Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPR010C (RPA135)1203118263880.0
Scas_707.471200118259170.0
CAGL0J01848g1202118458490.0
KLLA0B06303g1203118957020.0
Kwal_14.14921197118256470.0
ABR029W1198118353110.0
Scas_70.125923510541e-135
Kwal_26.85531171106410471e-123
Scas_605.141150104910251e-120
YOR207C (RET1)1149104610251e-120
ADL275C1141103310211e-119
KLLA0F01078g1142103810131e-118
CAGL0L02849g1133104010071e-117
Kwal_47.18783122011309621e-110
YOR151C (RPB2)122411519591e-110
CAGL0L04246g122311549481e-108
Scas_714.41122411489461e-108
AFR404C122211329331e-106
KLLA0B05577g12214747479e-82
YGL084C (GUP1)560140741.4
YML007W (YAP1)65037741.6
CAGL0E00847g1825166742.0
CAGL0J07942g1244106722.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR010C
         (1182 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR010C (RPA135) [5446] chr16 complement(577580..581191) RNA pol...  2465   0.0  
Scas_707.47                                                          2283   0.0  
CAGL0J01848g 177319..180927 highly similar to sp|P22138 Saccharo...  2257   0.0  
KLLA0B06303g complement(555780..559391) highly similar to sp|P22...  2201   0.0  
Kwal_14.1492                                                         2179   0.0  
ABR029W [620] [Homologous to ScYPR010C (RPA135) - SH] complement...  2050   0.0  
Scas_70.1                                                             410   e-135
Kwal_26.8553                                                          407   e-123
Scas_605.14                                                           399   e-120
YOR207C (RET1) [5000] chr15 complement(730008..733457) RNA polym...   399   e-120
ADL275C [1466] [Homologous to ScYOR207C (RET1) - SH] (219105..22...   397   e-119
KLLA0F01078g 98331..101759 highly similar to sp|P22276 Saccharom...   394   e-118
CAGL0L02849g 332195..335596 highly similar to sp|P22276 Saccharo...   392   e-117
Kwal_47.18783                                                         375   e-110
YOR151C (RPB2) [4950] chr15 complement(612997..616671) RNA polym...   374   e-110
CAGL0L04246g complement(493026..496697) highly similar to sp|P08...   369   e-108
Scas_714.41                                                           369   e-108
AFR404C [3596] [Homologous to ScYOR151C (RPB2) - SH] (1162949..1...   363   e-106
KLLA0B05577g complement(501690..505355) highly similar to sp|P08...   292   9e-82
YGL084C (GUP1) [1898] chr7 complement(350617..352299) Protein in...    33   1.4  
YML007W (YAP1) [3959] chr13 (253848..255800) Transcriptional act...    33   1.6  
CAGL0E00847g <73766..79244 highly similar to sp|P11075 Saccharom...    33   2.0  
CAGL0J07942g 772758..776492 similar to sp|P38717 Saccharomyces c...    32   2.7  

>YPR010C (RPA135) [5446] chr16 complement(577580..581191) RNA
            polymerase I second largest subunit [3612 bp, 1203 aa]
          Length = 1203

 Score = 2465 bits (6388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1182/1182 (100%), Positives = 1182/1182 (100%)

Query: 1    MSKVIKPPGQARTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTEGPDGGL 60
            MSKVIKPPGQARTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTEGPDGGL
Sbjct: 1    MSKVIKPPGQARTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTEGPDGGL 60

Query: 61   LNLGVKDIGEKVIFDGKPLNSEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVSSAVERK 120
            LNLGVKDIGEKVIFDGKPLNSEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVSSAVERK
Sbjct: 61   LNLGVKDIGEKVIFDGKPLNSEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVSSAVERK 120

Query: 121  VYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGGLPVMLQSNRCHLNKMSPYEL 180
            VYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGGLPVMLQSNRCHLNKMSPYEL
Sbjct: 121  VYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGGLPVMLQSNRCHLNKMSPYEL 180

Query: 181  VQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVR 240
            VQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVR
Sbjct: 181  VQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVR 240

Query: 241  PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDS 300
            PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDS
Sbjct: 241  PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDS 300

Query: 301  FLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLV 360
            FLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLV
Sbjct: 301  FLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLV 360

Query: 361  HLGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEY 420
            HLGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEY
Sbjct: 361  HLGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEY 420

Query: 421  LQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQ 480
            LQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQ
Sbjct: 421  LQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQ 480

Query: 481  VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG 540
            VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG
Sbjct: 481  VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG 540

Query: 541  LLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIGWVSHEQ 600
            LLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIGWVSHEQ
Sbjct: 541  LLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIGWVSHEQ 600

Query: 601  GKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPVRYLPLDK 660
            GKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPVRYLPLDK
Sbjct: 601  GKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPVRYLPLDK 660

Query: 661  EDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ 720
            EDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ
Sbjct: 661  EDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ 720

Query: 721  MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTG 780
            MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTG
Sbjct: 721  MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTG 780

Query: 781  YDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEKL 840
            YDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEKL
Sbjct: 781  YDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEKL 840

Query: 841  DEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQT 900
            DEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQT
Sbjct: 841  DEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQT 900

Query: 901  VSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTI 960
            VSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTI
Sbjct: 901  VSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTI 960

Query: 961  GMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGE 1020
            GMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGE
Sbjct: 961  GMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGE 1020

Query: 1021 ELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI 1080
            ELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI
Sbjct: 1021 ELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI 1080

Query: 1081 GHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRIGSISTVCCRRCSMRFEDAKK 1140
            GHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRIGSISTVCCRRCSMRFEDAKK
Sbjct: 1081 GHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRIGSISTVCCRRCSMRFEDAKK 1140

Query: 1141 LLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVL 1182
            LLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVL
Sbjct: 1141 LLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVL 1182

>Scas_707.47
          Length = 1200

 Score = 2283 bits (5917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1075/1182 (90%), Positives = 1135/1182 (96%), Gaps = 2/1182 (0%)

Query: 1    MSKVIKPPGQARTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTEGPDGGL 60
            MSKVIKPP  ARTA FRTLERESRFINPPKDKSA+PLLQEAV+PH+GSFNALTEGPDGGL
Sbjct: 1    MSKVIKPPSNARTAHFRTLERESRFINPPKDKSAYPLLQEAVEPHVGSFNALTEGPDGGL 60

Query: 61   LNLGVKDIGEKVIFDGKPLNSEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVSSAVERK 120
            LN GVKDIGEKVIFDGK      +     YLGNKLS+SVEQVSIAKP SNDGVSSAVERK
Sbjct: 61   LNQGVKDIGEKVIFDGK--TGAVQTGKDSYLGNKLSISVEQVSIAKPTSNDGVSSAVERK 118

Query: 121  VYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGGLPVMLQSNRCHLNKMSPYEL 180
            V+PSESRQRL SY+GKL+LKLKWSVN+GEE   EVRDCGGLPVMLQSNRCHLNK+SPYEL
Sbjct: 119  VFPSESRQRLVSYKGKLMLKLKWSVNDGEETFTEVRDCGGLPVMLQSNRCHLNKLSPYEL 178

Query: 181  VQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVR 240
            VQHKEESDE+GGYFI+NGIEKLIRMLIVQRRNHPMAIIRPSF NRGA+Y+ +GIQ+RSVR
Sbjct: 179  VQHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLRSVR 238

Query: 241  PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDS 300
            PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALC TSDREIFDGIIG+D+ DS
Sbjct: 239  PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIGSDLHDS 298

Query: 301  FLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLV 360
            FLTDRLELLLRGFKKRYP LQNRTQVLQ+LGDKFRVVFQASPD+SD EVGQEVLDRIVLV
Sbjct: 299  FLTDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLDRIVLV 358

Query: 361  HLGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEY 420
            HLGK  ++DKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMI+KEKIDEY
Sbjct: 359  HLGKGNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIKEKIDEY 418

Query: 421  LQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQ 480
            LQNII Q+R D NRG+AINFKD++YMSRVLMRVNENIGSK+QYFLSTGNLVSQSGLDLQQ
Sbjct: 419  LQNIIQQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQ 478

Query: 481  VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG 540
            VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG
Sbjct: 479  VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG 538

Query: 541  LLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIGWVSHEQ 600
            LLNHFAHKC+ISTQQSDVS+IP +LY LGV+PASHT AAGPS CCVQIDGKIIGWVSHEQ
Sbjct: 539  LLNHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIAAGPSQCCVQIDGKIIGWVSHEQ 598

Query: 601  GKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPVRYLPLDK 660
            GKIIADTLR+WKVEGK PGLP+DLEIGYVPPSTRGQYPGLY+FGGHSRM+RPVRYLPLDK
Sbjct: 599  GKIIADTLRFWKVEGKIPGLPLDLEIGYVPPSTRGQYPGLYIFGGHSRMMRPVRYLPLDK 658

Query: 661  EDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ 720
            EDIVGPFEQVYMN+AVTPQEI+NNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ
Sbjct: 659  EDIVGPFEQVYMNVAVTPQEIENNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ 718

Query: 721  MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTG 780
            MGKQTMGTPGVALCHRSDNKLYRLQ+GQTPIVKANLYDDYGMDNFPNG NAVVAVISYTG
Sbjct: 719  MGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTG 778

Query: 781  YDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEKL 840
            YDMDDAMIINKSADERGFGYGTMYK EKVDL+LNR+RGDPITQHFGFGNDEWPKEWL+KL
Sbjct: 779  YDMDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPITQHFGFGNDEWPKEWLDKL 838

Query: 841  DEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQT 900
            D+DGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQT
Sbjct: 839  DDDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQT 898

Query: 901  VSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTI 960
            VSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPT+DMPFSETGIQPD+IINPHAFPSRMTI
Sbjct: 899  VSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTI 958

Query: 961  GMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGE 1020
            GMFVESLAGK+GALHG+AQD+TPWIFNEDDTPADYFG+QL KAGYNYHGNEPMYSGATGE
Sbjct: 959  GMFVESLAGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMYSGATGE 1018

Query: 1021 ELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI 1080
            ELRADIY+GVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI
Sbjct: 1019 ELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI 1078

Query: 1081 GHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRIGSISTVCCRRCSMRFEDAKK 1140
            GHGTSFLLQDRLLN SDYTQ SVCRECGSILTTQQSVPRIGS+STVCCRRC++RF++AK 
Sbjct: 1079 GHGTSFLLQDRLLNCSDYTQTSVCRECGSILTTQQSVPRIGSLSTVCCRRCAVRFDEAKS 1138

Query: 1141 LLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVL 1182
            +L K E+   +FIDDS+IWEDGQGNKFVGGN+TTTVAIPFVL
Sbjct: 1139 MLAKDEETSNVFIDDSEIWEDGQGNKFVGGNDTTTVAIPFVL 1180

>CAGL0J01848g 177319..180927 highly similar to sp|P22138 Saccharomyces
            cerevisiae YPR010c RPA135, start by similarity
          Length = 1202

 Score = 2257 bits (5849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1065/1184 (89%), Positives = 1130/1184 (95%), Gaps = 5/1184 (0%)

Query: 1    MSKVIKPPGQARTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTEGPDGGL 60
            MSKVIKPP  ARTA FRTLERE+RF NPPKDKSA+PLLQEAVQPH+GSFNALTEGPDGGL
Sbjct: 1    MSKVIKPPSNARTAHFRTLERENRFKNPPKDKSAYPLLQEAVQPHVGSFNALTEGPDGGL 60

Query: 61   LNLGVKDIGEKVIFDGKPLNSEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVSSAVERK 120
            L   V+DIGEKVIFDGK  +  DEIS+  YLGNKLS+SVEQVSIAKP +NDGV  A ER 
Sbjct: 61   LQRAVEDIGEKVIFDGKS-DGSDEISD--YLGNKLSISVEQVSIAKPTANDGVMGAAERP 117

Query: 121  VYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGGLPVMLQSNRCHLNKMSPYEL 180
            VYPSE+RQRLTSYRGK+LLKLKWSVN+GE    EVRDCGGLP+MLQSNRCHLNKMSP+EL
Sbjct: 118  VYPSEARQRLTSYRGKILLKLKWSVNDGENVFSEVRDCGGLPIMLQSNRCHLNKMSPHEL 177

Query: 181  VQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVR 240
            VQHKEESDE+GGYFI+NGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYS YGIQIRSVR
Sbjct: 178  VQHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVR 237

Query: 241  PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDS 300
            PDQTSQTNVLHYLNDGQVTFRFSWRKNEYL+PVVMI+KAL  TSDREIFDGIIG++  +S
Sbjct: 238  PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNS 297

Query: 301  FLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLV 360
            FLTDRLELLLRGFKKRYP L+NRTQVLQYLGDKFR+VFQASPD+SD EVGQEVL+RIVLV
Sbjct: 298  FLTDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLV 357

Query: 361  HLGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEY 420
            HLG +G+ DKFRMLLFM+RKLYSLVAGEC PDNPDATQHQEVLLGGFLYGMILKEKIDEY
Sbjct: 358  HLGSNGNMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKEKIDEY 417

Query: 421  LQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQ 480
            LQ I+AQVR DINRG+AINF +K+YMSRVLMRVN+NIGSKMQYFLSTGNLVSQSGLDLQQ
Sbjct: 418  LQGIVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLVSQSGLDLQQ 477

Query: 481  VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG 540
            VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG
Sbjct: 478  VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG 537

Query: 541  LLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIGWVSHEQ 600
            LLNHFAHKCRIST QSDVS++P +LYSLGV PASHTFAAGPSLCCVQ+DGKIIGW SHEQ
Sbjct: 538  LLNHFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFAAGPSLCCVQLDGKIIGWTSHEQ 597

Query: 601  GKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPVRYLPLDK 660
            G++IADTLR+WKVEG+TPGLP DLEIGYVPPS++GQYPGLY+FGGHSRM+RPVRYLPLDK
Sbjct: 598  GRVIADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMMRPVRYLPLDK 657

Query: 661  EDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ 720
            EDIVGPFEQVYMNIAVTPQEIQNN+HTHVEF+PTNILSILANLTPFSDFNQSPRNMYQCQ
Sbjct: 658  EDIVGPFEQVYMNIAVTPQEIQNNIHTHVEFSPTNILSILANLTPFSDFNQSPRNMYQCQ 717

Query: 721  MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTG 780
            MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNG NAVVAVISYTG
Sbjct: 718  MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTG 777

Query: 781  YDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEKL 840
            YDMDDAMIINKSADERGFGYGTMYK EKVDL+LNR+RGDP+TQHFGFG DEWPKEWL+KL
Sbjct: 778  YDMDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPVTQHFGFGTDEWPKEWLDKL 837

Query: 841  DEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQT 900
            DEDGLPYIGTYVEEGDPICAYFDDT+ KTKIKTYHSSEPAYIEEVNLIGDESNKFQELQT
Sbjct: 838  DEDGLPYIGTYVEEGDPICAYFDDTIGKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQT 897

Query: 901  VSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTI 960
            VSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPD+IINPHAFPSRMTI
Sbjct: 898  VSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTI 957

Query: 961  GMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGE 1020
            GMFVESLAGKAGALHGIAQDSTPWIFNE DTPADYFGEQL KAGYNYHGNEPMYSGATGE
Sbjct: 958  GMFVESLAGKAGALHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGE 1017

Query: 1021 ELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI 1080
            ELR DIY+GVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI
Sbjct: 1018 ELRCDIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI 1077

Query: 1081 GHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRIGSISTVCCRRCSMRFEDAKK 1140
            GHGTSFLLQDRLLNSSDYTQA++CRECGSILTTQQ+VPRIG++S+VCCRRC+++FEDAKK
Sbjct: 1078 GHGTSFLLQDRLLNSSDYTQAAICRECGSILTTQQTVPRIGAVSSVCCRRCAVKFEDAKK 1137

Query: 1141 LLTKSEDG--EKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVL 1182
             L + E+   EKIFIDDSQIWEDGQG KFVGGN+TTTVAIPFVL
Sbjct: 1138 TLFEHEEKTEEKIFIDDSQIWEDGQGQKFVGGNDTTTVAIPFVL 1181

>KLLA0B06303g complement(555780..559391) highly similar to sp|P22138
            Saccharomyces cerevisiae YPR010c RPA135 DNA-directed RNA
            polymerase I, 135 KD subunit, start by similarity
          Length = 1203

 Score = 2201 bits (5702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1037/1189 (87%), Positives = 1118/1189 (94%), Gaps = 14/1189 (1%)

Query: 1    MSKVIKPPGQA------RTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTE 54
            MS VI PP QA      RTA FRTLERESRFINPPKDKSA+P L +AVQPHIGSFNALTE
Sbjct: 1    MSSVILPP-QAPVERLNRTASFRTLERESRFINPPKDKSAYPFLADAVQPHIGSFNALTE 59

Query: 55   GPDGGLLNLGVKDIGEKVIFDGKPLNSEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVS 114
            GPDGGLLNLG KDIG KVIFDGK  ++     N  YLGNKLS+S+EQVSI+KP SNDGVS
Sbjct: 60   GPDGGLLNLGAKDIGSKVIFDGKGSDT-----NPNYLGNKLSLSIEQVSISKPTSNDGVS 114

Query: 115  SAVERKVYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGGLPVMLQSNRCHLNK 174
            SAVERKV+PSESRQRLTSYRGK+LLKLKWSVN+GEE   EVRDCGGLP+MLQSNRCHLNK
Sbjct: 115  SAVERKVFPSESRQRLTSYRGKILLKLKWSVNDGEETFTEVRDCGGLPIMLQSNRCHLNK 174

Query: 175  MSPYELVQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGI 234
            MSPYELV+H+EESDE GGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYS YGI
Sbjct: 175  MSPYELVEHREESDEFGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGI 234

Query: 235  QIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIG 294
            QIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYL+PVVMIL+ALC T+DREIFD ++G
Sbjct: 235  QIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVG 294

Query: 295  NDVKDSFLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVL 354
             D  +SFLTDRLELLLRGFKKRYP LQNR Q LQYLGDKFRVVFQASPD +DL+VGQE+L
Sbjct: 295  GDTSNSFLTDRLELLLRGFKKRYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELL 354

Query: 355  DRIVLVHLGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILK 414
            +RIVLVHLG++ ++DKF MLLFMIRKLYSLVAGECSPDNPDA QHQE+LLGGFLYGMI+K
Sbjct: 355  NRIVLVHLGEN-NKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIVK 413

Query: 415  EKIDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQS 474
            EKI+EYLQNI  Q++ DINRG+AINFKD++YM++VLMRVNENIGSK+QYFLSTGNLVSQS
Sbjct: 414  EKIEEYLQNIRLQIQTDINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLVSQS 473

Query: 475  GLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTP 534
            GLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGF CPVHTP
Sbjct: 474  GLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFFCPVHTP 533

Query: 535  DGSPCGLLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIG 594
            DGSPCGLLNH +HKC+IST+QSDVS+IPSILYSLGV PA+H  AAGPS+CCVQ+DGKIIG
Sbjct: 534  DGSPCGLLNHLSHKCKISTEQSDVSKIPSILYSLGVTPAAHVIAAGPSMCCVQLDGKIIG 593

Query: 595  WVSHEQGKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPVR 654
            W SHEQGK++ADTLR+WKVEGKTPGLP+DLE+GYVPP+T GQYPGL+LFGGHSRM+RPVR
Sbjct: 594  WCSHEQGKVVADTLRFWKVEGKTPGLPVDLEVGYVPPTTSGQYPGLFLFGGHSRMMRPVR 653

Query: 655  YLPLDKEDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPR 714
            YLPLDKEDIVGPFEQVYMNIAVTP+EI+NNVH+HVEF+PTNILSILANLTPFSDFNQSPR
Sbjct: 654  YLPLDKEDIVGPFEQVYMNIAVTPEEIENNVHSHVEFSPTNILSILANLTPFSDFNQSPR 713

Query: 715  NMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVA 774
            NMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNG NAVVA
Sbjct: 714  NMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVA 773

Query: 775  VISYTGYDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPK 834
            VISYTGYDMDDAMIINKSADERGFGYGTMYK EKV+L++NR+RGDPITQHFGFG DEWPK
Sbjct: 774  VISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVNLSMNRSRGDPITQHFGFGTDEWPK 833

Query: 835  EWLEKLDEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNK 894
            EWLEKLD+DGLP IGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEV LIGDES+K
Sbjct: 834  EWLEKLDDDGLPLIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVKLIGDESSK 893

Query: 895  FQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAF 954
            FQELQ ++IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPD+IINPHAF
Sbjct: 894  FQELQAITIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAF 953

Query: 955  PSRMTIGMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMY 1014
            PSRMTIGMFVESLAGKAGALHGIAQDSTPW FNE DTPADYFG+QLAKAGYNYHGNEPMY
Sbjct: 954  PSRMTIGMFVESLAGKAGALHGIAQDSTPWTFNESDTPADYFGDQLAKAGYNYHGNEPMY 1013

Query: 1015 SGATGEELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEM 1074
            SGATGEELRADIY+GVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEM
Sbjct: 1014 SGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEM 1073

Query: 1075 ERDALIGHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRIGSISTVCCRRCSMR 1134
            ERDALIGHGTSFLLQDRLLN SDYTQ +VCR+CG+ILTTQ SVP+IGSISTV CRRC+++
Sbjct: 1074 ERDALIGHGTSFLLQDRLLNCSDYTQTAVCRDCGAILTTQSSVPKIGSISTVRCRRCALK 1133

Query: 1135 FEDAKKLLTKSEDG-EKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVL 1182
            F++AK+L+TK E G E + I DS+IWEDGQGNKFVGG  TTTVAIPFVL
Sbjct: 1134 FDEAKRLITKYESGSEPVHIADSEIWEDGQGNKFVGGGNTTTVAIPFVL 1182

>Kwal_14.1492
          Length = 1197

 Score = 2179 bits (5647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1017/1182 (86%), Positives = 1121/1182 (94%), Gaps = 6/1182 (0%)

Query: 1    MSKVIKPPGQARTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTEGPDGGL 60
            MSKV+K P  ARTA FRT+ERE+RF+NPPKDKSAFPLL+EAV+PHIGSFNALTEGP+GGL
Sbjct: 1    MSKVVKLPANARTAHFRTVERENRFVNPPKDKSAFPLLREAVEPHIGSFNALTEGPEGGL 60

Query: 61   LNLGVKDIGEKVIFDGKPLNSEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVSSAVERK 120
            LN  VKDIG K++FDG+  +SE+   NS YLGNKL++SVEQVSI+KP+SNDGV+SAVERK
Sbjct: 61   LNQAVKDIGGKIVFDGR--SSEE---NSNYLGNKLTLSVEQVSISKPVSNDGVTSAVERK 115

Query: 121  VYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGGLPVMLQSNRCHLNKMSPYEL 180
            +YP+ESRQRL+SYRGKLLLKLKWSVN+GEE+  E++DCGGLPVMLQSNRCHLN +SP EL
Sbjct: 116  IYPAESRQRLSSYRGKLLLKLKWSVNDGEESFTEIKDCGGLPVMLQSNRCHLNNLSPNEL 175

Query: 181  VQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVR 240
            V++KEESDE+GGYFI+NGIEKLIRMLIVQRRNHPMAIIRPSF+NRGASYS YGIQIRSVR
Sbjct: 176  VKNKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFSNRGASYSQYGIQIRSVR 235

Query: 241  PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDS 300
            PDQTSQTNVLHYLNDG+VTFRFSWRKNEYL+PVVMILKALC  +DREIFDGI+G+D  +S
Sbjct: 236  PDQTSQTNVLHYLNDGEVTFRFSWRKNEYLIPVVMILKALCELNDREIFDGIVGSDTSNS 295

Query: 301  FLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLV 360
            FLTDRLELLLRG KK+Y  LQNR QVLQYLGDKFRVV QASPD +D +VG+E+L RIVLV
Sbjct: 296  FLTDRLELLLRGHKKKYGQLQNRRQVLQYLGDKFRVVLQASPDATDFQVGEELLSRIVLV 355

Query: 361  HLGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEY 420
            HLG + ++DK RMLLFMIRKLYSLVAGEC+PDNPDATQHQEVLLGGFLYGMI+KEKI+EY
Sbjct: 356  HLGGN-NEDKSRMLLFMIRKLYSLVAGECAPDNPDATQHQEVLLGGFLYGMIIKEKIEEY 414

Query: 421  LQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQ 480
            LQNI  Q++ D+NRG+A+NFK+++YM+RVLMRVNENIGSK+QYFLSTGNLVSQSGLDLQQ
Sbjct: 415  LQNIRLQIQSDVNRGLAVNFKERKYMNRVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQ 474

Query: 481  VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG 540
            VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG
Sbjct: 475  VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG 534

Query: 541  LLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIGWVSHEQ 600
            LLNHFAHKC+IST QSDVSRIP++LYSLGVAPASHT AAGP+ CCVQ+DGKI+GW SHEQ
Sbjct: 535  LLNHFAHKCKISTTQSDVSRIPALLYSLGVAPASHTVAAGPTACCVQLDGKIVGWCSHEQ 594

Query: 601  GKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPVRYLPLDK 660
            GKIIADTLR+WKVEG+T GLP+DLEIGYVPPS+RGQYPGLYLFGGHSRM+RPV+YLPL K
Sbjct: 595  GKIIADTLRFWKVEGETAGLPLDLEIGYVPPSSRGQYPGLYLFGGHSRMMRPVKYLPLGK 654

Query: 661  EDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ 720
            EDIVGPFEQVYMNIAVTPQEIQNN+HTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ
Sbjct: 655  EDIVGPFEQVYMNIAVTPQEIQNNIHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ 714

Query: 721  MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTG 780
            MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNG NAVVAVISYTG
Sbjct: 715  MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGMNAVVAVISYTG 774

Query: 781  YDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEKL 840
            YDMDDAMIINKSADERGFGYGTMYK EK+DL++NR+RGDPITQHFGFG+DEWPK WLEKL
Sbjct: 775  YDMDDAMIINKSADERGFGYGTMYKVEKIDLSMNRSRGDPITQHFGFGDDEWPKGWLEKL 834

Query: 841  DEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQT 900
            D+DGLP IGTYVEEGDPICA+FDDTLNKTKIKTYHSSEPAYIEEVNLIGDES+KFQELQT
Sbjct: 835  DDDGLPIIGTYVEEGDPICAFFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESSKFQELQT 894

Query: 901  VSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTI 960
            +SIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPT+DMPFSE+G+QPDIIINPHAFPSRMTI
Sbjct: 895  ISIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSESGMQPDIIINPHAFPSRMTI 954

Query: 961  GMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGE 1020
            GMFVESLAGKAGALHG+A D+TPW F+E DTPA+YFG+QL  AGYNYHGNEPMYSGATGE
Sbjct: 955  GMFVESLAGKAGALHGMAHDATPWTFSEKDTPANYFGDQLLSAGYNYHGNEPMYSGATGE 1014

Query: 1021 ELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI 1080
            ELRADIY+GVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI
Sbjct: 1015 ELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI 1074

Query: 1081 GHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRIGSISTVCCRRCSMRFEDAKK 1140
            GHGTSFLLQDRLLN SDYTQ++VCRECGS+LTT  SVPRIGS++TV CRRC+++F++AKK
Sbjct: 1075 GHGTSFLLQDRLLNCSDYTQSAVCRECGSLLTTHYSVPRIGSLATVRCRRCAVKFDEAKK 1134

Query: 1141 LLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVL 1182
            ++ K +  ++IFIDDS IWEDGQGNKFVGG +TTTVAIPFVL
Sbjct: 1135 IVAKYQGEDQIFIDDSHIWEDGQGNKFVGGGQTTTVAIPFVL 1176

>ABR029W [620] [Homologous to ScYPR010C (RPA135) - SH]
            complement(450645..454241) [3597 bp, 1198 aa]
          Length = 1198

 Score = 2050 bits (5311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 983/1183 (83%), Positives = 1076/1183 (90%), Gaps = 12/1183 (1%)

Query: 4    VIKPPGQARTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTEGPDGGLLNL 63
            V++P    RTA FRTLERE+RF++PPKDKSA+PLL EAV+PH+GSFNALTEGP GGLLNL
Sbjct: 3    VMEPLSANRTAQFRTLEREARFVSPPKDKSAYPLLYEAVEPHVGSFNALTEGPGGGLLNL 62

Query: 64   GVKDIGEKVIFDGKPLNSEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVSSAVERKVYP 123
            G +DIG KV+FDGK   + DE  N  YLGNKL++SV QVS+ KPMSNDGV++A ER V+P
Sbjct: 63   GARDIGAKVVFDGK---ASDE--NPNYLGNKLALSVTQVSLTKPMSNDGVTAAAERNVFP 117

Query: 124  SESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGGLPVMLQSNRCHLNKMSPYELVQH 183
            +E+R+RLT+YRGKLLLKL WSVN+GEE   EVRDCG LPVMLQSNRCHL+KMSP ELV+H
Sbjct: 118  AEARKRLTTYRGKLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQELVEH 177

Query: 184  KEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVRPDQ 243
            KEESDE+GGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRG SYSHYG+QIR VRPDQ
Sbjct: 178  KEESDELGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVRPDQ 237

Query: 244  TSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDSFLT 303
            TSQTNVLHYLNDGQVTFRFSWRKNEYLVPVV+ILKAL   SDREIFDGI+G D  +SFLT
Sbjct: 238  TSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSNSFLT 297

Query: 304  DRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLVHLG 363
            DRLELLLRGFKKR+P L NR QVLQYLGDKFRVV QASPD SD  VGQE+L RIVLVHLG
Sbjct: 298  DRLELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVHLG 357

Query: 364  KDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEYLQN 423
             D + DK  ML+FMIRKLYSLVAGEC PDNPDATQHQEVLLGGFLYGMI+KEKI+EYLQN
Sbjct: 358  -DENTDKSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEEYLQN 416

Query: 424  IIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQVSG 483
            I  Q++ D+NRGM ++FKD++YM+RVL R+NENIGSK+QYFLSTGNLVSQSGLDLQQVSG
Sbjct: 417  IKLQIQADVNRGMPVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGLDLQQVSG 476

Query: 484  YTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLN 543
            YTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLN
Sbjct: 477  YTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLN 536

Query: 544  HFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIGWVSHEQGKI 603
            HFAHKC+IST QSDVS+IP++LYSLGV+PA+H  AAGPSLCCVQ+DGKI+GW SHEQG+I
Sbjct: 537  HFAHKCKISTTQSDVSKIPTLLYSLGVSPAAHVTAAGPSLCCVQLDGKIVGWCSHEQGRI 596

Query: 604  IADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPVRYLPLDKEDI 663
            +ADTLRYWKVEGKT GLP+DLEIGYVP S RGQYPGLYLFGGHSRM+RPVRYLPLDK+DI
Sbjct: 597  VADTLRYWKVEGKTDGLPLDLEIGYVPASKRGQYPGLYLFGGHSRMMRPVRYLPLDKQDI 656

Query: 664  VGPFEQVYMNIAVTPQEIQNNVHTHV---EFTPTNILSILANLTPFS-DFNQSPRNMYQC 719
            VGPFEQVYM+IAVTP+E  N + T +    F    ILSILANLTPF       P+     
Sbjct: 657  VGPFEQVYMDIAVTPEE--NPLITSILMLNFHQQIILSILANLTPFLLTLTNLPKICTNY 714

Query: 720  QMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYT 779
            QMGKQTMGTPGVALCHRSDNKLYRLQ+GQTPIVKANLYDDYGMDNFPNG NAVVAVISYT
Sbjct: 715  QMGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYT 774

Query: 780  GYDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEK 839
            GYDMDDAMIINKSADERGF YGT+YKTEK+DL+L+R RGDP+TQHFGFG DEWPKEWLEK
Sbjct: 775  GYDMDDAMIINKSADERGFSYGTVYKTEKIDLSLSRGRGDPVTQHFGFGTDEWPKEWLEK 834

Query: 840  LDEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQ 899
            LDEDGLP IG+YVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEV LIGDESNKFQELQ
Sbjct: 835  LDEDGLPIIGSYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVTLIGDESNKFQELQ 894

Query: 900  TVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMT 959
             ++IKYRIRR PQIGDKFSSRHGQKGVCSRKWPT+DMPFSETGIQPD+IINPHAFPSRMT
Sbjct: 895  YITIKYRIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMT 954

Query: 960  IGMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATG 1019
            IGMFVESLAGKAGALHGIAQD+TPW F+E+DTPADYFG+QL KAGYNYHGNEPMYSGATG
Sbjct: 955  IGMFVESLAGKAGALHGIAQDATPWTFSEEDTPADYFGDQLLKAGYNYHGNEPMYSGATG 1014

Query: 1020 EELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDAL 1079
            EELRADIY+GVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDAL
Sbjct: 1015 EELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDAL 1074

Query: 1080 IGHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRIGSISTVCCRRCSMRFEDAK 1139
            IGHGTSFLLQDRLLNSSDYTQ++VCRECGSILTTQ SVP+IGS+ T+ CRRC++ F++AK
Sbjct: 1075 IGHGTSFLLQDRLLNSSDYTQSAVCRECGSILTTQSSVPKIGSMVTIRCRRCAISFDEAK 1134

Query: 1140 KLLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVL 1182
            K++T+ +  + IFIDDS IWEDGQGNKFVGG  TTTVAIPFVL
Sbjct: 1135 KIITQQDSEDSIFIDDSHIWEDGQGNKFVGGGNTTTVAIPFVL 1177

>Scas_70.1
          Length = 259

 Score =  410 bits (1054), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 200/235 (85%), Positives = 218/235 (92%), Gaps = 1/235 (0%)

Query: 296 DVKDSFLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLD 355
           D  +SFLTDRLELLLRGFKK+YP LQNR QVLQYLGDKFRVVFQASPD +D +VG+EVL 
Sbjct: 12  DTSNSFLTDRLELLLRGFKKKYPQLQNRRQVLQYLGDKFRVVFQASPDMTDYQVGEEVLR 71

Query: 356 RIVLVHLGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKE 415
           RIVLVHLG+DG +DKF MLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMI+KE
Sbjct: 72  RIVLVHLGEDG-KDKFHMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIVKE 130

Query: 416 KIDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSG 475
           KI+EYLQNI  Q++ D+NRG+A+NFKD++YM+RVLMRVNENIGSK+QYFLSTGNLVSQSG
Sbjct: 131 KIEEYLQNIRLQIQADVNRGLAVNFKDRKYMTRVLMRVNENIGSKLQYFLSTGNLVSQSG 190

Query: 476 LDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCP 530
           LDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPE  G   P
Sbjct: 191 LDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPEILGVPMP 245

>Kwal_26.8553
          Length = 1171

 Score =  407 bits (1047), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 327/1064 (30%), Positives = 507/1064 (47%), Gaps = 142/1064 (13%)

Query: 114  SSAVERKVYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDC--GGLPVMLQSNRCH 171
            SS+ +  V P E R R  +Y   + + ++++      N+   RD   G +P+ML+SN+C 
Sbjct: 131  SSSKDYIVPPHECRLRDMTYSAPIYVDIEYTRG---RNIIMHRDVEIGRMPIMLRSNKCI 187

Query: 172  LNKMSPYELVQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSH 231
            LN  S  ++ +  E   + GGYFIVNG EK+I   +VQ +     II  +   +    + 
Sbjct: 188  LNGASEKDMARINECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKAIVQA- 243

Query: 232  YGIQIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDG 291
                + S   ++ S+T V+    +G++  + +    E  VP+V++LKA    SD EI   
Sbjct: 244  ---SVTSSTHERKSKTYVI--TKNGKIYLKHNSIAEE--VPIVLVLKASGIVSDLEIMQL 296

Query: 292  IIGNDVKDSFLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQ 351
            + GND   S   D   +      K   + Q   Q L+Y+G K + V +     + L+ G 
Sbjct: 297  VCGND---SSYQDIFAVNFEEVAKMKIYTQQ--QALEYIGSKVKTVRRQK--LTTLQEGI 349

Query: 352  EVLDRIVLVHLGKDGS--QDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLY 409
            E +   V+ HL  +    ++K   +  M R++   +      D+ D   ++ + L G L 
Sbjct: 350  EAIATTVIAHLTVEALDFREKALYIAVMTRRVVMAIHNPKMVDDRDYVGNKRLELAGQLM 409

Query: 410  GMILKE---KIDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVN---ENIGSKMQY 463
             ++ ++   K +   +  I +V    NR M  +          L+ +N    NI S +  
Sbjct: 410  SLLFEDLFKKFNNDFKANIDKVLKKPNRAMEYD---------ALLSINVHSNNITSGLNR 460

Query: 464  FLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLL 521
             +STGN  S     +++ +G T V  ++++   IS   M+ R S  F    K +  R L 
Sbjct: 461  AISTGNW-SLKRFKMER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQ 515

Query: 522  PESWGFLCPVHTPDGSPCGLLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGP 581
            P  +G LC   TP+G  CGL+ + A    I+T   +   I  + Y LGV     T     
Sbjct: 516  PSQFGMLCTSDTPEGEACGLVKNLALMTHITTDDEE-EPIKKLCYLLGVEDI--TVVDSD 572

Query: 582  SL---CCVQIDGKIIGWVSHEQGKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYP 638
            SL    CV ++G I+G V            R  +  GK           ++   T     
Sbjct: 573  SLHFNYCVYLNGTIVGVVRFPTK--FVSQFRNLRRSGKVSE--------FISIYTNSHQK 622

Query: 639  GLYLFGGHSRMLRPVRY--------------------LPLDKEDIVGPFEQVYMN----- 673
             +++     R+ RP+                      L  D    +G  E + +N     
Sbjct: 623  AVHIATDGGRICRPLIIVTDGKSLVTAQHLRQLLDGQLQFDDFLKLGLVEYLDVNEENDS 682

Query: 674  -IAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVA 732
             IA+  ++++ ++ TH+E  P  +L  +A L P+   NQSPRN YQC MGKQ +G     
Sbjct: 683  FIALYERDLEPSI-THMEIEPFTVLGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYN 741

Query: 733  LCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTGYDMDDAMIINKS 792
               R D  LY +   Q P+VK    +    D  P G NA VAV+SY+GYD++DA+++NK+
Sbjct: 742  QFKRIDTLLYLMIYPQQPMVKTKTIELIDYDKIPAGQNATVAVMSYSGYDIEDALVLNKA 801

Query: 793  ADERGFGYGTMYKTEKVDLALNR---------------NRGDPITQHFGFGNDEWPKEWL 837
            + +RGFG     +  K+   L R                 G+PI QH   G         
Sbjct: 802  SIDRGFGRCETRR--KLTTVLKRYPNHTQDMVGGMRVDENGEPIWQHKALG--------- 850

Query: 838  EKLDEDGLPYIGTYVEEGD-------PICAYFDDTLNKTKIK------TYHSSEPAYIEE 884
                 DGL  +G  VE G        P  A  D  L +T+ +       Y + EP++I++
Sbjct: 851  ----PDGLGEVGMKVESGQIYVNKSVPTNAS-DSVLTQTQAQYRETPVVYRAPEPSHIDQ 905

Query: 885  VNLIGDESNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQ 944
            V +   E+++      + +  R  R P++GDKFSSRHGQKGVC       D+PF++ G+ 
Sbjct: 906  VMMSVSENDQ----ALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVNQEDLPFNDQGVV 961

Query: 945  PDIIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAG 1004
            PDII+NPH FPSRMT+G  +E ++GKAG L+G  +  T +      +  +   + L   G
Sbjct: 962  PDIIMNPHGFPSRMTVGKMIELISGKAGVLNGTLEYGTCF----GGSKLEDMSQILMNNG 1017

Query: 1005 YNYHGNEPMYSGATGEELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRK 1064
            +NY G + +YSG TGE L+A I+ G +YYQ+L+HMV DK   R+ GP   LT QP +GR 
Sbjct: 1018 FNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRS 1077

Query: 1065 RHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQASVCRECG 1108
            R GG+R+GEMERD +I +G S LL +RL+ SSD  +  VC +CG
Sbjct: 1078 RDGGLRLGEMERDCVIAYGASQLLLERLMISSDAFEVDVCDKCG 1121

>Scas_605.14
          Length = 1150

 Score =  399 bits (1025), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 317/1049 (30%), Positives = 501/1049 (47%), Gaps = 111/1049 (10%)

Query: 114  SSAVERKVYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDC--GGLPVMLQSNRCH 171
            SSA +    P E R R  +Y   + + ++++      N+   +D   G +P+ML+SN+C 
Sbjct: 108  SSAKDYLTPPHECRLRDMTYSAPIYVDIEYTRG---RNIIMHKDVELGRMPIMLRSNKCT 164

Query: 172  LNKMSPYELVQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSH 231
            L  +   E+ +  E   + GGYFIVNG EK+I   +VQ +     II  +   +G   + 
Sbjct: 165  LYGIDEKEMAKLNECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKGIVQA- 220

Query: 232  YGIQIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDG 291
                + S   ++ S+T V+    + ++  + +    E  +P+V++LKA    SD EI   
Sbjct: 221  ---SVTSSTHERRSKTYVI--TKNDKIYLKHNSITEE--IPIVIVLKACGVVSDLEIMQL 273

Query: 292  IIGND--VKDSFLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEV 349
            + GND   +D F  + LE   R       ++  + Q L+++G K + + +     S L+ 
Sbjct: 274  VCGNDSSYQDIFAVN-LEEASR------LNIYTQQQALEFIGTKVKTMRRQK--LSVLQE 324

Query: 350  GQEVLDRIVLVHLGKDGS--QDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGF 407
            G E +   V+ HL  +    ++K   +  M R++   +      D+ D   ++ + L G 
Sbjct: 325  GIEAIATTVVAHLTVEALDFREKALYMAMMTRRVVMAIQNPKMVDDRDYVGNKRLELAGQ 384

Query: 408  LYGMILKE---KIDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVN---ENIGSKM 461
            L  ++ ++   K +   +  I +V    NR M  +          L+ +N    NI S +
Sbjct: 385  LISLLFEDLFKKFNSDFKATIDKVLKKPNRAMEYD---------ALLSINVHSNNITSGL 435

Query: 462  QYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRK 519
               +STGN  S     +++ +G T V  ++++   IS   M+ R S  F    K +  R 
Sbjct: 436  NRAISTGNW-SLKRFKMER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRA 490

Query: 520  LLPESWGFLCPVHTPDGSPCGLLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAA 579
            L P  +G LC   TP+G  CGL+ + A    I+T   +   I  + Y LGV   S   +A
Sbjct: 491  LQPSQFGMLCTADTPEGEACGLVKNLALMTHITTDDEE-EPIKRLCYILGVEDVSLIDSA 549

Query: 580  GPSL-CCVQIDGKIIGWVSHEQGKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYP 638
               L   V ++G +IG              R+ +  GK           ++         
Sbjct: 550  SLHLNFGVYLNGTLIGTTRFPIK--FVSQFRHLRRTGKISE--------FISIYANSHQK 599

Query: 639  GLYLFGGHSRMLRPVRYLPLDKEDI--------------------VGPFEQVYMN----- 673
             +++     R+ RP+  +   K  +                    +G  E + +N     
Sbjct: 600  AVHIATDGGRICRPLIIVTKGKSHVTADHLRRLLNGELVFDDFLKLGLVEYLDVNEENDS 659

Query: 674  -IAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVA 732
             IA+  ++I++   TH+E  P  IL  +A L P+   NQSPRN YQC MGKQ +G     
Sbjct: 660  FIALYEKDIES-ASTHLEIEPFTILGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYN 718

Query: 733  LCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTGYDMDDAMIINKS 792
               R D  LY +   Q P+VK    +    D  P G NA VAV+SY+GYD++DA+++NK+
Sbjct: 719  QFKRIDTLLYLMIYPQQPMVKTKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKA 778

Query: 793  ADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEKLDEDGLPYIGTYV 852
            + +RGFG     +     L    N    I        +  P    + L  DGL  +G  V
Sbjct: 779  SIDRGFGRCETRRKTTTVLKRYPNHTQDIIGGMRVDENGEPIWQHKALGADGLGEVGMKV 838

Query: 853  EEGD-------PICAYFDDTLNKTKIK------TYHSSEPAYIEEVNLIGDESNKFQELQ 899
            E G        P     D T    + +       Y + EP++I++V +   ++++     
Sbjct: 839  ESGQIYINKSVPTNQSNDMTTQAQQAQYRETPVIYRAPEPSHIDQVMMSVSDNDQ----A 894

Query: 900  TVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMT 959
             + +  R  R P++GDKFSSRHGQKGVC       DMPF++ GI PDII+NPH FPSRMT
Sbjct: 895  LIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVKQEDMPFNDQGIVPDIIMNPHGFPSRMT 954

Query: 960  IGMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATG 1019
            +G  +E ++GKAG L+G  +  T +      +  +   + L   G+NY G + +YSG TG
Sbjct: 955  VGKMIELISGKAGVLNGSLEYGTCF----GGSKLEDMSKILVDQGFNYSGKDMLYSGITG 1010

Query: 1020 EELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDAL 1079
            E L+A I+ G +YYQ+L+HMV DK   R+ GP   LT QP +GR R GG+R+GEMERD +
Sbjct: 1011 ECLQAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCV 1070

Query: 1080 IGHGTSFLLQDRLLNSSDYTQASVCRECG 1108
            I +G S LL +RL+ SSD  +  VC +CG
Sbjct: 1071 IAYGASQLLLERLMISSDAFEVDVCDKCG 1099

>YOR207C (RET1) [5000] chr15 complement(730008..733457) RNA polymerase
            III, second-largest subunit (C128) [3450 bp, 1149 aa]
          Length = 1149

 Score =  399 bits (1025), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 327/1046 (31%), Positives = 505/1046 (48%), Gaps = 121/1046 (11%)

Query: 123  PSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDC--GGLPVMLQSNRCHLNKMSPYEL 180
            P E R R  +Y   + + ++++      N+   +D   G +P+ML+SN+C L      ++
Sbjct: 115  PHECRLRDMTYSAPIYVDIEYTRG---RNIIMHKDVEIGRMPIMLRSNKCILYDADESKM 171

Query: 181  VQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVR 240
             +  E   + GGYFIVNG EK+I   +VQ +     II  +   +G   +     + S  
Sbjct: 172  AKLNECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKGIVQA----SVTSST 224

Query: 241  PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDS 300
             ++ S+T V+    +G++  + +    E  +P+ ++LKA    SD EI   + GND   S
Sbjct: 225  HERKSKTYVI--TKNGKIYLKHNSIAEE--IPIAIVLKACGILSDLEIMQLVCGND---S 277

Query: 301  FLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLV 360
               D   + L    K   + Q   Q L+Y+G K + + +     + L+ G E +   V+ 
Sbjct: 278  SYQDIFAVNLEESSKLDIYTQQ--QALEYIGAKVKTMRRQK--LTILQEGIEAIATTVIA 333

Query: 361  HLGKDGS--QDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKID 418
            HL  +    ++K   +  M R++   +      D+ D   ++ + L G L  ++ ++   
Sbjct: 334  HLTVEALDFREKALYIAMMTRRVVMAMYNPKMIDDRDYVGNKRLELAGQLISLLFEDLFK 393

Query: 419  EYLQNI---IAQVRMDINRGMAINFKDKRYMSRVLMRVN---ENIGSKMQYFLSTGNLVS 472
            ++  +    I +V    NR M  +          L+ +N    NI S +   +STGN  S
Sbjct: 394  KFNNDFKLSIDKVLKKPNRAMEYD---------ALLSINVHSNNITSGLNRAISTGNW-S 443

Query: 473  QSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFLCP 530
                 +++ +G T V  ++++   IS   M+ R S  F    K +  R L P  +G LC 
Sbjct: 444  LKRFKMER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCT 499

Query: 531  VHTPDGSPCGLLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGPSL-CCVQID 589
              TP+G  CGL+ + A    I+T   +   I  + Y LGV   +   +A   L   V ++
Sbjct: 500  ADTPEGEACGLVKNLALMTHITTDDEE-EPIKKLCYVLGVEDITLIDSASLHLNYGVYLN 558

Query: 590  GKIIGWVSHEQGKIIADTLRYWKVEGKTPGL------PIDLEIGYVPPSTRGQYPGLYLF 643
            G +IG +            R+ +  GK             + +       R   P + + 
Sbjct: 559  GTLIGSIRFPTK--FVTQFRHLRRTGKVSEFISIYSNSHQMAVHIATDGGRICRPLIIVS 616

Query: 644  GGHSRM----LRPVRYLPLDKEDIV--GPFEQVYMN------IAVTPQEIQNNVHTHVEF 691
             G SR+    LR +    LD +D +  G  E + +N      IA+  ++I  ++ TH+E 
Sbjct: 617  DGQSRVKDIHLRKLLDGELDFDDFLKLGLVEYLDVNEENDSYIALYEKDIVPSM-THLEI 675

Query: 692  TPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPI 751
             P  IL  +A L P+   NQSPRN YQC MGKQ +G        R D  LY +   Q P+
Sbjct: 676  EPFTILGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMTYPQQPM 735

Query: 752  VKANLYDDYGMDNFPNGFNAVVAVISYTGYDMDDAMIINKSADERGFGYG-TMYKTEKV- 809
            VK    +    D  P G NA VAV+SY+GYD++DA+++NKS+ +RGFG   T  KT  V 
Sbjct: 736  VKTKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKSSIDRGFGRCETRRKTTTVL 795

Query: 810  ------------DLALNRNRGDPITQHFGFGNDEWPKEWLEKLDEDGLPYIGTYVEEGD- 856
                         + ++ N GDPI QH   G              DGL  +G  V+ G  
Sbjct: 796  KRYANHTQDIIGGMRVDEN-GDPIWQHQSLG-------------PDGLGEVGMKVQSGQI 841

Query: 857  ------PICAYFDDTLNKTKIKT--------YHSSEPAYIEEVNLIGDESNKFQELQTVS 902
                  P  +      N   ++T        Y   EP++I++V +    S+  Q L  + 
Sbjct: 842  YINKSVPTNSADAPNPNNVNVQTQYREAPVIYRGPEPSHIDQVMM--SVSDNDQAL--IK 897

Query: 903  IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTIGM 962
            +  R  R P++GDKFSSRHGQKGVC       DMPF++ GI PDII+NPH FPSRMT+G 
Sbjct: 898  VLLRQNRRPELGDKFSSRHGQKGVCGIIVKQEDMPFNDQGIVPDIIMNPHGFPSRMTVGK 957

Query: 963  FVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGEEL 1022
             +E ++GKAG L+G  +  T +      +  +   + L   G+NY G + +YSG TGE L
Sbjct: 958  MIELISGKAGVLNGTLEYGTCF----GGSKLEDMSKILVDQGFNYSGKDMLYSGITGECL 1013

Query: 1023 RADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH 1082
            +A I+ G +YYQ+L+HMV DK   R+ GP   LT QP +GR R GG+R+GEMERD +I +
Sbjct: 1014 QAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAY 1073

Query: 1083 GTSFLLQDRLLNSSDYTQASVCRECG 1108
            G S LL +RL+ SSD  +  VC +CG
Sbjct: 1074 GASQLLLERLMISSDAFEVDVCDKCG 1099

>ADL275C [1466] [Homologous to ScYOR207C (RET1) - SH] (219105..222530)
            [3426 bp, 1141 aa]
          Length = 1141

 Score =  397 bits (1021), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 314/1033 (30%), Positives = 496/1033 (48%), Gaps = 98/1033 (9%)

Query: 123  PSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGGLPVMLQSNRCHLNKMSPYELVQ 182
            P E R R  +Y   + + ++++       L +  + G +P+ML+SN+C LN  S   + +
Sbjct: 110  PHECRLRDMTYSAPIFVDIEYT-RGRSIVLHKDVEIGKMPIMLRSNKCILNGASEEVMAK 168

Query: 183  HKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVRPD 242
              E   + GGYFIVNG EK+I   +VQ +     II  +   +    +     + S   +
Sbjct: 169  LNECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKAIVQA----SVTSSTHE 221

Query: 243  QTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDSFL 302
            + S+T V+    + ++  + +    E  VP+V++LKA    SD EI   + GND   S  
Sbjct: 222  RKSKTYVV--TKNDKIYLKHNSIAEE--VPIVIVLKACGIVSDLEIMQLVCGND---SSY 274

Query: 303  TDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLVHL 362
             D   +      K   + Q   Q L+Y+G K + + +     + L+ G E +   V+ HL
Sbjct: 275  QDIFAINFEEASKMNIYTQQ--QALEYIGTKVKTIRRQK--LTVLQEGIEAIATTVIAHL 330

Query: 363  GKDGS--QDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEY 420
              +    ++K   +  M R++   +      D+ D   ++ + L G L  ++ ++   ++
Sbjct: 331  TVEALDFREKALYVAMMTRRVIMAIHNPKMVDDRDYVGNKRLELAGQLMSLLFEDLFKKF 390

Query: 421  LQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVN---ENIGSKMQYFLSTGNLVSQSGLD 477
              +  A +   + +       ++  M   L+ +N    NI S +   +STGN  S     
Sbjct: 391  NNDFKASIDKVLKK------PNRAEMYDALLSINVHSNNITSGLNRAISTGNW-SLKRFK 443

Query: 478  LQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFLCPVHTPD 535
            +++ +G T V  ++++   IS   M+ R S  F    K +  R L P  +G LC   TP+
Sbjct: 444  MER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTSDTPE 499

Query: 536  GSPCGLLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGPSL-CCVQIDGKIIG 594
            G  CGL+ + A    I+T   +   I ++ Y LGV   +   +A   L   V ++G IIG
Sbjct: 500  GEACGLVKNLALMTHITTDDEE-EPIKNLCYLLGVEDITLLDSASIHLNYGVYLNGTIIG 558

Query: 595  WVSHEQGKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPVR 654
                       +  R  +  GK           ++   T      +++     R+ RP+ 
Sbjct: 559  TTRFPAR--FVNQFRLLRRTGKVSE--------FISIYTNSHQKAVHIATDGGRICRPLI 608

Query: 655  Y--------------------LPLDKEDIVGPFEQVYMN------IAVTPQEIQNNVHTH 688
                                 L  D    +G  E + +N      IA+  ++I+    TH
Sbjct: 609  IVRNGKSMVTAGHLRRLLEGELQFDDFLKLGLVEYLDVNEENDSYIALYEKDIEEGT-TH 667

Query: 689  VEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQ 748
            +E  P  +L  +A L P+   NQSPRN YQC MGKQ +G        R D  LY +   Q
Sbjct: 668  LEIEPFTVLGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMIYPQ 727

Query: 749  TPIVKANLYDDYGMDNFPNGFNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKTEK 808
             P+VK+   +    D  P G NA VAV+SY+GYD++DA++INKS+ +RGFG     K   
Sbjct: 728  QPMVKSKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVINKSSIDRGFGRCETRKKTT 787

Query: 809  VDLALNRNRGDPITQHFGFGNDEWPKEWLEKLDEDGLPYIG-------TYVEEGDPICAY 861
              L    N    I        +  P    + L  DGL  +G        Y+ +  P  A 
Sbjct: 788  TILKRYPNHTQDIIGGMRVDENGEPIWQHQSLGPDGLGEVGMKVTSGQIYINKSIPTNAS 847

Query: 862  FDDTLNKTKIK------TYHSSEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIGD 915
             D  LN+ + +       Y + EP++I++V +   ++++      + +  R  R P++GD
Sbjct: 848  -DSVLNQVQSQYREAPIIYRAPEPSHIDQVMMSVSDNDQ----ALIKVLLRQNRRPELGD 902

Query: 916  KFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTIGMFVESLAGKAGALH 975
            KFSSRHGQKGVC       DMPF++ GI PDII+NPH FPSRMT+G  +E ++GKAG L+
Sbjct: 903  KFSSRHGQKGVCGIIVQQEDMPFNDQGICPDIIMNPHGFPSRMTVGKMLELVSGKAGVLN 962

Query: 976  GIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGEELRADIYVGVVYYQR 1035
            G  +  T +  ++    AD   E L   G+NY G + +Y G TGE L+A ++ G +YYQ+
Sbjct: 963  GTLEYGTCFGGSQ---LAD-MSEILVNNGFNYSGKDMLYFGITGECLQAYVFFGPIYYQK 1018

Query: 1036 LRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNS 1095
            L+HMV DK   R+ GP   LT QP +GR R GG+R+GEMERD +I +G S LL +RL+ S
Sbjct: 1019 LKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMLS 1078

Query: 1096 SDYTQASVCRECG 1108
            SD  +  VC +CG
Sbjct: 1079 SDAFEVDVCNKCG 1091

>KLLA0F01078g 98331..101759 highly similar to sp|P22276 Saccharomyces
            cerevisiae YOR207c RPC128 DNA-directed RNA polymerase
            III, 130 KD subunit, hypothetical start
          Length = 1142

 Score =  394 bits (1013), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 318/1038 (30%), Positives = 502/1038 (48%), Gaps = 108/1038 (10%)

Query: 123  PSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDC--GGLPVMLQSNRCHLNKMSPYEL 180
            P E R R  +Y   + + ++++   G   +   RD   G +P+ML+SN+C L+  +  ++
Sbjct: 111  PHECRLRDMTYSTPIFVDIEYT--RGRSIVLH-RDVEIGRMPIMLRSNKCILDGAAENDM 167

Query: 181  VQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVR 240
             +  E   + GGYFIVNG EK+I   +VQ +     II  +   +    +     + S  
Sbjct: 168  AKLNECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKNIVQA----SVTSST 220

Query: 241  PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGND--VK 298
             ++ S+T V+    + ++  + +    E  VP+V++LKA    SD EI   + GND   +
Sbjct: 221  HERKSKTYVV--TKNDKIYLKHNSIAEE--VPIVVVLKACGVVSDLEIMQLVCGNDSSYQ 276

Query: 299  DSF---LTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLD 355
            D F   L +  EL           +  + Q L+++G K + V +     S L+ G E + 
Sbjct: 277  DIFAVNLEEAAEL----------KIYTQQQALEFIGTKVKTVRRQK--LSILQEGIEAIA 324

Query: 356  RIVLVHLGKDGS--QDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIL 413
              V+ HL  +    ++K   +  M R++   +      D+ D   ++ + L G L  ++ 
Sbjct: 325  TTVIAHLTVEALDFREKALYIAMMTRRVVMAIDNPKMVDDRDYVGNKRLELAGQLMSLLF 384

Query: 414  KEKIDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVN---ENIGSKMQYFLSTGNL 470
            ++   ++  +  A +   + +       ++  M   L+ +N    NI + M   +STGN 
Sbjct: 385  EDLFKKFNNDFKANIDKVLKK------PNRAEMYDALLTINVHSNNITTGMNRAISTGNW 438

Query: 471  VSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFL 528
             S     +++ +G T V  ++++   IS   M+ R S  F    K +  R L P  +G L
Sbjct: 439  -SLKRFKMER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQPSQFGML 493

Query: 529  CPVHTPDGSPCGLLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGPSL-CCVQ 587
            C   TP+G  CGL+ + A    I+T   +   I  I Y LGV   S   +A   L   V 
Sbjct: 494  CTSDTPEGEACGLVKNLALMTHITTDDEE-EPIKRICYLLGVEDISLIDSASIHLNYGVY 552

Query: 588  IDGKIIGWVSH-----EQGKIIADTLR-------YWKVEGKTPGLPIDLEIGYVPPSTRG 635
            ++G IIG          Q + +  T R       Y     K   +  D          R 
Sbjct: 553  LNGTIIGTTRFPTKFVSQFRCLRRTGRASEFISIYTNTHQKAVHIATD--------GGRI 604

Query: 636  QYPGLYLFGGHSRM----LRPVRYLPLDKEDIV--GPFEQVYMN------IAVTPQEIQN 683
              P + +  G S +    LR +    L  +D +  G  E + +N      IA+  +++  
Sbjct: 605  CRPLIIVSNGQSSVTADHLRSLLAGKLQFDDFLKLGLVEYLDVNEENDSFIALYEKDLSE 664

Query: 684  NVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYR 743
            N+ TH+E     +L  +A L P+   NQSPRN YQC MGKQ +G        R D  LY 
Sbjct: 665  NI-THLEIESFTVLGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYL 723

Query: 744  LQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTGYDMDDAMIINKSADERGFGYGTM 803
            +   Q P+VK    +    D  P G NA VAV+SY+GYD++DA+++NK++ +RGFG    
Sbjct: 724  MIYPQQPMVKTKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKASIDRGFGRCET 783

Query: 804  YKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEKLDEDGLPYIGTYVEEGD------- 856
             +     L    N    I        +  P    + L  DGL  +G  VE G        
Sbjct: 784  RRKNTTVLKRYPNHTQDIIGGMRVDENGEPIWQHQALGPDGLGEVGMKVESGQIYVNKSV 843

Query: 857  PICAYFDDTLNKTKIK------TYHSSEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRT 910
            P  A  D  L +T+ +       Y + EP++I++V +   ++++      + +  R  R 
Sbjct: 844  PTNAS-DSILTQTQAQYKETPVVYRAPEPSHIDQVMMSVSDNDQ----ALIKVLLRQNRR 898

Query: 911  PQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTIGMFVESLAGK 970
            P++GDKFSSRHGQKGVC       D+PF++ G+ PDII+NPH FPSRMT+G  +E ++GK
Sbjct: 899  PELGDKFSSRHGQKGVCGIIVKQEDLPFNDQGVVPDIIMNPHGFPSRMTVGKMIELISGK 958

Query: 971  AGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGEELRADIYVGV 1030
            AG L+G  +  T +      +  +   + L   G+NY G + +YSG TGE L+A I+ G 
Sbjct: 959  AGVLNGTLEYGTCF----GGSKLEDMSKILVDNGFNYSGKDMLYSGITGECLQAYIFFGP 1014

Query: 1031 VYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQD 1090
            +YYQ+L+HMV DK   R+ GP   LT QP +GR R GG+R+GEMERD +I +G S LL +
Sbjct: 1015 IYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLE 1074

Query: 1091 RLLNSSDYTQASVCRECG 1108
            RL+ SSD  +  VC +CG
Sbjct: 1075 RLMLSSDAFEVDVCEKCG 1092

>CAGL0L02849g 332195..335596 highly similar to sp|P22276 Saccharomyces
            cerevisiae YOR207c RPC128 DNA-directed RNA polymerase
            III, hypothetical start
          Length = 1133

 Score =  392 bits (1007), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 318/1040 (30%), Positives = 505/1040 (48%), Gaps = 109/1040 (10%)

Query: 121  VYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVR-DCGGLPVMLQSNRCHLNKMSPYE 179
            V P E R R  +Y   + + ++++   G   +     + G +P+ML+SN+C L+      
Sbjct: 101  VPPHECRLRDMTYSAPIYVDIEYT--RGRNIIMHKNVEIGRMPIMLRSNKCILHGADEKM 158

Query: 180  LVQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSV 239
            + +  E   + GGYFIVNG EK+I   +VQ +     II  +   +    +     + S 
Sbjct: 159  MARLSECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKDIVQA----SVTSS 211

Query: 240  RPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKD 299
              ++ S+T V+    +G++  + +    E  VP+V++LKA    SD EI   + GND   
Sbjct: 212  THERKSKTYVV--TKNGKIYLKHNSIAEE--VPIVIVLKAAGIISDLEIMQLVCGND--- 264

Query: 300  SFLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVL 359
            S   D   + L    K   ++  + Q L+Y+G K + + +     + L+ G E +   ++
Sbjct: 265  SSYQDIFSVNLEEAAKL--NICTQQQALEYIGAKVKTMRRQK--LTILQEGIEAIATTII 320

Query: 360  VHLGKDGS--QDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKI 417
             HL  +    ++K   +  M R++   +      D+ D   ++ + L G L  ++ ++  
Sbjct: 321  AHLTVEALDFREKALYIATMTRRVVMAMHNPKMVDDRDYVGNKRLELAGQLISLLFEDLF 380

Query: 418  DEYLQNI---IAQVRMDINRGMAINFKDKRYMSRVLMRVN---ENIGSKMQYFLSTGNLV 471
             ++  +    I +V    NR M  +          L+ +N    NI S +   +STGN  
Sbjct: 381  KKFNNDFKLSIDKVLKKPNRAMEYD---------ALLSINVHSNNITSGLNRAISTGNW- 430

Query: 472  SQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFLC 529
            S     +++ +G T V  ++++   IS   M+ R S  F    K +  R L P  +G LC
Sbjct: 431  SLKRFKMER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLC 486

Query: 530  PVHTPDGSPCGLLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGPSL-CCVQI 588
               TP+G  CGL+ + A    I+T   +   I  + Y LGV P S   +A   L   V +
Sbjct: 487  TADTPEGEACGLVKNLALMTHITTDDEE-EPIRKLCYVLGVEPISLLDSASLHLNYGVYL 545

Query: 589  DGKIIGWVSHEQGKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSR 648
            +G +IG              R+ +  GK           ++   T   +  +++     R
Sbjct: 546  NGTLIGTTKFPSN--FVSRFRFLRRTGKVSE--------FISIYTNDHHNAVHIATDGGR 595

Query: 649  MLRPVRYLPLDKEDI--------------------VGPFEQVYMN------IAVTPQEIQ 682
            + RP+  +   K  +                    +G  E + +N      IA+  ++I 
Sbjct: 596  ICRPLIIVKDGKSMVEAEHLKRLLSGELVFDDFLKLGLVEYLDVNEENDSYIALYEKDIT 655

Query: 683  NNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLY 742
            +++ TH+E  P  +L  +A L P+   NQSPRN YQC MGKQ +G        R D  LY
Sbjct: 656  HDI-THLEIEPFTVLGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLY 714

Query: 743  RLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTGYDMDDAMIINKSADERGFGYG- 801
             +   Q P+VK    +    D  P G NA VAV+SY+GYD++DA+++NKS+ +RGFG   
Sbjct: 715  LMIYPQQPMVKTKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKSSIDRGFGRCE 774

Query: 802  TMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKE-WL-EKLDEDGLPYIG-------TYV 852
            T  KT  V      +  D +    G   DE  +  W  E L  DGL  +G        Y+
Sbjct: 775  TRRKTTTVLKKYPNHTKDALC---GMRVDENGEAIWQHESLGPDGLGEVGLKIRSGQIYI 831

Query: 853  EEGDPICAYFDDTLNKTKIK----TYHSSEPAYIEEVNLIGDESNKFQELQTVSIKYRIR 908
             +  P+ +     +N+ + +     Y + E + I++V +    S+  Q+L  + +  R  
Sbjct: 832  NKSVPVQSSDAMAVNQAQYRETPVIYRAPELSIIDQVMM--STSDNDQDL--IKVLLRQN 887

Query: 909  RTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTIGMFVESLA 968
            R P++GDKFSSRHGQKGVC       DMPF++ GI PDII+NPH FPSRMT+G  +E ++
Sbjct: 888  RRPELGDKFSSRHGQKGVCGIIVQQEDMPFNDQGICPDIIMNPHGFPSRMTVGKMIELIS 947

Query: 969  GKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGEELRADIYV 1028
            GKAG L+G  +  T +      +  +   + L   G+NY G + +YSG TGE L+A I+ 
Sbjct: 948  GKAGVLNGSLEYGTCF----GGSKLEDMSKILVDQGFNYSGKDMLYSGITGECLQAYIFF 1003

Query: 1029 GVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLL 1088
            G +YYQ+L+HMV DK   R+ GP   LT QP +GR R GG+R+GEMERD +I +G S LL
Sbjct: 1004 GPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLL 1063

Query: 1089 QDRLLNSSDYTQASVCRECG 1108
             +RL+ SSD  +  VC  CG
Sbjct: 1064 LERLMISSDAFEVDVCSNCG 1083

>Kwal_47.18783
          Length = 1220

 Score =  375 bits (962), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 325/1130 (28%), Positives = 504/1130 (44%), Gaps = 158/1130 (13%)

Query: 91   LGNKLSVSVEQVSIAKP--MSNDGVSSAVERKVYPSESRQRLTSYRGKLLLKLKWSVNN- 147
            +  K  +S  ++ +AKP    +DGVS A+    YP E+R R  +Y   L ++++      
Sbjct: 80   ISRKYEISFGKIYLAKPSMTESDGVSHAM----YPQEARLRNLTYASGLFVEIRKRTYEA 135

Query: 148  ----GEENLFEVRD------------CGGLPVMLQSNRCHLNKMSPYELVQHKEESDEIG 191
                G +  +EV D             G +P+ML+S  C L++++  +L + KE   ++G
Sbjct: 136  VDIPGRDLKYEVIDEESEMSDENKIFIGRVPIMLRSKYCLLDELTESDLYKLKECPFDMG 195

Query: 192  GYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSV-----RPDQTSQ 246
            GYFI+NG EK+   LI Q R+     I   F     S   +  +IRS      R   T Q
Sbjct: 196  GYFIINGSEKV---LIAQERS--AGNIVQVFKKSAPSPISHIAEIRSALEKGSRFISTLQ 250

Query: 247  TNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDSFLTDRL 306
              +     +   T + +    +  +P+V+I +AL    D EI + I   DV D  +   L
Sbjct: 251  VKLYGREGNTNRTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHIC-YDVNDWQM---L 306

Query: 307  ELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLVHLGK-D 365
            ELL    ++ +  +Q+R   L ++G +   +      +  ++  +++L +  L H+ + +
Sbjct: 307  ELLKPCVEEGFV-IQDRETALDFIGRRGTAL--GIKKEKRIQYAKDILQKEFLPHITQLE 363

Query: 366  GSQDKFRMLL-FMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEYLQNI 424
            G + +    L +MI +L          D+ D    + + L G L   + K         +
Sbjct: 364  GFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFK--------TL 415

Query: 425  IAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQVSGY 484
              ++  DI R M  + ++ +  +  L      I + ++Y L+TGN   Q    +   +G 
Sbjct: 416  FRKLTRDILRFMQRSVEEAKDFNLKLAVKATTITAGLKYALATGNWGEQKKA-MTSRAGV 474

Query: 485  TVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNH 544
            + V  +  +   +SH R  +        K    R+L    WG +CP  TP+G  CGL+ +
Sbjct: 475  SQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKN 533

Query: 545  FAHKCRISTQQSDVSRIPSILYSLGVAP-ASHTFAAGPSLCCVQIDGKIIGWVSHEQGKI 603
             +    IS   +D   I + L   G+ P   +     P    V ++G   G   H     
Sbjct: 534  LSLMSCISVG-TDPLPIITFLNEWGMEPLEDYVPHQSPDATRVFVNGVWHGI--HRNPAK 590

Query: 604  IADTLRYWKVEGK-TPGLPI-----DLEIGYVPPSTRGQYP-------------GLYLFG 644
            + DT+R  + +G  TP + I     + E+     + R   P              L L  
Sbjct: 591  LVDTIRKLRRKGDVTPEVSIVRDIREKELKIFTDAGRVYRPLFIVDENESTGVKELKLRK 650

Query: 645  GHSRMLRPVRYLPLDKEDIVGPFEQVYMN------------------------IAVTPQE 680
            GH R L    Y     +DI G FE+  +N                        IA+  ++
Sbjct: 651  GHVRKLMMTEY-----QDIEGGFEEEDINYTWTSLLNEGLVEYIDAEEEETILIAMQHED 705

Query: 681  I-----------------------QNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMY 717
            +                        +N  TH E  P+ IL + A++ PF D NQSPRN Y
Sbjct: 706  LDPSFEADDPEGELDPAKRIKAIHHSNTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTY 765

Query: 718  QCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVIS 777
            Q  MGKQ MG        R D     L   Q P+      +       P G NA+VA+  
Sbjct: 766  QSAMGKQAMGVFLTNYSVRMDTMANILYYPQKPLGTTRSMEYLKFRELPAGQNAIVAIAC 825

Query: 778  YTGYDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEW- 836
            Y+GY+ +D+MI+N+S+ +RG      +++    +   +  G  IT+ F     E P+   
Sbjct: 826  YSGYNQEDSMIMNQSSIDRGLFRSLFFRSY---MDQEKRIGMSITESF-----EKPQRTN 877

Query: 837  --------LEKLDEDGLPYIGTYVEEGD-------PICAYFDDTLNKTKIKTYHSSEPAY 881
                     +KLD+DGL   G  V   D       PI    ++   +T   +   +    
Sbjct: 878  TLRMKHGTYDKLDDDGLIAPGVRVSGDDMIIGKTTPIPPDAEELGQRTAFHSKRDASTPL 937

Query: 882  IEEVNLIGDE---SNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPF 938
                N I D+   +   + L+ V ++ R  + PQIGDKF+SRHGQKG     +   DMPF
Sbjct: 938  RSTENGIVDQVLITTNQEGLKFVKVRVRTTKVPQIGDKFASRHGQKGTIGITYRREDMPF 997

Query: 939  SETGIQPDIIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGE 998
            +  GI PD+IINPHA PSRMT+   +E L  K  AL G   D++P+     D   D    
Sbjct: 998  TAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFT----DITVDGISR 1053

Query: 999  QLAKAGYNYHGNEPMYSGATGEELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQ 1058
             L + GY   G E MY+G TG++L A I+ G  YYQRLRHMV+DK   R+ GPV  LT Q
Sbjct: 1054 LLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPVQVLTRQ 1113

Query: 1059 PVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQASVCRECG 1108
            PV+GR R GG+R GEMERD +I HG +  L++RL+ +SD  +  +C  CG
Sbjct: 1114 PVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFRVHICGVCG 1163

>YOR151C (RPB2) [4950] chr15 complement(612997..616671) RNA polymerase
            II, second-largest subunit [3675 bp, 1224 aa]
          Length = 1224

 Score =  374 bits (959), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 324/1151 (28%), Positives = 507/1151 (44%), Gaps = 190/1151 (16%)

Query: 86   SNSGYLGNKLSVSVEQVSIAKPMSNDGVSSAVERKVYPSESRQRLTSYRGKLLLKLKWSV 145
            + S  +  K  +S  ++ + KPM N+  S  V   +YP E+R R  +Y   L + +K   
Sbjct: 79   TESDNISRKYEISFGKIYVTKPMVNE--SDGVTHALYPQEARLRNLTYSSGLFVDVKKRT 136

Query: 146  NN-----GEENLFEVRD-------------CGGLPVMLQSNRCHLNKMSPYELVQHKEES 187
                   G E  +E+                G LP+ML+S  C+L++ +  +L + KE  
Sbjct: 137  YEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECP 196

Query: 188  DEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSV-----RPD 242
             ++GGYFI+NG EK+   LI Q R+     I   F     S   +  +IRS      R  
Sbjct: 197  FDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKAAPSPISHVAEIRSALEKGSRFI 251

Query: 243  QTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDSFL 302
             T Q  +         T + +    +  +P+V+I +AL    D EI + I   DV D  +
Sbjct: 252  STLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHIC-YDVNDWQM 310

Query: 303  TDRLELLLR-GFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLVH 361
             + L+  +  GF      +Q+R   L ++G +   +      +  ++  +++L +  L H
Sbjct: 311  LEMLKPCVEDGFV-----IQDRETALDFIGRRGTAL--GIKKEKRIQYAKDILQKEFLPH 363

Query: 362  LGK-DGSQDKFRMLL-FMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILK----- 414
            + + +G + +    L +MI +L          D+ D    + + L G L   + K     
Sbjct: 364  ITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLFKK 423

Query: 415  --EKIDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVS 472
              + I  Y+Q  + +   D N  +AIN K               I S ++Y L+TGN   
Sbjct: 424  LTKDIFRYMQRTVEEAH-DFNMKLAINAK--------------TITSGLKYALATGNWGE 468

Query: 473  QSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVH 532
            Q    +   +G + V  +  +   +SH R  +        K    R+L    WG +CP  
Sbjct: 469  QKKA-MSSRAGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAE 526

Query: 533  TPDGSPCGLLNHFAHKCRISTQQSDVSRIPSILYSLGVAP-ASHTFAAGPSLCCVQIDGK 591
            TP+G  CGL+ + +    IS   +D   I + L   G+ P   +     P    V ++G 
Sbjct: 527  TPEGQACGLVKNLSLMSCISVG-TDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGV 585

Query: 592  IIGWVSHEQGKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLR 651
              G   H     + +TLR  + +G      I+ E+  +      +   L +F    R+ R
Sbjct: 586  WHG--VHRNPARLMETLRTLRRKGD-----INPEVSMIRDIREKE---LKIFTDAGRVYR 635

Query: 652  PV----------------------RYLPLDKEDIVGPFEQV---------------YMN- 673
            P+                      + +  + +DI G FE V               Y++ 
Sbjct: 636  PLFIVEDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDA 695

Query: 674  -------IAVTPQEIQ-----------------------NNVHTHVEFTPTNILSILANL 703
                   IA+ P++++                           TH E  P+ IL + A++
Sbjct: 696  EEEESILIAMQPEDLEPAEANEENDLDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASI 755

Query: 704  TPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMD 763
             PF D NQSPRN YQ  MGKQ MG        R D     L   Q P+      +     
Sbjct: 756  IPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFR 815

Query: 764  NFPNGFNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQ 823
              P G NA+VA+  Y+GY+ +D+MI+N+S+ +RG      +++    +   +  G  IT+
Sbjct: 816  ELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSY---MDQEKKYGMSITE 872

Query: 824  HFGFGNDEWPKEW---------LEKLDEDGLPYIGTYVEEGD-------PICAYFDDTLN 867
             F     E P+            +KLD+DGL   G  V   D       PI    ++   
Sbjct: 873  TF-----EKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQ 927

Query: 868  KTKIKTYHS----------SEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIGDKF 917
            +T    YHS          +E   +++V +  ++      L+ V ++ R  + PQIGDKF
Sbjct: 928  RT---AYHSKRDASTPLRSTENGIVDQVLVTTNQDG----LKFVKVRVRTTKIPQIGDKF 980

Query: 918  SSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTIGMFVESLAGKAGALHGI 977
            +SRHGQKG     +   DMPF+  GI PD+IINPHA PSRMT+   +E L  K  AL G 
Sbjct: 981  ASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN 1040

Query: 978  AQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGEELRADIYVGVVYYQRLR 1037
              D++P+     D   +   + L + GY   G E MY+G TG++L A I+ G  YYQRLR
Sbjct: 1041 EGDASPFT----DITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLR 1096

Query: 1038 HMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSD 1097
            HMV+DK   R+ GP+  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+ +SD
Sbjct: 1097 HMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASD 1156

Query: 1098 YTQASVCRECG 1108
              +  +C  CG
Sbjct: 1157 AFRVHICGICG 1167

>CAGL0L04246g complement(493026..496697) highly similar to sp|P08518
            Saccharomyces cerevisiae YOR151c RPB2 DNA-directed RNA
            polymerase II, hypothetical start
          Length = 1223

 Score =  369 bits (948), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 327/1154 (28%), Positives = 505/1154 (43%), Gaps = 205/1154 (17%)

Query: 91   LGNKLSVSVEQVSIAKPMSNDGVSSAVERKVYPSESRQRLTSYRGKLLLKLKWSVNNGEE 150
            +  K  +S  ++ + KPM N+  S  V   +YP E+R R  +Y   L + +        +
Sbjct: 82   ISRKYEISFGKIYVTKPMVNE--SDGVTHALYPQEARLRNLTYSSGLFVDVT-------K 132

Query: 151  NLFEVRDC-------------------------GGLPVMLQSNRCHLNKMSPYELVQHKE 185
              +E  D                          G LP+ML+S  C+L+  +  +L + KE
Sbjct: 133  RTYEAVDVPGRDLNYQLIAEESEEDSESGKVFIGRLPIMLRSKNCYLSDATESDLYKLKE 192

Query: 186  ESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSV-----R 240
               ++GGYFI+NG EK+   LI Q R+     I   F     S   +  +IRS      R
Sbjct: 193  CPFDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKAAPSPISHVAEIRSALEKGSR 247

Query: 241  PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDS 300
               T Q  +    +    T + +    +  +P+V+I +AL    D EI + I   DV D 
Sbjct: 248  FISTLQVKLYGRESSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHIC-YDVNDW 306

Query: 301  FLTDRLELLLR-GFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVL 359
             + + L+  +  GF      +Q+R   L ++G +   +      +  ++  +++L +  L
Sbjct: 307  QMLEMLKPCVEDGFV-----IQDRETALDFIGRRGTAL--GIKKEKRIQYAKDILQKEFL 359

Query: 360  VHLGK-DGSQDKFRMLL-FMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILK--- 414
             H+ + +G + +    L +MI +L          D+ D    + + L G L   + K   
Sbjct: 360  PHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLF 419

Query: 415  ----EKIDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNL 470
                + I  Y+Q  + +   D N  +AIN K               I S ++Y L+TGN 
Sbjct: 420  RKLTKDIFRYMQRTVEEAN-DFNMKLAINAK--------------TITSGLKYALATGNW 464

Query: 471  VSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCP 530
              Q    +   +G + V  +  +   +SH R  +        K    R+L    WG +CP
Sbjct: 465  GEQKKA-MSSRAGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCP 522

Query: 531  VHTPDGSPCGLLNHFAHKCRISTQQSDVSRIPSILYSLGVAP-ASHTFAAGPSLCCVQID 589
              TP+G  CGL+ + +    IS   +D   I + L   G+ P   +     P    V ++
Sbjct: 523  AETPEGQACGLVKNLSLMSCISVG-ADPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVN 581

Query: 590  GKIIGWVSHEQGKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRM 649
            G   G   H     + +TLR  + +G      I+ E+  +    R Q   L +F    R+
Sbjct: 582  GVWHG--VHRNPARLMETLRTLRRKGD-----INPEVSMIR-DIREQ--ELKIFTDAGRV 631

Query: 650  LRPVRYLPLDKE----------------------DIVGPFEQV---------------YM 672
             RP+  +  D+E                      DI G FE                 Y+
Sbjct: 632  YRPLFIVEDDEELGRKELKVRKGHVAKLMATEYQDIEGGFEDAEDYTWSSLLNEGLVEYI 691

Query: 673  N--------IAVTPQEIQ----------NNVH--------------THVEFTPTNILSIL 700
            +        IA+ P++++           NV               TH E  P+ IL + 
Sbjct: 692  DAEEEESILIAMQPEDLEPTAVEQDIPKENVDLAKRIKVTHHATTFTHCEIHPSMILGVA 751

Query: 701  ANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDY 760
            A++ PF D NQSPRN YQ  MGKQ MG        R D     L   Q P+      +  
Sbjct: 752  ASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNFRMDTMANILYYPQKPLGTTRAMEYL 811

Query: 761  GMDNFPNGFNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDP 820
                 P G NA+VA+  Y+GY+ +D+MI+N+S+ +RG      +++    +   +  G  
Sbjct: 812  KFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSY---MDQEKKYGMS 868

Query: 821  ITQHFGFGNDEWPKEW---------LEKLDEDGLPYIGTYVEEGD-------PICAYFDD 864
            IT+ F     E P+            +KLDEDGL   G  V   D       PI    ++
Sbjct: 869  ITETF-----EKPQRTNTLRMKHGTYDKLDEDGLIAPGVRVSGEDIIIGKTTPIAPDEEE 923

Query: 865  TLNKTKIKTYHS----------SEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIG 914
               +T    YHS          +E   +++V +  ++      L+ V ++ R  + PQIG
Sbjct: 924  LGQRT---AYHSKRDASTPLRSTENGIVDQVLITTNQDG----LKFVKVRVRTTKVPQIG 976

Query: 915  DKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTIGMFVESLAGKAGAL 974
            DKF+SRHGQKG     +   DMPF+  GI PD+IINPHA PSRMT+   +E L  K  AL
Sbjct: 977  DKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAAL 1036

Query: 975  HGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGEELRADIYVGVVYYQ 1034
             G   D++P+     D   +   + L + GY   G E MY+G TG++L A I+ G  YYQ
Sbjct: 1037 SGNEGDASPFT----DITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQ 1092

Query: 1035 RLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLN 1094
            RLRHMV+DK   R+ GP+  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+ 
Sbjct: 1093 RLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLME 1152

Query: 1095 SSDYTQASVCRECG 1108
            +SD  +  +C  CG
Sbjct: 1153 ASDAFRVHICGICG 1166

>Scas_714.41
          Length = 1224

 Score =  369 bits (946), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 322/1148 (28%), Positives = 504/1148 (43%), Gaps = 194/1148 (16%)

Query: 91   LGNKLSVSVEQVSIAKPMSNDGVSSAVERKVYPSESRQRLTSYRGKLLLKLKWSVNN--- 147
            +  K  +   ++ + KPM N+  S  V   +YP E+R R  +Y   L + +K        
Sbjct: 84   VSRKYEIGFGKIYVTKPMVNE--SDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAVD 141

Query: 148  --GEENLFEVRD-------------CGGLPVMLQSNRCHLNKMSPYELVQHKEESDEIGG 192
              G E  +E+                G LP+ML+S  C+L+  +  +L + KE   ++GG
Sbjct: 142  VPGRELKYELIAEESEEESESGKVFIGRLPIMLRSKNCYLSDATESDLYKLKECPFDMGG 201

Query: 193  YFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVRPDQT---SQTNV 249
            YFI+NG EK+   LI Q R+     I   F     S   +  +IRS     +   S   V
Sbjct: 202  YFIINGSEKV---LIAQERS--AGNIVQVFKKAAPSPISHVAEIRSALEKGSRFISTLQV 256

Query: 250  LHYLNDGQ----VTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDSFLTDR 305
              Y  +G     +     + K +  +P+V+I +AL    D EI + I   DV D  + + 
Sbjct: 257  KLYGREGSDARTINATLPYIKQD--IPIVIIFRALGIIPDGEILEHIC-YDVNDWQMLEM 313

Query: 306  LELLLR-GFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLVHLGK 364
            L+  +  GF      +Q+R   L ++G +   +      +  ++  +++L +  L H+ +
Sbjct: 314  LKPCVEDGFV-----IQDRETALDFIGRRGTAL--GIKKEKRIQYAKDILQKEFLPHITQ 366

Query: 365  -DGSQDKFRMLL-FMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILK-------E 415
             +G + +    L +MI +L          D+ D    + + L G L   + K       +
Sbjct: 367  LEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLASLFKTLFRKLTK 426

Query: 416  KIDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSG 475
             I  Y+Q  + +   D N  +AIN K               I S ++Y L+TGN   Q  
Sbjct: 427  DIFRYMQRTVEEAH-DFNMKLAINAK--------------TITSGLKYALATGNWGEQKK 471

Query: 476  LDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPD 535
              +   +G + V  +  +   +SH R  +        K    R+L    WG +CP  TP+
Sbjct: 472  A-MSSRAGVSQVLNRYTYSSTLSHLRRTNT-PIGRDGKLAKPRQLHNTHWGLVCPAETPE 529

Query: 536  GSPCGLLNHFAHKCRISTQQSDVSRIPSILYSLGVAP-ASHTFAAGPSLCCVQIDGKIIG 594
            G  CGL+ + +    IS   +D   I + L   G+ P   +     P    V ++G   G
Sbjct: 530  GQACGLVKNLSLMSCISVG-TDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGVWHG 588

Query: 595  WVSHEQGKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPV- 653
               H     + DTLR  + +G      I+ E+  +      +   L +F    R+ RP+ 
Sbjct: 589  --VHRNPARLMDTLRTLRRKGD-----INPEVSMIRDIREKE---LKIFTDAGRVYRPLF 638

Query: 654  ---------------------RYLPLDKEDIVGPFEQV---------------YMN---- 673
                                 + +  + +DI G FE                 Y++    
Sbjct: 639  IVEDDETLGHKELKVRKGHIAKLMATEYQDIEGGFEDAEEYTWTSLLNEGLVEYIDAEEE 698

Query: 674  ----IAVTPQEIQ-----------------------NNVHTHVEFTPTNILSILANLTPF 706
                I++ P++++                           TH E  P+ IL + A++ PF
Sbjct: 699  ETILISMQPEDLEPPMENEEVIDDMDPAKRIRATQHATTFTHCEIHPSMILGVAASIIPF 758

Query: 707  SDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFP 766
             D NQSPRN YQ  MGKQ MG        R D     L   Q P+      +       P
Sbjct: 759  PDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRSMEYLKFRELP 818

Query: 767  NGFNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFG 826
             G NA+VA+  Y+GY+ +D+MI+N+S+ +RG      +++    +   +  G  IT+ F 
Sbjct: 819  AGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSY---MDQEKKYGMSITETF- 874

Query: 827  FGNDEWPKEW---------LEKLDEDGLPYIGTYVEEGD-------PICAYFDDTLNKTK 870
                E P+            +KLD+DGL   G  V   D       PI    ++   +T 
Sbjct: 875  ----EKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDIIIGKTTPISPDEEELGQRT- 929

Query: 871  IKTYHS----------SEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIGDKFSSR 920
               YHS          +E   +++V +  ++      L+ V ++ R  + PQIGDKF+SR
Sbjct: 930  --AYHSKRDASTPLRSTENGIVDQVLITTNQDG----LKFVKVRVRTTKVPQIGDKFASR 983

Query: 921  HGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTIGMFVESLAGKAGALHGIAQD 980
            HGQKG     +   DMPF+  GI PD+IINPHA PSRMT+   +E L  K  AL G   D
Sbjct: 984  HGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGD 1043

Query: 981  STPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGEELRADIYVGVVYYQRLRHMV 1040
            ++P+     D   +   + L + GY   G E MY+G TG++L A I+ G  YYQRLRHMV
Sbjct: 1044 ASPFT----DITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMV 1099

Query: 1041 NDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQ 1100
            +DK   R+ GP+  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+ +SD  +
Sbjct: 1100 DDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFR 1159

Query: 1101 ASVCRECG 1108
              +C  CG
Sbjct: 1160 VHICGNCG 1167

>AFR404C [3596] [Homologous to ScYOR151C (RPB2) - SH]
            (1162949..1166617) [3669 bp, 1222 aa]
          Length = 1222

 Score =  363 bits (933), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 319/1132 (28%), Positives = 493/1132 (43%), Gaps = 160/1132 (14%)

Query: 91   LGNKLSVSVEQVSIAKP--MSNDGVSSAVERKVYPSESRQRLTSYRGKLLLKLKWSVNN- 147
            +  K  +S  ++ +AKP    +DGVS A+    YP E+R R  +Y   L +++K      
Sbjct: 80   ISRKYEISFGKIYLAKPSMTESDGVSHAM----YPQEARLRNLTYASGLFVEIKKRTYEA 135

Query: 148  ----GEENLFEVRD------------CGGLPVMLQSNRCHLNKMSPYELVQHKEESDEIG 191
                G +  +E+               G +P+ML+S  C L+ +S  +L + KE   ++G
Sbjct: 136  VDIPGRDLKYEIIQEESEDTEEGKIFIGRVPIMLRSKYCLLDDLSESDLYRLKECPFDMG 195

Query: 192  GYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVRPDQT---SQTN 248
            GYFI+NG EK+   LI Q R+     I   F     S   +  +IRS     +   S   
Sbjct: 196  GYFIINGSEKV---LIAQERS--AGNIVQVFKKSAPSPISHIAEIRSALEKGSRFISTLQ 250

Query: 249  VLHYLNDGQV--TFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDSFLTDRL 306
            V  Y  +G    T + +    +  +P+V+I +AL    D EI + I  +      L    
Sbjct: 251  VKLYGREGSTSRTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDQNDWQMLEMLK 310

Query: 307  ELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLVHLGK-D 365
              +  GF      +Q+R   L ++G +   +      +  ++  +++L +  L H+ + +
Sbjct: 311  PCVEEGFV-----IQDRETALDFIGRRGTAL--GIKKEKRIQYAKDILQKEFLPHITQLE 363

Query: 366  GSQDKFRMLL-FMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEYLQNI 424
            G + +    L +MI +L          D+ D    + + L G L   + K         +
Sbjct: 364  GFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFK--------TL 415

Query: 425  IAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQVSGY 484
              ++  DI R M  + ++ +  +  L      I + ++Y L+TGN   Q    +   +G 
Sbjct: 416  FRKLTRDILRFMQRSVEEAKDFNLKLAVKATTITAGLKYALATGNWGEQKKA-MSSRAGV 474

Query: 485  TVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNH 544
            + V  +  +   +SH R  +        K    R+L    WG +CP  TP+G  CGL+ +
Sbjct: 475  SQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKN 533

Query: 545  FAHKCRISTQQSDVSRIPSILYSLGVAP-ASHTFAAGPSLCCVQIDGKIIGWVSHEQGKI 603
             +    IS   +D   I + L   G+ P   +     P    V ++G   G   H     
Sbjct: 534  LSLMSCISVG-TDPVPIITFLNEWGMEPLEDYVPHQSPDATRVFVNGVWHGI--HRNPAR 590

Query: 604  IADTLRYWKVEG------------KTPGLPIDLEIG------YVPPSTRGQ--YPGLYLF 643
            + DT+R  + +G            +   L I  + G      +V   T+    +  L + 
Sbjct: 591  LVDTIRKLRRKGDITAEVSIVRDIREKELKIFTDAGRVYRPLFVVADTQHADGHKDLKVR 650

Query: 644  GGHSRMLRPVRYLPLDKEDIVGPFEQVYMNIAVT-------------------------- 677
             GH R L    Y     +DI G FE   +N   T                          
Sbjct: 651  KGHIRKLMLTEY-----QDIEGGFEDEDINYTWTSLLNDGIVEYIDAEEEETILIAMQQE 705

Query: 678  ------PQEI----------------QNNVHTHVEFTPTNILSILANLTPFSDFNQSPRN 715
                  PQ +                 +N  TH E  P+ IL + A++ PF D NQSPRN
Sbjct: 706  DLDPSVPQTVDPSDELDPARRIKAIHHSNTFTHCEIHPSMILGVAASVIPFPDHNQSPRN 765

Query: 716  MYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAV 775
             YQ  MGKQ MG        R D     L   Q P+      +       P G NA+VA+
Sbjct: 766  TYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAI 825

Query: 776  ISYTGYDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKE 835
              Y+GY+ +D+MI+N+S+ + G      +++    +   +  G  IT+ F     E P  
Sbjct: 826  ACYSGYNQEDSMIMNQSSIDSGLFRSLFFRSY---MDQEKRIGMSITESF-----EKPHR 877

Query: 836  W---------LEKLDEDGLPYIGTYVEEGD-------PICAYFDDTLNKTKIKTYHSSEP 879
                       EKLD+DGL   G  V   D       PI    ++   +T   +   +  
Sbjct: 878  TNTLRMKHGTYEKLDDDGLIAPGVRVSGDDIIIGKTTPIPPDAEELGQRTAFHSKRDAST 937

Query: 880  AYIEEVNLIGDE---SNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDM 936
                  N I D+   +   + L+ V ++ R  + PQIGDKF+SRHGQKG     +   DM
Sbjct: 938  PLRSTENGIVDQVLITTNQEGLKFVKVRVRTTKVPQIGDKFASRHGQKGTIGITYRREDM 997

Query: 937  PFSETGIQPDIIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYF 996
            PF+  G+ PD+IINPHA PSRMT+   +E L  K  AL G   D++P+     D   D  
Sbjct: 998  PFTAEGVVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFT----DITVDGI 1053

Query: 997  GEQLAKAGYNYHGNEPMYSGATGEELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLT 1056
             + L + GY   G E MY+G TG++L A I+ G  YYQRLRHMV+DK   R+ GP+  LT
Sbjct: 1054 SKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLT 1113

Query: 1057 MQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQASVCRECG 1108
             QPV+GR R GG+R GEMERD +I HG +  L++RL+ +SD  +  +C  CG
Sbjct: 1114 RQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFRVHICGICG 1165

>KLLA0B05577g complement(501690..505355) highly similar to sp|P08518
            Saccharomyces cerevisiae YOR151c RPB2 DNA-directed RNA
            polymerase II, 140 kDa chain, start by similarity
          Length = 1221

 Score =  292 bits (747), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 177/474 (37%), Positives = 247/474 (52%), Gaps = 41/474 (8%)

Query: 656  LPL-DKEDIVGPFEQVYMNIAVTPQEIQN-NVHTHVEFTPTNILSILANLTPFSDFNQSP 713
            LP+ D ED + P  ++        + I N N+ TH E  P+ IL + A++ PF D NQSP
Sbjct: 711  LPVADSEDDLDPARRI--------RAIHNSNIFTHCEIHPSMILGVAASVIPFPDHNQSP 762

Query: 714  RNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVV 773
            RN YQ  MGKQ MG        R D     L   Q P+      +       P G NA+V
Sbjct: 763  RNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIV 822

Query: 774  AVISYTGYDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDEWP 833
            A+  Y+GY+ +D+MI+N+S+ +RG      +++    +   +  G  IT+ F     E P
Sbjct: 823  AIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSY---MDQEKRIGMSITESF-----EKP 874

Query: 834  KEW---------LEKLDEDGLPYIGTYVEEGD-------PICAYFDDTLNKTKIKTYHSS 877
                         +KLD+DGL   G  V   D       PI    ++   +T   +   +
Sbjct: 875  HRTNTLRMKHGTYDKLDDDGLIAPGVRVSGDDMIIGKTTPIPPDAEELGQRTAFHSKRDA 934

Query: 878  EPAYIEEVNLIGDE---SNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTI 934
                    N I D+   +   + L+ V ++ R  + PQIGDKF+SRHGQKG     + T 
Sbjct: 935  STPLRSTENGIVDQVLITTNQEGLKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRTE 994

Query: 935  DMPFSETGIQPDIIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPWIFNEDDTPAD 994
            DMPF+  G+ PD+IINPHA PSRMT+   +E L  K  AL G   D++P+     D   D
Sbjct: 995  DMPFTAEGVVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFT----DITVD 1050

Query: 995  YFGEQLAKAGYNYHGNEPMYSGATGEELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNS 1054
                 L + GY   G E MY+G TG++L A I+ G  YYQRLRHMV+DK   R+ GP+  
Sbjct: 1051 GISRLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQV 1110

Query: 1055 LTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQASVCRECG 1108
            LT QPV+GR R GG+R GEMERD +I HG +  L++RL+ +SD  +  +C  CG
Sbjct: 1111 LTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFRVHICGICG 1164

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 141/595 (23%), Positives = 248/595 (41%), Gaps = 73/595 (12%)

Query: 91  LGNKLSVSVEQVSIAKP--MSNDGVSSAVERKVYPSESRQRLTSYRGKLLLKLKWSVNNG 148
           +  K  +S  ++ +AKP    +DGVS A+    YP E+R R  +Y   L ++++      
Sbjct: 78  ISRKYEISFGKIYLAKPSMTESDGVSHAM----YPQEARLRNLTYASGLFVEIQKRTYQA 133

Query: 149 EENLFEVRD--------------------CGGLPVMLQSNRCHLNKMSPYELVQHKEESD 188
            +     RD                     G +P+ML+S  C L+ ++  +L + KE   
Sbjct: 134 ID--IPGRDLKYEIITEESEENEENNKIFIGRVPIMLRSKYCLLDDLTESDLYRLKECPF 191

Query: 189 EIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVRPDQT---S 245
           ++GGYFI+NG EK+   LI Q R+     I   F     S   +  +IRS     +   S
Sbjct: 192 DMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKSAPSPISHIAEIRSALEKGSRFIS 246

Query: 246 QTNVLHYLNDGQV--TFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDSFLT 303
              V  Y  +G    T + +    +  +P+V+I +AL    D EI + I   DV D  + 
Sbjct: 247 TLQVKLYGREGSTSRTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHIC-YDVNDWQML 305

Query: 304 DRLE-LLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLVHL 362
           + L+  +  GF      +Q+R   L ++G +   +      +  ++  +++L +  L H+
Sbjct: 306 EMLKPCVEEGFV-----IQDRETALDFIGRRGTAL--GIKKEKRIQYAKDILQKEFLPHI 358

Query: 363 GK-DGSQDKFRMLL-FMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEY 420
            + +G + +    L +MI +L          D+ D    + + L G L   + K      
Sbjct: 359 TQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFK------ 412

Query: 421 LQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQ 480
              +  ++  DI R M  + ++ +  +  L      I + ++Y L+TGN   Q    +  
Sbjct: 413 --TLFRKLTRDILRFMQRSVEEAKDFNLKLAVKATTITAGLKYALATGNWGEQKK-SMSS 469

Query: 481 VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG 540
            +G + V  +  +   +SH R  +        K    R+L    WG +CP  TP+G  CG
Sbjct: 470 RAGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACG 528

Query: 541 LLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFA-AGPSLCCVQIDGKIIGWVSHE 599
           L+ + +    IS   +D   I + L   G+ P         P    V ++G   G   H 
Sbjct: 529 LVKNLSLMSCISV-GTDPLPIITFLNEWGMEPLEDYIPHQSPDATRVFVNGVWHGI--HR 585

Query: 600 QGKIIADTLRYWKVEGK-TPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPV 653
               + DT+R  + +G  TP + I  +I         +   L +F    R+ RP+
Sbjct: 586 NPAKLVDTIRKLRRKGDITPEVSIVRDI---------REKELKIFTDAGRVYRPL 631

>YGL084C (GUP1) [1898] chr7 complement(350617..352299) Protein
           involved in active glycerol uptake, protein trafficking
           to the vacuole, maintenance of vacuolar morphology, and
           secretion [1683 bp, 560 aa]
          Length = 560

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 65/140 (46%), Gaps = 23/140 (16%)

Query: 367 SQDKFRMLLFMIRKLYSLVAG--ECSPDNPDATQHQEVLLGGFLYGMILKEKIDEYLQNI 424
           ++ KF  + F++       AG    SP+NP+  +++ +L  G+L+G     K+D    N 
Sbjct: 40  TEFKFYYIAFLVVVPLMFYAGLQASSPENPNYARYERLLSQGWLFG----RKVD----NS 91

Query: 425 IAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQVSGY 484
            +Q R          F+D   +  VLM V+ +I   + Y  ST   +++   DL     +
Sbjct: 92  DSQYRF---------FRDNFALLSVLMLVHTSIKRIVLY--STN--ITKLRFDLIFGLIF 138

Query: 485 TVVAEKINFYRFISHFRMVH 504
            V A  +N  R ++H  +++
Sbjct: 139 LVAAHGVNSIRILAHMLILY 158

>YML007W (YAP1) [3959] chr13 (253848..255800) Transcriptional
           activator of the basic leucine zipper (bZIP) family,
           possible redox sensor involved in oxidative stress
           response [1953 bp, 650 aa]
          Length = 650

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%)

Query: 295 NDVKDSFLTDRLELLLRGFKKRYPHLQNRTQVLQYLG 331
           N+V+ +FL D+L  L+   KK  P  +N ++VL+YL 
Sbjct: 106 NEVEATFLRDQLITLVNELKKYRPETRNDSKVLEYLA 142

>CAGL0E00847g <73766..79244 highly similar to sp|P11075
           Saccharomyces cerevisiae YDR170c component of
           non-clathrin vesicle coat, start by similarity
          Length = 1825

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 69/166 (41%), Gaps = 28/166 (16%)

Query: 813 LNRNRGDPITQHFGFGNDEWPK---EWLEKLDEDGLPYIGTYVEEGDPICAYFDDTLNKT 869
           L   R  P+    GF NDE P+   +WL + D   L  +G Y+ EGD           + 
Sbjct: 693 LKPKRAIPLLLQNGFINDESPESIAKWLLETDGLDLAMVGDYLGEGD-----------EK 741

Query: 870 KIKTYHSSEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQK----- 924
            I   H    A++++ +  G   +    L+    K+R+    Q  D+F  +  ++     
Sbjct: 742 NIAVMH----AFVDQFDFTG--QSIVDALRDFLQKFRLPGEGQKIDRFMLKFAERFVDQN 795

Query: 925 -GVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTIGMFVESLAG 969
            GV S+      + +S   +  D  ++     ++MT+  F+E+  G
Sbjct: 796 PGVFSKADTAYVLSYSLIMLNTD--LHSSQIKNKMTLQEFLENNEG 839

>CAGL0J07942g 772758..776492 similar to sp|P38717 Saccharomyces
           cerevisiae YNL257c SIP3 SNF1P or sp|P38851 Saccharomyces
           cerevisiae YHR155w, hypothetical start
          Length = 1244

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 45/106 (42%), Gaps = 10/106 (9%)

Query: 688 HVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTG 747
           ++EF  +    I   +T F D  +S    Y+C   +  + + G         K++  QT 
Sbjct: 444 YIEFASSTTTKIDQQITTFDDTTESLFQKYKCAFSEYEVLSVG-------SEKIFNFQTI 496

Query: 748 QTPIVKANLYDDYGMDNFPNG---FNAVVAVISYTGYDMDDAMIIN 790
            TPI        +  DN   G    NAVVA I  T Y  D ++I++
Sbjct: 497 ITPISTKMTNLAFLADNSVYGSYCTNAVVANIWGTTYWSDYSLILS 542

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.138    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 40,504,652
Number of extensions: 1878948
Number of successful extensions: 4184
Number of sequences better than 10.0: 27
Number of HSP's gapped: 4249
Number of HSP's successfully gapped: 40
Length of query: 1182
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1069
Effective length of database: 12,684,275
Effective search space: 13559489975
Effective search space used: 13559489975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)