLAATGSTYPYITLKTRMHLSESGKHTD 241

Query: 270 ------ELGFRYT--SVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTA 310
                   G + +  S+   +  I + +GVSG Y+G+   L + + + A
Sbjct: 242 DDSGKKAKGHKASSKSMLSLITEIVKKDGVSGLYRGVGIKLAQSILTAA 290

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 64/144 (44%), Gaps = 10/144 (6%)

Query: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNG 84
           + L G VAG+V+    +P      +   + + T   +   ++I ++  ++  K LF  NG
Sbjct: 114 SMLTGCVAGSVTAIASNPI----WVANTRMTVTKSEKTALATIIEIVKKDSAKTLF--NG 167

Query: 85  LNCIRIFPYSA-VQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPL 143
           L    +   +  VQ+ V+E  K  +      N Q  L+ +     GAL    +  +TYP 
Sbjct: 168 LKPALVLVMNPIVQYTVFEQLKNLVL---AWNKQGILSPSWAFLLGALGKLAATGSTYPY 224

Query: 144 DLIKTRLSIQTANLSSLNRSKAKS 167
             +KTR+ +  +   + + S  K+
Sbjct: 225 ITLKTRMHLSESGKHTDDDSGKKA 248

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 35/72 (48%), Gaps = 3/72 (4%)

Query: 247 AQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVV 306
           +  +TYP   +  + Q     GN+   +  S  + +  I R +G+ G+Y GL + ++ + 
Sbjct: 27  SMALTYPLVTITTKLQT---QGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMA 83

Query: 307 PSTAVSWLVYEV 318
            +  V +  YE+
Sbjct: 84  LTNFVYYYFYEL 95

>Scas_715.45
          Length = 305

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/167 (19%), Positives = 79/167 (47%), Gaps = 12/167 (7%)

Query: 3   EVLTVLEQPNSIKD---FLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSY 59
           E+   L   + +KD     K  ++I  L+   A   +  ++ PFE +K+  + Q++   +
Sbjct: 93  ELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKV--KQQTTMPPW 150

Query: 60  NRGIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQ 119
              +    +++Y +EG  G ++G      R  PY+  +F  +E   + ++       + +
Sbjct: 151 CNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIY-ARLPTKKSE 209

Query: 120 LTNTQRL---FSGALCGG--CSVVATYPLDLIKTRLSIQTANLSSLN 161
           ++  Q++   F G    G  C++V ++P D++ ++++ +     S+N
Sbjct: 210 MSALQQISVSFVGGYMAGILCAIV-SHPADVMVSKINNERKVNESMN 255

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 64/314 (20%), Positives = 116/314 (36%), Gaps = 34/314 (10%)

Query: 12  NSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVY 71
           + I+ + K+      L G VA   + + V+P + +K  LQV  +    N    S I Q+ 
Sbjct: 6   SPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNT---SGIIQIL 62

Query: 72  HEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKK--KLFHVNGNNGQEQLTNTQRLFSG 129
            +EG   LF G G  CI      A ++  YE  K+      V       +   +  L S 
Sbjct: 63  KKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSS 122

Query: 130 ALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLS--ETXXXXXX 187
           A     + +   P + IK +                +  + PP    ++   +       
Sbjct: 123 ATAEFFADIMLCPFEAIKVK----------------QQTTMPPWCNNVIEGWKKMYAKEG 166

Query: 188 XXXXXXXVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTI----GAIS 243
                  + P     +PY    F  +E++ E        + S  S L ++++    G ++
Sbjct: 167 LNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMA 226

Query: 244 GGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLF 303
           G +   +++P D++  +        NE      S+  AL  I    G  G + GL   + 
Sbjct: 227 GILCAIVSHPADVMVSKIN------NERKVN-ESMNVALKRIYSRIGFVGLWNGLPVRIL 279

Query: 304 KVVPSTAVSWLVYE 317
            +   T+  WL+Y+
Sbjct: 280 MIGTLTSFQWLIYD 293

 Score = 28.5 bits (62), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 17/86 (19%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 20  QDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGL 79
           Q  +++F+ G +AG +   V  P +   +++   ++    N  +  +++++Y   G  GL
Sbjct: 214 QQISVSFVGGYMAGILCAIVSHPAD---VMVSKINNERKVNESMNVALKRIYSRIGFVGL 270

Query: 80  FRGNGLNCIRIFPYSAVQFVVYEACK 105
           + G  +  + I   ++ Q+++Y++ K
Sbjct: 271 WNGLPVRILMIGTLTSFQWLIYDSFK 296

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 58/133 (43%), Gaps = 8/133 (6%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGN 83
           + F++G  +G     V  PF+ +K+ LQ    +T + +G    + + + ++G +G + G 
Sbjct: 62  MGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRF-KGPLDCVYKTFTQQGIRGFYLGF 120

Query: 84  GLNCIRIFPYSAVQFVV---YEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVAT 140
               +      +V       Y    KK  + N    +E+L  +  + SG + G       
Sbjct: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYN----EEKLPLSGCIISGVMAGWSVSFIA 176

Query: 141 YPLDLIKTRLSIQ 153
            P++L K +L +Q
Sbjct: 177 APVELAKAKLQVQ 189

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQ--SSTTSYNRGIFSSIRQVYHEEGTKGLFRG 82
           ++G +AG     + +P E  K  LQVQ  + TT Y  G    I++VY   G +GL++G
Sbjct: 163 ISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYT-GPVDVIKKVYSSNGVRGLYKG 219

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 75/152 (49%), Gaps = 11/152 (7%)

Query: 25  AFLAGGVAGAVSRTVVSP-----FERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGL 79
           A + GGV+G V++  ++       + V+I    +S+     +  +++ +++Y++EG +G+
Sbjct: 107 AGIMGGVSGGVAQAYLTMGFCTCMKTVEITKH-KSAAAGAKQSSWAAFKEIYNKEGIRGI 165

Query: 80  FRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGN-NGQEQLTNTQRLFSGALCGGCSVV 138
            +G     IR       +F      ++ L    G  N  ++LT  +++F+ A+ GG S  
Sbjct: 166 NKGVNAVAIRQMTNWGSRFGFSRLVEEGLRKFTGKTNPDDKLTALEKIFASAIGGGLSAW 225

Query: 139 ATYPLDLIKTRLSIQTANLSSLNRSKAKSISK 170
              P+++I+  +  +T   +  NR K  ++ K
Sbjct: 226 -NQPIEVIRVEMQSKT---NDPNRPKDLTVGK 253

 Score = 28.5 bits (62), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 6/45 (13%)

Query: 42  PFERVKILLQVQSSTTSYNR----GIFSSIRQVYHEEGTKGLFRG 82
           P E +++  ++QS T   NR     +  + R +Y   G KGL+RG
Sbjct: 228 PIEVIRV--EMQSKTNDPNRPKDLTVGKAFRYIYQSNGVKGLYRG 270

>Kwal_34.15907
          Length = 312

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 65/132 (49%), Gaps = 7/132 (5%)

Query: 25  AFLAGGVAGAVSRTVVSP-----FERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGL 79
           A + GGV+G V++  ++       + V+I     +   +  +  +S+ +++Y +EG KG+
Sbjct: 110 AGIMGGVSGGVAQAYLTMGFCTCMKTVEITKAKSAVAGAIPQSSWSAFKEIYSKEGIKGI 169

Query: 80  FRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGN-NGQEQLTNTQRLFSGALCGGCSVV 138
            +G     IR       +F +    ++ +    G  N  ++LT  +++F+ AL GG S  
Sbjct: 170 NKGVNAVAIRQMTNWGSRFGLSRLVEQGIRDFTGKTNPDDKLTALEKIFASALGGGLSAW 229

Query: 139 ATYPLDLIKTRL 150
              P+++I+  +
Sbjct: 230 -NQPIEVIRVEM 240

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 71/155 (45%), Gaps = 9/155 (5%)

Query: 16  DFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEG 75
            +L     +  +A   A  ++  ++ PFE +K+  + Q++   +   +    +++Y E G
Sbjct: 103 SWLSPGVTVYLMASATAEFLADIMLCPFEAIKV--KQQTTMPPFCNNVVDGWKKMYAESG 160

Query: 76  -TKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRL----FSGA 130
             K  ++G      R  PY+  +F  +E   +K++ V     +E++   Q++      G 
Sbjct: 161 GMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKK-KEEMNALQQISVSFVGGY 219

Query: 131 LCGGCSVVATYPLDLIKTRL-SIQTANLSSLNRSK 164
           L G      ++P D++ +++ S + AN S    SK
Sbjct: 220 LAGILCAAVSHPADVMVSKINSERKANESMSVASK 254

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 3/76 (3%)

Query: 9  EQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIR 68
          +QP  I+ + K+      L G +A   + + ++P + VK  LQV     + N       R
Sbjct: 5  KQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSN---LQGFR 61

Query: 69 QVYHEEGTKGLFRGNG 84
          ++   EG K ++ G G
Sbjct: 62 KIIANEGWKKVYTGFG 77

 Score = 31.2 bits (69), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 22/103 (21%), Positives = 54/103 (52%), Gaps = 4/103 (3%)

Query: 3   EVLTVLEQPNSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRG 62
           ++ +VL +     + L+Q S ++F+ G +AG +   V  P +   +++   +S    N  
Sbjct: 193 KIYSVLPKKKEEMNALQQIS-VSFVGGYLAGILCAAVSHPAD---VMVSKINSERKANES 248

Query: 63  IFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACK 105
           +  + +++Y + G  GL+ G  +  + I   ++ Q+++Y++ K
Sbjct: 249 MSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFK 291

>Scas_671.1*
          Length = 123

 Score = 37.0 bits (84), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 8/81 (9%)

Query: 238 TIGAI-SGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYK 296
           ++ AI S  +A  IT PFD ++ R Q+           +T+ +  LV I + E +   + 
Sbjct: 43  SVSAIASASLATAITAPFDTIKTRMQLKPKV-------FTNFFTTLVLITKNESIFQLFS 95

Query: 297 GLAANLFKVVPSTAVSWLVYE 317
           GL+  L +   S  ++W +YE
Sbjct: 96  GLSMRLTRKALSAGIAWGIYE 116

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 57/255 (22%), Positives = 97/255 (38%), Gaps = 44/255 (17%)

Query: 67  IRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQ-EQLTNTQR 125
           I +VY  EG  GL+ G   + +  F  S   F  Y   ++  F V    G+  + +  + 
Sbjct: 94  IVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKKVKGEAARFSTIEE 153

Query: 126 LFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSK--AKSISKPPGI---WQLLSE 180
           L    L    S + T P++++ T+   +   L   N  K  AK +    GI   W+ L  
Sbjct: 154 LLLSMLAAATSQLFTNPINIVSTKQQTRRG-LEGDNSFKAIAKEVYDEDGITGFWKSLK- 211

Query: 181 TXXXXXXXXXXXXXVWPTSLGVVPYVALNFAVYEQLREF---------GVNSSDAQPSWK 231
                             SL +    ++ +A  E+L++           +N S  Q    
Sbjct: 212 -----------------VSLVLTINPSITYASAEKLKDILYHVEWNAKDLNDSSLQLKPG 254

Query: 232 SNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGV 291
            N     IG +S  ++  +T+P  + +   Q  +        ++TS  + L  + R EG 
Sbjct: 255 QNFL---IGVLSKIISTCLTHPLIVAKASLQRSSS-------KFTSFQEVLTYLYRHEGA 304

Query: 292 SGYYKGLAANLFKVV 306
              +KGL   L K V
Sbjct: 305 HALWKGLLPQLTKGV 319

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 274 RYTSVWDALVTIGRAEGVSGYYKGLAANLF 303
           RY    D +V + R EG  G Y GL+A+L 
Sbjct: 86  RYKHALDVIVKVYRNEGFGGLYHGLSASLL 115

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 120 LTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQ 153
           + + +  F GA+  G + +A YPLDL KT +  Q
Sbjct: 1   MASLENAFVGAVSSGFANLAVYPLDLAKTVIQTQ 34

>Kwal_23.5757
          Length = 307

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 63/295 (21%), Positives = 104/295 (35%), Gaps = 27/295 (9%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLN 86
           L G VA   + + V+P + VK   QV +S    N       RQ+   EG   +F G G  
Sbjct: 24  LGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSN---LDGWRQIVRSEGATKVFTGVGAT 80

Query: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLI 146
            I      A ++  YE  K +   +              L + A     + +   P + I
Sbjct: 81  AIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAI 140

Query: 147 KTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYV 206
           K R   QTA      R+   + SK  G     S               + P     +PY 
Sbjct: 141 KVRQ--QTAVPPPFARNVFDAYSKMVGAEGFAS-----------LYKGITPLWFRQIPYT 187

Query: 207 ALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTI----GAISGGVAQTITYPFDLLRRRFQ 262
              F  +E++ E             S L ++++    G ++G +   +++P D++  +  
Sbjct: 188 MCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVN 247

Query: 263 VLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
                G        S   A   I    G  G + GLA  +  +   T+  WL+Y+
Sbjct: 248 NERKSGE-------STLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYD 295

 Score = 29.3 bits (64), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 79/195 (40%), Gaps = 23/195 (11%)

Query: 129 GALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXX 188
           G +  G +  A  PLDL+K R  +  A+L   N    + I +  G  ++ +         
Sbjct: 26  GLVACGPTHSAVTPLDLVKCRRQVD-ASLYKSNLDGWRQIVRSEGATKVFT--------- 75

Query: 189 XXXXXXVWPTSLGVVPYVALNFAVYEQLRE--FGVNSSDAQPSWKSNLYKLTIGAISGGV 246
                 V  T++G     A  +  YE  +     + S +   S+++ ++ L   A +  +
Sbjct: 76  -----GVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIF-LAASASAEFI 129

Query: 247 AQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVV 306
           A     P++ ++ R Q              +V+DA   +  AEG +  YKG+    F+ +
Sbjct: 130 ADIFLCPWEAIKVRQQTAVPPPFA-----RNVFDAYSKMVGAEGFASLYKGITPLWFRQI 184

Query: 307 PSTAVSWLVYEVVCD 321
           P T   +  +E + +
Sbjct: 185 PYTMCKFTSFERIVE 199

>Sklu_2250.1 YBL030C, Contig c2250 1624-1847
          Length = 75

 Score = 35.8 bits (81), Expect = 0.005,   Method: Composition-based stats.
 Identities = 15/25 (60%), Positives = 20/25 (80%)

Query: 29 GGVAGAVSRTVVSPFERVKILLQVQ 53
          GGV+ AVS+T  +P ERVK+L+Q Q
Sbjct: 2  GGVSAAVSKTAAAPIERVKLLIQNQ 26

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 240 GAISGGVAQTITYPFDLLRRRFQVLAM----GGNELGFRYTSVWDALVTIGRAEGVSGYY 295
           GA++  +A T  YP DL +   Q        G ++   +Y +V D ++ I +  G  G Y
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLY 69

Query: 296 KGLAANL 302
           +GLA N+
Sbjct: 70  QGLATNV 76

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 20/40 (50%)

Query: 120 LTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSS 159
           + + +  F+GA+    +    YPLDL KT +  Q  N  S
Sbjct: 1   MASLESAFTGAVASSLAATTVYPLDLAKTLIQTQHKNADS 40

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/158 (20%), Positives = 57/158 (36%), Gaps = 37/158 (23%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNR------------------------- 61
           +AG + G V    + PFE +K  L +QS+   + +                         
Sbjct: 80  IAGTLTGIVESLFIIPFENIKTTL-IQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVA 138

Query: 62  ---GIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQE 118
               +  +++ +Y   G     +G      R    +++QF  Y A K+ L        Q 
Sbjct: 139 RIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLL--------QA 190

Query: 119 QLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTAN 156
           +      + +G       V  T P+D++KTR+  Q A 
Sbjct: 191 RNDKASSVITGLATSFTLVAMTQPIDVVKTRMMSQNAK 228

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 64/173 (36%), Gaps = 49/173 (28%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNR------------------------ 61
            +AG + G +    + PFE VK+ + +Q+S  S+ R                        
Sbjct: 105 LMAGALTGTMESLCIIPFENVKVAM-IQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKP 163

Query: 62  ----------------GIFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACK 105
                            + ++  ++Y + G +  F+G     +R    S V+F  +   K
Sbjct: 164 TLRSSYEALFPEKLPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLK 223

Query: 106 KKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVV-ATYPLDLIKTRLSIQTANL 157
           +  F        E       L S      C+VV AT PLD+IKTR+  + + L
Sbjct: 224 Q--FAPKEYQNNEYFATLLGLISS-----CAVVGATQPLDVIKTRMQAKDSVL 269

 Score = 34.3 bits (77), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 69/328 (21%), Positives = 122/328 (37%), Gaps = 48/328 (14%)

Query: 19  KQDSNIAFL-AGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTK 77
           K + N+  + AG V+G  S T+  PFE +K  LQ+       +R + ++          +
Sbjct: 5   KVNDNVTLITAGSVSGLFSATITYPFEFLKTGLQL-------HRNVVAAKPFEVLGYQVR 57

Query: 78  GLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSV 137
             F G     I +   ++++F+ ++   + L           L+  Q L +GAL G    
Sbjct: 58  TYFAGCSAVNIGVVMKTSLRFLAFDKASEWL-RPPALAKDAPLSGVQLLMAGALTGTMES 116

Query: 138 VATYPLDLIKT-----------RLSIQTANLS-SLNRSKAKSISKPPGIWQ----LLSET 181
           +   P + +K            RL+  T+N+   +     K+  K P +      L  E 
Sbjct: 117 LCIIPFENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEALFPEK 176

Query: 182 XXXXXXXXXXXXX-----------VWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSW 230
                                     PT +  V    + F  +  L++F      A   +
Sbjct: 177 LPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQF------APKEY 230

Query: 231 KSNLYKLTI-GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAE 289
           ++N Y  T+ G IS       T P D+++ R Q       +    Y +  +    I   E
Sbjct: 231 QNNEYFATLLGLISSCAVVGATQPLDVIKTRMQ-----AKDSVLLYRNSINCAYRIFVEE 285

Query: 290 GVSGYYKGLAANLFKVVPSTAVSWLVYE 317
           G +  +KG    L KV  S +VS+ +Y+
Sbjct: 286 GFAMLWKGWLPRLMKVGLSGSVSFGIYQ 313

>Scas_562.12
          Length = 300

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 54/123 (43%), Gaps = 9/123 (7%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNC 87
           AG + G +   V+ P + +KI  Q         RG      ++  +EG   L+RG G   
Sbjct: 125 AGSLIG-IGEIVLLPLDVLKIKRQTNPEAFK-GRGFV----KILKDEGIFNLYRGWGWTA 178

Query: 88  IRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIK 147
            R  P S   F      K+   ++ G     Q + +Q   S  +   CS++ + PLD+IK
Sbjct: 179 ARNAPGSFALFGGNAFAKE---YILGLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIK 235

Query: 148 TRL 150
           TR+
Sbjct: 236 TRI 238

 Score = 32.0 bits (71), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 38/88 (43%), Gaps = 9/88 (10%)

Query: 226 AQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTI 285
           +Q SW  N     +GA     +  ++ P D+++ R Q  +    E G   T V +     
Sbjct: 206 SQASWSQNFISSIVGA---SCSLIVSAPLDVIKTRIQNRSFDNPETGL--TIVKNTF--- 257

Query: 286 GRAEGVSGYYKGLAANLFKVVPSTAVSW 313
            + EG++ ++KGL   L    P    S+
Sbjct: 258 -KNEGITAFFKGLTPKLLTTGPKLVFSF 284

>Scas_705.9
          Length = 323

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 8/80 (10%)

Query: 232 SNLYKLTIGAISGGVAQTITYPFDLLRRRFQ--VLAMGGNELG------FRYTSVWDALV 283
           SNL     GAI+  +A  I YP D+ +   Q    A   +EL        R  +V   L+
Sbjct: 2   SNLESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLI 61

Query: 284 TIGRAEGVSGYYKGLAANLF 303
            I R  G+ G Y+G++ ++F
Sbjct: 62  RIFRKRGLRGLYQGMSTSVF 81

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 60/135 (44%), Gaps = 8/135 (5%)

Query: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGL 85
            + G  A A+++ V +P E   IL + Q++    N   +S ++Q+Y E   K      G 
Sbjct: 124 LIVGVGAAALTQVVNNPIE--VILTKQQTTDDKDNVDFYSVLKQIYVESNGKLSSYWKGF 181

Query: 86  NCIRIFPYS-AVQFVVYEACKKKLFHVNGNNGQE---QLTNTQRLFSGALCGGCSVVATY 141
               I   + ++ F  Y+  K  L     N+ +    QLT  Q    GAL    S + T 
Sbjct: 182 KVSLILTVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKIISTIITQ 241

Query: 142 PLDLIKTRLSIQTAN 156
           P  LI  ++S+Q +N
Sbjct: 242 P--LIVAKVSLQRSN 254

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 3/62 (4%)

Query: 23  NIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRG 82
           N  F+ G +A  +S  +  P    K+ LQ  +S   +   +   +R +Y EEG   L++G
Sbjct: 223 NQNFILGALAKIISTIITQPLIVAKVSLQRSNSKFKHFEEV---LRYLYKEEGVLALWKG 279

Query: 83  NG 84
            G
Sbjct: 280 VG 281

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/155 (17%), Positives = 66/155 (42%), Gaps = 5/155 (3%)

Query: 19  KQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKG 78
           +  + +   A   A  ++  ++ P+E +K+  + Q++   + +       ++   EG  G
Sbjct: 109 RHRTAVYLCASASAEFLADILLCPWEAIKV--KQQTTIPPFCKNFLEGWSKITAAEGLSG 166

Query: 79  LFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQ---RLFSGALCGGC 135
           L++G      R  PY+  +F  +E   + ++     + QE   + Q       G L G  
Sbjct: 167 LYKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGIL 226

Query: 136 SVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISK 170
             V ++P D++ ++++       S+  +  +  S+
Sbjct: 227 CAVVSHPADVMVSKVNADRKQGESMVEASKRIYSR 261

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 55/296 (18%), Positives = 103/296 (34%), Gaps = 30/296 (10%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLN 86
           L G VA   + + V+P + VK  LQV       N       + +   EG   +F G G  
Sbjct: 20  LGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSN---LDGWKTIVRSEGLSKVFTGVGAT 76

Query: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLI 146
            I      A ++  YE  K+   ++       +      L + A     + +   P + I
Sbjct: 77  FIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAI 136

Query: 147 KTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETXXXXXXXXXXXXXVWPTSLGVVPYV 206
           K +   Q   +    ++  +  SK                        + P     +PY 
Sbjct: 137 KVK---QQTTIPPFCKNFLEGWSK-----------ITAAEGLSGLYKGITPLWCRQIPYT 182

Query: 207 ALNFAVYEQLRE-----FGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRF 261
              F  +E++ E        +  +  PS +  +     G ++G +   +++P D++  + 
Sbjct: 183 MCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGV-SFVGGYLAGILCAVVSHPADVMVSKV 241

Query: 262 QVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
                 G        S+ +A   I    G  G + GL   +F +   T+  WL+Y+
Sbjct: 242 NADRKQGE-------SMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYD 290

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 64/134 (47%), Gaps = 15/134 (11%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN-RGIFSSIRQVYHEEGTKGLFRGNGLN 86
           AG + G +   V+ P + +KI  + Q++  S+  RG    +R    +EG   L+RG G  
Sbjct: 125 AGSLIG-IGEIVLLPLDVLKI--KRQTNPESFKGRGFIKILR----DEGLFNLYRGWGWT 177

Query: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCS-VVATYPLDL 145
             R  P S   F      K+   ++ G     Q T +Q   S ++ G CS ++ + PLD+
Sbjct: 178 AARNAPGSFALFGGNAFAKE---YILGLKDYSQATWSQNFIS-SIVGACSSLIVSAPLDV 233

Query: 146 IKTRLSIQTANLSS 159
           IKTR  IQ  N  +
Sbjct: 234 IKTR--IQNRNFDN 245

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 9/88 (10%)

Query: 226 AQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTI 285
           +Q +W  N     +GA S   +  ++ P D+++ R Q       E G R   V + L   
Sbjct: 206 SQATWSQNFISSIVGACS---SLIVSAPLDVIKTRIQNRNFDNPESGLRI--VKNTL--- 257

Query: 286 GRAEGVSGYYKGLAANLFKVVPSTAVSW 313
            + EGV+ ++KGL   L    P    S+
Sbjct: 258 -KNEGVTAFFKGLTPKLLTTGPKLVFSF 284

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 56/132 (42%), Gaps = 11/132 (8%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNC 87
           AG + G +   V+ P + +KI  Q         RG      ++  +EG   L+RG G   
Sbjct: 125 AGSLIG-IGEIVLLPLDVLKIKRQTNPEAFK-GRGFL----KILKDEGIFNLYRGWGWTA 178

Query: 88  IRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIK 147
            R  P S   F      K+   ++ G     Q T +Q   S  +    S++ + PLD+IK
Sbjct: 179 ARNAPGSFALFGGNAFAKE---YILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIK 235

Query: 148 TRLSIQTANLSS 159
           TR  IQ  N  +
Sbjct: 236 TR--IQNRNFDN 245

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 61/133 (45%), Gaps = 14/133 (10%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN-RGIFSSIRQVYHEEGTKGLFRGNGLN 86
           AG + G +   V+ P + +KI  + Q++  S+  RG    +R    +EG  GL+RG G  
Sbjct: 124 AGSLIG-IGEIVLLPLDVLKI--KRQTNPESFRGRGFLRILR----DEGM-GLYRGWGWT 175

Query: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLI 146
             R  P S   F      K+   ++ G     Q T  Q   S       S++ + PLD+I
Sbjct: 176 AARNAPGSFALFGGNAFAKE---YILGLKDYSQATWGQNFVSSIFGASASLIVSAPLDVI 232

Query: 147 KTRLSIQTANLSS 159
           KTR  IQ+ N  S
Sbjct: 233 KTR--IQSRNFES 243

 Score = 31.6 bits (70), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 40/95 (42%), Gaps = 9/95 (9%)

Query: 226 AQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTI 285
           +Q +W  N      GA     +  ++ P D+++ R Q       E GF  T V + L   
Sbjct: 204 SQATWGQNFVSSIFGA---SASLIVSAPLDVIKTRIQSRNFESAESGF--TIVKNTL--- 255

Query: 286 GRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVC 320
            + EG + ++KGL   L    P    S+ + + + 
Sbjct: 256 -KNEGATAFFKGLTPKLLTTGPKLVFSFAIAQTLI 289

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 35.8 bits (81), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 8/89 (8%)

Query: 63  IFSSIRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTN 122
           IF+++R++    G    F+G+     R    SAV+F  Y   K+ +          +  +
Sbjct: 193 IFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQMI-------SPNKPLS 245

Query: 123 TQRLFSGALCGGCSVVA-TYPLDLIKTRL 150
               F   +   C+VVA T P+D++KTR+
Sbjct: 246 EYYAFGIGVFSSCAVVALTQPIDVVKTRM 274

 Score = 34.7 bits (78), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 53/126 (42%), Gaps = 16/126 (12%)

Query: 197 PTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDL 256
           PT    V   A+ F  Y  L++     S  +P   S  Y   IG  S      +T P D+
Sbjct: 215 PTIFRQVGNSAVRFTTYTTLKQM---ISPNKPL--SEYYAFGIGVFSSCAVVALTQPIDV 269

Query: 257 LRRRFQ---VLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSW 313
           ++ R Q     ++  N L   Y +  +        EG++  +KG    LFKV  S  VS+
Sbjct: 270 VKTRMQSKYTWSLYRNSLNCVYRTFIE--------EGLTSLWKGWVPRLFKVGLSGGVSF 321

Query: 314 LVYEVV 319
            VY+ V
Sbjct: 322 GVYQYV 327

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 52/125 (41%), Gaps = 12/125 (9%)

Query: 27  LAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLN 86
           LAG  A     T+  PFE +K   Q+  S    N   F+    V      K  F G    
Sbjct: 13  LAGSAAAVFQTTLSHPFEFLKTGQQLHRSLP--NAEAFNMFHHV------KSYFAGCSAL 64

Query: 87  CIRIFPYSAVQFVVYE-ACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDL 145
            I I   +A +F  ++ AC+      +  N +  ++  + + +G++ G    +   P + 
Sbjct: 65  NIGILLKTATRFATFDKACQ---LLKDPENPEAPVSGLRLIAAGSITGFMESMLIIPFEN 121

Query: 146 IKTRL 150
           IKTR+
Sbjct: 122 IKTRM 126

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 35.0 bits (79), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 62/133 (46%), Gaps = 14/133 (10%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN-RGIFSSIRQVYHEEGTKGLFRGNGLN 86
           AG + G +   V+ P + +KI  + Q++  S+  RG    I+    +EG  GL+RG G  
Sbjct: 125 AGSLIG-IGEIVLLPLDVLKI--KRQTNPESFKGRGFLKIIK----DEGF-GLYRGWGWT 176

Query: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLI 146
             R  P S   F      K+   ++ G     Q T +Q   S  +    S++ + PLD+I
Sbjct: 177 AARNAPGSFALFGGNAFAKE---YILGLKDYGQATWSQNFVSSIVGASASLIVSAPLDVI 233

Query: 147 KTRLSIQTANLSS 159
           KTR  IQ  N  +
Sbjct: 234 KTR--IQNRNFDN 244

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 35.0 bits (79), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 57/135 (42%), Gaps = 8/135 (5%)

Query: 24  IAFLAGGVAGAVSRTVVSPFERVKILL---QVQSSTTSYNRGIFSSIRQVYHEEGTKGLF 80
           + F+AG  +G    TV  PF+ VK+ L   QV S      +G    + +    +G +GL+
Sbjct: 11  MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLY 70

Query: 81  RGNGLNCIRIFPYSAVQFVVYEACK--KKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVV 138
            G       +F +  +   +  +    + L H       ++L  +  + SG + G     
Sbjct: 71  LG---FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSF 127

Query: 139 ATYPLDLIKTRLSIQ 153
              P++L K +L +Q
Sbjct: 128 IAAPVELAKAKLQVQ 142

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 31/72 (43%), Gaps = 1/72 (1%)

Query: 232 SNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGV 291
           S +     G  SG    T+ +PFD ++ R Q   +G    G ++    D +    + +G+
Sbjct: 8   SRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGA-GIQFKGPLDCVYKTLKNQGI 66

Query: 292 SGYYKGLAANLF 303
            G Y G    LF
Sbjct: 67  RGLYLGFTPPLF 78

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 34.3 bits (77), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 57/132 (43%), Gaps = 12/132 (9%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNC 87
           AG + G +   V+ P + +KI  Q         RG      ++  +EG  GL+RG G   
Sbjct: 124 AGSMIG-IGEIVLLPLDVLKIKRQTNPEAFK-GRGFV----KILKDEGL-GLYRGWGWTA 176

Query: 88  IRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIK 147
            R  P S   F      K+   ++ G     Q T +Q   S  +    S++ + PLD+IK
Sbjct: 177 ARNAPGSFALFGGNAFAKE---YILGLKDYSQATWSQNFVSSIVGASASLIISAPLDVIK 233

Query: 148 TRLSIQTANLSS 159
           TR  IQ  N  +
Sbjct: 234 TR--IQNKNFEN 243

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 68/150 (45%), Gaps = 10/150 (6%)

Query: 27  LAGGVAGAVSRTVVSP-----FERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFR 81
           + GGV G V++  ++       + V+I     +S     +  +S  + +Y +EG +G+ +
Sbjct: 114 ILGGVTGGVTQAYLTMGFCTCMKTVEITRHKSASAGGVPQSSWSVFKNIYKKEGIRGINK 173

Query: 82  GNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGN-NGQEQLTNTQRLFSGALCGGCSVVAT 140
           G     IR       +F +    +  +  + G  N  ++L   +++ + AL GG S    
Sbjct: 174 GVNAVAIRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKLNPFEKIGASALGGGLS-AWN 232

Query: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSISK 170
            P+++I  R+ +Q+      NR K  ++ K
Sbjct: 233 QPIEVI--RVEMQSKK-EDPNRPKNLTVGK 259

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 29/149 (19%), Positives = 70/149 (46%), Gaps = 10/149 (6%)

Query: 27  LAGGVAGAVSRTVVSP-----FERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFR 81
           + GGV G V++  ++       + V+I  +  +   +  +  + + +++Y ++G KG+ +
Sbjct: 112 IMGGVTGGVAQAYLTMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINK 171

Query: 82  GNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGN-NGQEQLTNTQRLFSGALCGGCSVVAT 140
           G     IR       +F      ++ + +  G  N  ++LT  +++ + A+ GG S    
Sbjct: 172 GVNAVAIRQMTNWGSRFGFSRLVEEGIRNATGKTNPDDKLTALEKIAASAIGGGLSAW-N 230

Query: 141 YPLDLIKTRLSIQTANLSSLNRSKAKSIS 169
            P+++I+  +  +  +    NR K  ++S
Sbjct: 231 QPIEVIRVEMQSKKED---PNRPKNLTVS 256

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 42/111 (37%), Gaps = 11/111 (9%)

Query: 207 ALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAM 266
           A+  AVY   +E     S   P   + LY L   A+S         PFD+   R      
Sbjct: 192 AVQLAVYSHAKE---ALSRHVPDGMA-LYTLA-SALSSVAVCIAMNPFDVAMTRMY---- 242

Query: 267 GGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317
             +  G  Y    D L    R EG S  YKG  A L ++ P T +   + E
Sbjct: 243 --HHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLME 291

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

Query: 70  VYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKL-FHVNGNNGQEQLTNTQRLFS 128
           ++ + G +GL++G     +R    SAVQ  VY   K+ L  HV   +G    T    L S
Sbjct: 167 LFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHV--PDGMALYTLASALSS 224

Query: 129 GALCGGCSVVATYPLDLIKTRL 150
            A+C     +A  P D+  TR+
Sbjct: 225 VAVC-----IAMNPFDVAMTRM 241

>Sklu_2436.18 YDR470C, Contig c2436 37947-39431 reverse complement
          Length = 494

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 39/89 (43%), Gaps = 4/89 (4%)

Query: 67  IRQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRL 126
           +  V  EEGT+GL+R N    I  F  SA     +         +      + + +    
Sbjct: 237 MNSVMDEEGTRGLWRANNTTFIYNF-LSATLDAWFTGMLSPFLQIPDPYFIDIIHSPDPQ 295

Query: 127 FSGALCGGCSV---VATYPLDLIKTRLSI 152
            S AL    SV   +A  PLDLIKTRL+I
Sbjct: 296 KSIALTLAASVFTGIALLPLDLIKTRLTI 324

>Kwal_27.11626
          Length = 299

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 58/124 (46%), Gaps = 12/124 (9%)

Query: 28  AGGVAGAVSRTVVSPFERVKILLQVQSSTTSYN-RGIFSSIRQVYHEEGTKGLFRGNGLN 86
           AG + G +   V+ P + +KI  + Q++  S+  RG      ++  +EG  GL+RG G  
Sbjct: 124 AGSLIG-IGEIVLLPLDVLKI--KRQTNPESFKGRGFI----KILKDEGF-GLYRGWGWT 175

Query: 87  CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLI 146
             R  P S   F      K+   ++ G       T +Q   S  +    S++ + PLD+I
Sbjct: 176 AARNAPGSFALFGGNAFAKE---YILGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVI 232

Query: 147 KTRL 150
           KTR+
Sbjct: 233 KTRI 236

 Score = 32.3 bits (72), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 37/85 (43%), Gaps = 9/85 (10%)

Query: 229 SWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRA 288
           +W  N     +GA     +  ++ P D+++ R Q       E GFR   V + L    + 
Sbjct: 207 TWSQNFVSSIVGA---SASLIVSAPLDVIKTRIQNRHFDNPESGFRI--VQNTL----KN 257

Query: 289 EGVSGYYKGLAANLFKVVPSTAVSW 313
           EG++ ++KGL   L    P    S+
Sbjct: 258 EGITAFFKGLTPKLLTTGPKLVFSF 282

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 51/104 (49%), Gaps = 5/104 (4%)

Query: 68  RQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQ-EQLTNTQRL 126
           + +Y +EG +G+ +G     IR       +F +    +  +  + G  G+ ++LT  +++
Sbjct: 153 KSIYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKI 212

Query: 127 FSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISK 170
            + A+ GG S     P+++I  R+ +Q+      NR K  ++ K
Sbjct: 213 MASAIGGGLS-AWNQPIEVI--RVEMQSKK-EDPNRPKNLTVGK 252

>AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH]
           (873480..875951) [2472 bp, 823 aa]
          Length = 823

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 11/64 (17%)

Query: 200 LGVVPYVAL--------NFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTIT 251
           L +VPYV+L        NF +YE   EF  +    Q  WK+  Y     AISGG      
Sbjct: 438 LDLVPYVSLKPANSIRTNFGLYE---EFLFDIVGYQNHWKAKAYHNIFTAISGGEESDFG 494

Query: 252 YPFD 255
           +  D
Sbjct: 495 FEDD 498

>Scas_433.1
          Length = 1167

 Score = 29.6 bits (65), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 22/97 (22%)

Query: 22   SNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVY---------- 71
             ++A   G VA  +S T  S F++ + L Q  +ST+   R +F++  Q +          
Sbjct: 919  DSMAKFTGSVAKGLSVTQDSDFQKARRLQQRMNSTS---RNVFATSAQSFASTLGSGFSG 975

Query: 72   ---------HEEGTKGLFRGNGLNCIRIFPYSAVQFV 99
                      +EGT G F+G G   I +   +A+ F+
Sbjct: 976  VALDPYKAAQKEGTSGFFKGLGKGLIGLPTKTAIGFL 1012

>Scas_696.9
          Length = 312

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 22/103 (21%), Positives = 40/103 (38%), Gaps = 3/103 (2%)

Query: 68  RQVYHEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLF 127
           R +Y +EG +G+++G     IR       +F      +  +    G    E   N     
Sbjct: 158 RSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSRLVEDWVRKATGKTKPEDRLNAWEKI 217

Query: 128 SGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISK 170
                GG       P+++I  R+ +Q+      NR K  +++K
Sbjct: 218 GATAVGGGLSAWNQPIEVI--RVEMQSKK-EDPNRPKNLTVAK 257

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,243,397
Number of extensions: 344916
Number of successful extensions: 2406
Number of sequences better than 10.0: 213
Number of HSP's gapped: 1471
Number of HSP's successfully gapped: 626
Length of query: 321
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 219
Effective length of database: 13,065,073
Effective search space: 2861250987
Effective search space used: 2861250987
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)