Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPR009W (SUT2)26826413490.0
YGL162W (SUT1)2991433301e-36
CAGL0L09383g3662072964e-31
Sklu_1042.22981442891e-30
AEL298C3371382589e-26
CAGL0I04246g3572152474e-24
KLLA0A03091g3831432397e-23
Scas_710.104371542301e-21
Kwal_14.15243941972264e-21
CAGL0A00451g110739770.12
AGR369W1051151750.19
YGL013C (PDR1)106838730.30
Kwal_34.1575162822710.58
KLLA0A09119g108247700.76
YKL038W (RGT1)117043691.1
AER183C87920681.1
AFR096W85230681.2
CAGL0L03377g120924681.2
Sklu_2296.691924681.3
KLLA0F04609g91625681.4
Kwal_23.475481224681.5
AGL083W85620662.3
YLR256W (HAP1)150226653.1
Scas_702.7111326653.2
KLLA0F14322g71728653.3
Scas_556.6102242643.5
YOR363C (PIP2)99630643.7
Scas_573.4147842643.7
Scas_711.3193249643.8
AFR117C115224643.9
Kwal_26.744871449644.3
AER370W80124644.3
Scas_625.5114135644.4
YJL089W (SIP4)82918635.0
KLLA0F22990g125327635.7
KLLA0E18194g86542635.7
Scas_662.890621626.2
Sklu_1993.282321626.4
YIL130W96421627.3
KLLA0F25630g100721627.7
YDR034C (LYS14)79045618.4
KLLA0D05038g67341618.7
KLLA0C17050g95524618.8
Sklu_2376.692222619.5
KLLA0C03201g65035619.5
CAGL0G08844g84726619.6
YER184C79428619.7
CAGL0M03025g1254436110.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR009W
         (264 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR009W (SUT2) [5445] chr16 (576547..577353) Protein with simila...   524   0.0  
YGL162W (SUT1) [1827] chr7 (198142..199041) Protein that binds S...   131   1e-36
CAGL0L09383g 1018859..1019959 some similarities with sp|P53032 S...   118   4e-31
Sklu_1042.2 YGL162W, Contig c1042 1296-2192 reverse complement        115   1e-30
AEL298C [2207] [Homologous to ScYPR009W (SUT2) - SH; ScYGL162W (...   103   9e-26
CAGL0I04246g 377568..378641 weakly similar to sp|P53032 Saccharo...   100   4e-24
KLLA0A03091g 276333..277484 some similarities with sgd|S0006213 ...    97   7e-23
Scas_710.10                                                            93   1e-21
Kwal_14.1524                                                           92   4e-21
CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces cer...    34   0.12 
AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH] complement(...    33   0.19 
YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finge...    33   0.30 
Kwal_34.15751                                                          32   0.58 
KLLA0A09119g complement(797533..800781) weakly similar to sp|P12...    32   0.76 
YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in...    31   1.1  
AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH] (975879..9...    31   1.1  
AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH] complement(...    31   1.2  
CAGL0L03377g complement(382932..386561) some similarities with s...    31   1.2  
Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement       31   1.3  
KLLA0F04609g complement(451579..454329) similar to sp|P40467 Sac...    31   1.4  
Kwal_23.4754                                                           31   1.5  
AGL083W [4228] [Homologous to ScYKL038W (RGT1) - SH; ScYBR033W (...    30   2.3  
YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription facto...    30   3.1  
Scas_702.7                                                             30   3.2  
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    30   3.3  
Scas_556.6                                                             29   3.5  
YOR363C (PIP2) [5140] chr15 complement(1020218..1023208) Transcr...    29   3.7  
Scas_573.4                                                             29   3.7  
Scas_711.31                                                            29   3.8  
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    29   3.9  
Kwal_26.7448                                                           29   4.3  
AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH] complement(...    29   4.3  
Scas_625.5                                                             29   4.4  
YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional act...    29   5.0  
KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces...    29   5.7  
KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces...    29   5.7  
Scas_662.8                                                             28   6.2  
Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement         28   6.4  
YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that cont...    28   7.3  
KLLA0F25630g 2378464..2381487 some similarities with sp|P32862 S...    28   7.7  
YDR034C (LYS14) [885] chr4 complement(509732..512104) Transcript...    28   8.4  
KLLA0D05038g 433653..435674 weakly similar to sp|P40971 Saccharo...    28   8.7  
KLLA0C17050g 1490472..1493339 some similarities with ca|CA3454|I...    28   8.8  
Sklu_2376.6 , Contig c2376 12573-15341 reverse complement              28   9.5  
KLLA0C03201g complement(286973..288925) similar to sp|P39529 Sac...    28   9.5  
CAGL0G08844g complement(846590..849133) similar to sp|P40467 Sac...    28   9.6  
YER184C (YER184C) [1612] chr5 complement(556291..558675) Protein...    28   9.7  
CAGL0M03025g complement(341849..345613) similar to sp|P39113 Sac...    28   10.0 

>YPR009W (SUT2) [5445] chr16 (576547..577353) Protein with
           similarity to Sut1p, involved in sterol uptake [807 bp,
           268 aa]
          Length = 268

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/264 (96%), Positives = 255/264 (96%)

Query: 1   MKPNNRTCDVITNKDESXXXXXXXXXNSYTCDDSLLKGQISSNGRYQPFGFSDCSLLPKR 60
           MKPNNRTCDVITNKDES         NSYTCDDSLLKGQISSNGRYQPFGFSDCSLLPKR
Sbjct: 1   MKPNNRTCDVITNKDESLPALLLPALNSYTCDDSLLKGQISSNGRYQPFGFSDCSLLPKR 60

Query: 61  LNIQAGQGSMPVSSIQCADHSYSNWQKESEKTKLPKLGCPTEYTEYYKTVSSGETTDSAV 120
           LNIQAGQGSMPVSSIQCADHSYSNWQKESEKTKLPKLGCPTEYTEYYKTVSSGETTDSAV
Sbjct: 61  LNIQAGQGSMPVSSIQCADHSYSNWQKESEKTKLPKLGCPTEYTEYYKTVSSGETTDSAV 120

Query: 121 VSSIATNRLKRKRQRDGPSCDSCRIKKIKCNATIIIFLQDRNLISSISSNLHYTLSQDDI 180
           VSSIATNRLKRKRQRDGPSCDSCRIKKIKCNATIIIFLQDRNLISSISSNLHYTLSQDDI
Sbjct: 121 VSSIATNRLKRKRQRDGPSCDSCRIKKIKCNATIIIFLQDRNLISSISSNLHYTLSQDDI 180

Query: 181 NQFRMKFFRKLPDVMGTYEVIKHLDKIVLFKACTSCSRRNQKNGKCLFSRGFTKSDMNVF 240
           NQFRMKFFRKLPDVMGTYEVIKHLDKIVLFKACTSCSRRNQKNGKCLFSRGFTKSDMNVF
Sbjct: 181 NQFRMKFFRKLPDVMGTYEVIKHLDKIVLFKACTSCSRRNQKNGKCLFSRGFTKSDMNVF 240

Query: 241 PKINSKLKDKSIFEMTVDDYVAAG 264
           PKINSKLKDKSIFEMTVDDYVAAG
Sbjct: 241 PKINSKLKDKSIFEMTVDDYVAAG 264

>YGL162W (SUT1) [1827] chr7 (198142..199041) Protein that binds
           Ssn6p and counteracts Ssn6p-Tup1p-mediated
           transcriptional repression, involved in sterol uptake
           [900 bp, 299 aa]
          Length = 299

 Score =  131 bits (330), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 67/143 (46%), Positives = 92/143 (64%), Gaps = 14/143 (9%)

Query: 132 KRQRDGPSCDSCRIKKIKCNATIIIFLQDRNLISSISSNLHYTLSQDDINQFRMKFFR-- 189
           KRQR GPSCD CR+KKIKCNA I I LQD  ++  IS+ L Y L+ DDI  +R    R  
Sbjct: 152 KRQRSGPSCDKCRLKKIKCNAKIEILLQDDTIMPMISNKLRYVLTPDDIRLYRGTLLRNI 211

Query: 190 KLPDVM----GTYEVIKHLDKIVLFKACTSCSRRNQ--------KNGKCLFSRGFTKSDM 237
            +PD +    G+ ++IKH+DK+VL   C  C ++          KN KC FS+GFT++D+
Sbjct: 212 AIPDDVIEGTGSRKLIKHIDKLVLLTPCLPCIKKKHSSSSTNFPKNDKCTFSKGFTRADI 271

Query: 238 NVFPKINSKLKDKSIFEMTVDDY 260
           N+  KI+ K KDK+I+++T DDY
Sbjct: 272 NISSKISLKFKDKTIYDITYDDY 294

>CAGL0L09383g 1018859..1019959 some similarities with sp|P53032
           Saccharomyces cerevisiae YGL162w SUT1 or tr|Q12286
           Saccharomyces cerevisiae YPR009w, hypothetical start
          Length = 366

 Score =  118 bits (296), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 110/207 (53%), Gaps = 32/207 (15%)

Query: 84  NWQKESEKTKLPKLGC-----------PTEYTEYYKTVSSGETTDSAVVSSIATNRLKRK 132
           N     +K   PKLG             + +   + T++S   + S +V++ A      K
Sbjct: 165 NLASPKQKLPSPKLGVIQKPISVPPKKSSPFVSAFNTMASNIKSTSDLVANNAG-----K 219

Query: 133 RQRDGPSCDSCRIKKIKCNATIIIFLQDRNLISSISSNLHYTLSQDDIN-QFRMKFFRKL 191
           RQR GPSCD CR KKIKC+A I I  QD  ++     +LH+ L++ +I  Q   + + + 
Sbjct: 220 RQRIGPSCDKCRSKKIKCDAKIDILCQDEAVLHMFGQSLHHELTKHEIETQLGQEVYSQS 279

Query: 192 P-------DVMGTYE-------VIKHLDKIVLFKACTSCSRRNQKNGKCLFSRGFTKSDM 237
                   D+M   E       +IKHLDKI+ F+ CTSCSR+ +    C FS+GFT++D+
Sbjct: 280 STFAYISKDLMSKIESREPDAKIIKHLDKIIYFQPCTSCSRK-KNTAVCAFSKGFTRADI 338

Query: 238 NVFPKINSKLKDKSIFEMTVDDYVAAG 264
           N+F KI S++  K I+EMT  +Y  AG
Sbjct: 339 NIFSKIGSRVAQKPIYEMTYKEYKKAG 365

>Sklu_1042.2 YGL162W, Contig c1042 1296-2192 reverse complement
          Length = 298

 Score =  115 bits (289), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 60/144 (41%), Positives = 88/144 (61%), Gaps = 11/144 (7%)

Query: 130 KRKRQRDGPSCDSCRIKKIKCNATIIIFLQDRNLISSISSNLHYTLSQDDINQFRMKFFR 189
           K KRQR GPSCD CR++KIKC+ATI I  Q  +L+SSIS +LH  LS  D+         
Sbjct: 156 KSKRQRVGPSCDVCRVRKIKCDATIRIVHQAESLVSSISDSLHAVLSAQDLELLPKYLAD 215

Query: 190 KLP--------DVMGTYEVIKHLDKIVLFKACTSCSRRNQKNGKCLFSRGFTKSDMNVFP 241
           ++P        D     +++KH+DK+V+FK C SC +++  N  C FS+G T++D+N+F 
Sbjct: 216 RVPLDLLLQVKDPADKTQLVKHVDKLVVFKPCRSCHKKH--NAACQFSKGLTRADINIFN 273

Query: 242 KINSKL-KDKSIFEMTVDDYVAAG 264
           ++  K  K  ++ + T  DY AAG
Sbjct: 274 RLEKKTGKRAALKDYTYHDYRAAG 297

>AEL298C [2207] [Homologous to ScYPR009W (SUT2) - SH; ScYGL162W
           (SUT1) - SH] (81182..82195) [1014 bp, 337 aa]
          Length = 337

 Score =  103 bits (258), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 87/138 (63%), Gaps = 12/138 (8%)

Query: 130 KRKRQRDGPSCDSCRIKKIKCNATIIIFLQDRNLISSISSNLHYTLSQDDINQFRMKFFR 189
           K KRQR GPSCD CR KKIKC+ATI I  QD ++  S +  LH  +   ++++   ++  
Sbjct: 198 KYKRQRTGPSCDICRSKKIKCDATITILFQDASVTGSFNEMLHAPV---NVSELANEWLS 254

Query: 190 KLPDVM------GTYEVIKHLDKIVLFKACTSCSRRNQKNGKCLFSRGFTKSDMNVFPKI 243
           ++PD +          ++KH+DK++ FK CTSCS+R  KN  C FS+GFT++D+NV+  +
Sbjct: 255 QIPDEVRQALLTKELTLLKHVDKLIAFKPCTSCSKR--KNCFCTFSKGFTRADINVYTNL 312

Query: 244 NSKL-KDKSIFEMTVDDY 260
             K  K  SI + +++DY
Sbjct: 313 CVKFGKRSSIDQFSLNDY 330

>CAGL0I04246g 377568..378641 weakly similar to sp|P53032
           Saccharomyces cerevisiae YGL162w SUT1 hypoxic protein
           involved in sterol uptake, start by similarity
          Length = 357

 Score = 99.8 bits (247), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 99/215 (46%), Gaps = 65/215 (30%)

Query: 108 KTVSSGETTDSAVVSSIATNRLKRKRQRDGPSCDSCRIKKIKCNATIIIFLQDRNLISSI 167
           K  S G   ++A    IA      KRQR GPSCD CR+KKIKCNAT  I +QD +++S  
Sbjct: 147 KNNSRGRGKNNAAAHHIA------KRQRVGPSCDKCRVKKIKCNATSNILVQDLDIVSLF 200

Query: 168 SSNLHYTLSQDDI-------NQF-RMKFFRKLPDVMGTYE------------VIKHLDKI 207
           S+ LHY  S ++I       NQ+ R K     P +    E            ++KH+DK+
Sbjct: 201 STKLHYEFSPEEILNENSEVNQYMRRKHIIDAPSIQNLKECIRKNQNPQNKTLVKHIDKL 260

Query: 208 VLFKACTSCS-----------------RRNQKNGK----------CLFSRGFTKSDMNVF 240
           ++F+ C SC                  R+N K  K          C FS+GFT+SD++++
Sbjct: 261 IIFQPCDSCQKKKNNLLITANSTPIEIRQNPKFQKTHELLISHCNCTFSKGFTRSDISIY 320

Query: 241 PKINSKLK------------DKSIFEMTVDDYVAA 263
            KI    K              SI+ MT  DY AA
Sbjct: 321 TKITYHQKKGKSIGFMHEDAGSSIYNMTTADYFAA 355

>KLLA0A03091g 276333..277484 some similarities with sgd|S0006213
           Saccharomyces cerevisiae YPR009w, hypothetical start
          Length = 383

 Score = 96.7 bits (239), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 86/143 (60%), Gaps = 15/143 (10%)

Query: 132 KRQRDGPSCDSCRIKKIKCNATIIIFLQDRNLISSISSN--LHYTLSQDDINQFRMKFFR 189
           KRQR GPSCD CR KKIKC+AT+++  QD +L+ +   +  LH  LS   I+  R     
Sbjct: 242 KRQRTGPSCDVCRSKKIKCDATVLVISQDPSLLFNCKEDESLHCPLS---IDTCRPDILM 298

Query: 190 KLPDVM-------GTYEVIKHLDKIVLFKACTSCSRRNQKNGKCLFSRGFTKSDMNVFPK 242
           K+P  +           +++H+DK++ F +C+SC ++  K+  C FS+GFT++D+ VF  
Sbjct: 299 KIPTEVRKQLAERKDMSLVRHVDKLIAFSSCSSCQKK--KDRDCSFSKGFTRNDIAVFST 356

Query: 243 INSKL-KDKSIFEMTVDDYVAAG 264
           +N KL K  S+ + TV DY+  G
Sbjct: 357 LNKKLGKRNSLGDFTVKDYLNVG 379

>Scas_710.10
          Length = 437

 Score = 93.2 bits (230), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 84/154 (54%), Gaps = 26/154 (16%)

Query: 130 KRKRQRDGPSCDSCRIKKIKCNATIIIFLQDRNLISSISSNLHYTLSQDDINQFRMKFFR 189
           ++KRQR GPSCD CR KKIKC++ I + L+  ++++ IS+ +HY  + D+I   +    +
Sbjct: 281 EKKRQRVGPSCDHCRFKKIKCDSQIKVVLESNHILNLISNKIHYVFNADEIELLKTTLLK 340

Query: 190 K--LPDVMG--------------TYEV-IKHLDKIVLFKACTSCSRRNQKNGKCLFSRGF 232
              LP+ +                Y + +KH DKI+LF  CTSC +  Q    CLFS GF
Sbjct: 341 NTTLPEKLANTTTINKRNIAEGSVYPILLKHFDKIILFSPCTSCDKNEQ---DCLFSMGF 397

Query: 233 TKSDMNVFPKINSKLK------DKSIFEMTVDDY 260
           T+SD+     I   L        K+IF++T+ DY
Sbjct: 398 TRSDIATCKMILKNLPNNNDNIKKNIFDLTIMDY 431

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 54/108 (50%), Gaps = 15/108 (13%)

Query: 125 ATNRLKRKRQRDGPSCDSCRIKKIKCNATIIIFLQDRNLISSI-SSNLHYTLSQDDINQF 183
           +T++    R+R+  SCD CR +KIKC++   I      LI  +    + + L++ +I++ 
Sbjct: 125 STSKAPPIRKRNSSSCDYCRQRKIKCDSNFNIIRTSNQLIGPMFPDEIFHILTKKEIDEL 184

Query: 184 R--MKFFRKLPDVMGTYE------------VIKHLDKIVLFKACTSCS 217
           +  M    +LP  +  Y+            + K+ + ++LF  CT+CS
Sbjct: 185 QQVMVPPLELPSTLFNYQWNWEANPEGNPILFKNKNDLILFTPCTNCS 232

>Kwal_14.1524
          Length = 394

 Score = 91.7 bits (226), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 93/197 (47%), Gaps = 65/197 (32%)

Query: 132 KRQRDGPSCDSCRIKKIKCNATIIIFLQDRNLISSISSN----LHYTLSQDDIN-QFRMK 186
           KRQR GPSCDSCR+KKIKC+A++ +  QD  L+ + S N    LH T++  ++       
Sbjct: 198 KRQRIGPSCDSCRLKKIKCDASVSVLHQDEALV-AFSGNKNESLHATMTYSELKAALPSH 256

Query: 187 FFRKLPD-VMGTY--------EVIKHLDKIVLFKACTSCSRRNQK---NGK--------- 225
            ++ LP  V+           EV++H+DK+V F+AC SC+RRN     +GK         
Sbjct: 257 VWKNLPARVLEALESQDSRAGEVVRHVDKVVFFRACASCARRNASGSGSGKESDGESGTS 316

Query: 226 -------------------------------------CLFSRGFTKSDMNVFPKINSKLK 248
                                                C FS+GFT+SD+NVF ++  +L 
Sbjct: 317 APATPAGPTGSVRAAAGVAAAAAGTTATPAAALGPACCTFSKGFTRSDINVFTRLQKQLG 376

Query: 249 DKS-IFEMTVDDYVAAG 264
            +  + + TV +Y + G
Sbjct: 377 PRGQLADFTVAEYRSIG 393

>CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces
           cerevisiae YGL013c PDR1 transcription factor,
           hypothetical start
          Length = 1107

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 114 ETTDSAVVSSIATNRLKRKRQRDGPSCDSCRIKKIKCNA 152
           ETT  +    +   +   +R + G +CDSCR +KIKCN 
Sbjct: 5   ETTSKSNPGEVKAQKPSTRRTKVGKACDSCRRRKIKCNG 43

>AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH]
           complement(1412347..1415502) [3156 bp, 1051 aa]
          Length = 1051

 Score = 33.5 bits (75), Expect = 0.19,   Method: Composition-based stats.
 Identities = 40/151 (26%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 89  SEKTKLPKLGCPTEYTEYYKTVSSGETTDSAVVS------SIATNRLKRKRQRDGPS--- 139
           S+  ++ K    T   +  K + S E+  S +VS        + +R K  +Q++G S   
Sbjct: 28  SDSAQMKKRNTETAGMKARKKLRSEESGLSTLVSIASFGGQASPDRSKVSKQQNGASGHR 87

Query: 140 ----CDSCRIKKIKCNATIIIFLQDRNLISSISSNLHYTLSQDDINQFRMKFFRKLPDVM 195
               C  CR  KIKCNA+        N  SS S      L  +   QFR K   +L ++ 
Sbjct: 88  PVTSCTHCRQHKIKCNAS-------ENFPSSCSRCERMGLQCEIDPQFRPKKGSQLQNLK 140

Query: 196 GTYEVIK-HLDKIVLFKACTSCSRRNQKNGK 225
              E +K  L+ ++  +   S + RN   G+
Sbjct: 141 NEIEELKTKLEFLLRSEGILSSAMRNSDLGR 171

>YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finger
           transcription factor, in conjunction with Pdr3p
           regulates the expression of a network of genes involved
           in multiple drug resistance [3207 bp, 1068 aa]
          Length = 1068

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 25/38 (65%)

Query: 115 TTDSAVVSSIATNRLKRKRQRDGPSCDSCRIKKIKCNA 152
           + DS+  S+  + ++++ R +   +CD+CR +KIKCN 
Sbjct: 21  SADSSNFSTGFSGKIRKPRSKVSKACDNCRKRKIKCNG 58

>Kwal_34.15751
          Length = 628

 Score = 32.0 bits (71), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 16/22 (72%)

Query: 130 KRKRQRDGPSCDSCRIKKIKCN 151
           K K+ R    CD+CRI+K+KCN
Sbjct: 5   KSKKNRISHVCDACRIRKLKCN 26

>KLLA0A09119g complement(797533..800781) weakly similar to sp|P12383
           Saccharomyces cerevisiae YGL013c PDR1 transcription
           factor, start by similarity
          Length = 1082

 Score = 31.6 bits (70), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 109 TVSSGETTD-SAVVSSIATNRLKRKRQRDGPSCDSCRIKKIKCNATI 154
           + SSG   D +A+      N   + R++   +CDSCR KKIKC+ T+
Sbjct: 23  SASSGVNGDRTAIPRDSNGNGTGKPRRKVSRACDSCRKKKIKCSGTL 69

>YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in
           regulation of glucose transporters, acts as a
           transcriptional repressor that is converted to an
           activator upon glucose-induced phosphorylation [3513 bp,
           1170 aa]
          Length = 1170

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 4/43 (9%)

Query: 109 TVSSGETTDSAVVSSIATNRLKRKRQRDGPSCDSCRIKKIKCN 151
           T +S +  DSA  +S A     +KR +   +CD CR KKIKC+
Sbjct: 20  TSNSPDDMDSAAAASHAI----KKRTKASRACDQCRKKKIKCD 58

>AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH]
           (975879..978518) [2640 bp, 879 aa]
          Length = 879

 Score = 30.8 bits (68), Expect = 1.1,   Method: Composition-based stats.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 133 RQRDGPSCDSCRIKKIKCNA 152
           R+R   +CD CR KKI+CN 
Sbjct: 74  RKRVSKACDICRAKKIRCNG 93

>AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH]
           complement(606993..609551) [2559 bp, 852 aa]
          Length = 852

 Score = 30.8 bits (68), Expect = 1.2,   Method: Composition-based stats.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 4/30 (13%)

Query: 123 SIATNRLKRKRQRDGPSCDSCRIKKIKCNA 152
           +I  + +KR  Q    +CD CR+KKIKC+ 
Sbjct: 16  TIELSNMKRSSQ----ACDRCRLKKIKCDG 41

>CAGL0L03377g complement(382932..386561) some similarities with
           sp|P46954 Saccharomyces cerevisiae YJL089w SIP4
           interacts with SNF1 protein kinase, hypothetical start
          Length = 1209

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (66%)

Query: 129 LKRKRQRDGPSCDSCRIKKIKCNA 152
           L R ++R   +CD CR KKIKC+ 
Sbjct: 18  LTRTKKRHSQACDRCRSKKIKCDG 41

>Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement
          Length = 919

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 17/24 (70%)

Query: 129 LKRKRQRDGPSCDSCRIKKIKCNA 152
           L  +++R   +CD CR+KKIKC+ 
Sbjct: 18  LLSRQERSSQACDRCRLKKIKCDG 41

>KLLA0F04609g complement(451579..454329) similar to sp|P40467
           Saccharomyces cerevisiae YIL130w, start by similarity
          Length = 916

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 128 RLKRKRQRDGPSCDSCRIKKIKCNA 152
            L+ KR+R   +CD CR KK+KC+ 
Sbjct: 2   ELQNKRRRVTRACDECRKKKVKCDG 26

>Kwal_23.4754
          Length = 812

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 129 LKRKRQRDGPSCDSCRIKKIKCNA 152
           L+ KR+R   +CD CR KK+KC+ 
Sbjct: 4   LQNKRRRVTRACDECRKKKVKCDG 27

>AGL083W [4228] [Homologous to ScYKL038W (RGT1) - SH; ScYBR033W
           (EDS1) - NSH] complement(550291..552861) [2571 bp, 856
           aa]
          Length = 856

 Score = 30.0 bits (66), Expect = 2.3,   Method: Composition-based stats.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 131 RKRQRDGPSCDSCRIKKIKC 150
           R+R +   +CD CR KKIKC
Sbjct: 37  RRRTKVSRACDQCRRKKIKC 56

>YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription factor
           with heme-dependent DNA-binding activity, responsible
           for heme-dependent activation of many genes [4509 bp,
           1502 aa]
          Length = 1502

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%)

Query: 126 TNRLKRKRQRDGPSCDSCRIKKIKCN 151
           ++++KRKR R   SC  CR +K+KC+
Sbjct: 50  SSKIKRKRNRIPLSCTICRKRKVKCD 75

>Scas_702.7
          Length = 1113

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 18/26 (69%)

Query: 128 RLKRKRQRDGPSCDSCRIKKIKCNAT 153
           ++KR R++   +C +CR +KIKC  T
Sbjct: 25  KIKRPRKKVSKACANCRRRKIKCTGT 50

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
           Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 4/28 (14%)

Query: 125 ATNRLKRKRQRDGPSCDSCRIKKIKCNA 152
           A+ ++KR  Q    +CD CR+KKIKC+ 
Sbjct: 52  ASTKVKRFSQ----ACDRCRLKKIKCDG 75

>Scas_556.6
          Length = 1022

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 2/42 (4%)

Query: 110 VSSGETTDSAVVSSIATNRLKRKRQRDGPSCDSCRIKKIKCN 151
           VSSG +T S       +NR  +KR R    C  CR  K KC+
Sbjct: 18  VSSGNSTSSPAAG--GSNRQIKKRNRISFVCQECRKAKTKCD 57

>YOR363C (PIP2) [5140] chr15 complement(1020218..1023208)
           Transcription factor required for induction of
           peroxisomal proteins in response to oleic acid [2991 bp,
           996 aa]
          Length = 996

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 122 SSIATNRLKRKRQRDGPSCDSCRIKKIKCN 151
           SS A NR+ +KR R    C +CR  K KC+
Sbjct: 7   SSPAMNRVGKKRNRLSFVCQACRKAKTKCD 36

>Scas_573.4
          Length = 1478

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 110 VSSGETTDSAVVSSIATNRLKRKRQRDGPSCDSCRIKKIKCN 151
           +S+ +++  A  +  +T ++KRKR R   SC  CR +K+KC+
Sbjct: 14  LSATDSSSHANANGTST-KVKRKRNRVPLSCTICRKRKVKCD 54

>Scas_711.31
          Length = 932

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 13/49 (26%)

Query: 116 TDSAVVSSIATNRLKRKRQRDGP-------------SCDSCRIKKIKCN 151
           T   V S    N L++KR+  G              +CD CR+KKIKC+
Sbjct: 8   TRELVDSEPNANNLQKKRKNSGQVFVQDSIFIKRKQACDRCRLKKIKCD 56

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
           (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (66%)

Query: 130 KRKRQRDGPSCDSCRIKKIKCNAT 153
           KRKR R   SC  CR +K+KC+ T
Sbjct: 9   KRKRNRVPLSCTICRKRKVKCDKT 32

>Kwal_26.7448
          Length = 714

 Score = 29.3 bits (64), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 107 YKTVSSGETTDSAVVSSIATNRLKRKRQRDGP-SCDSCRIKKIKCNATI 154
           Y+++S  + +    V  +   R+ R+R R+    CD C+ ++IKC+ T+
Sbjct: 63  YESLSFDDVSPRETV--VLKKRITRRRHRNSRLGCDECKRRRIKCDETL 109

>AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH]
           complement(1320487..1322892) [2406 bp, 801 aa]
          Length = 801

 Score = 29.3 bits (64), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 129 LKRKRQRDGPSCDSCRIKKIKCNA 152
           L  KR+R   +CD CR KK+KC++
Sbjct: 7   LGLKRRRVTRACDECRKKKVKCDS 30

>Scas_625.5
          Length = 1141

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 118 SAVVSSIATNRL-KRKRQRDGPSCDSCRIKKIKCN 151
           SA  ++ A+N   ++KR +   +CD CR KKIKC+
Sbjct: 52  SAAGTNAASNSSSQKKRTKASRACDQCRKKKIKCD 86

>YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional
           activator of gluconeogenic genes through CSRE elements,
           activated by Snf1p kinase, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2490 bp, 829 aa]
          Length = 829

 Score = 28.9 bits (63), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 10/18 (55%), Positives = 13/18 (72%)

Query: 135 RDGPSCDSCRIKKIKCNA 152
           R   +CD CR+KKIKC+ 
Sbjct: 41  RKAHACDRCRLKKIKCDG 58

>KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces
           cerevisiae YLR256w HAP1 transcription factor singleton,
           hypothetical start
          Length = 1253

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 125 ATNRLKRKRQRDGPSCDSCRIKKIKCN 151
            T + KRKR R   SC  CR +K+KC+
Sbjct: 10  GTPQQKRKRNRVPLSCTICRKRKVKCD 36

>KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces
           cerevisiae YKL015w PUT3 positive activator of the
           proline utilisation pathway, start by similarity
          Length = 865

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 109 TVSSGETTDSAVVSSIATNRLKRKRQRDGPSCDSCRIKKIKC 150
           +V SG+  D  +V  +  N  K+K +R   +C  CR + IKC
Sbjct: 17  SVYSGDEKDEVIVELL--NDKKKKVKRSSLACTRCRRRHIKC 56

>Scas_662.8
          Length = 906

 Score = 28.5 bits (62), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%)

Query: 132 KRQRDGPSCDSCRIKKIKCNA 152
           KR+R   +CD CR KK+KC+ 
Sbjct: 29  KRRRVTRACDECRKKKVKCDG 49

>Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement
          Length = 823

 Score = 28.5 bits (62), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%)

Query: 132 KRQRDGPSCDSCRIKKIKCNA 152
           KR+R   +CD CR KK+KC+ 
Sbjct: 7   KRRRVTRACDECRKKKVKCDG 27

>YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region, putative transcription
           factor [2895 bp, 964 aa]
          Length = 964

 Score = 28.5 bits (62), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%)

Query: 132 KRQRDGPSCDSCRIKKIKCNA 152
           KR+R   +CD CR KK+KC+ 
Sbjct: 13  KRRRVTRACDECRKKKVKCDG 33

>KLLA0F25630g 2378464..2381487 some similarities with sp|P32862
           Saccharomyces cerevisiae YKL038w RGT1 regulator of
           glucose-induced genes, hypothetical start
          Length = 1007

 Score = 28.5 bits (62), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%)

Query: 131 RKRQRDGPSCDSCRIKKIKCN 151
           R+R +   +CD CR KKIKC+
Sbjct: 108 RRRSKVSRACDQCRKKKIKCD 128

>YDR034C (LYS14) [885] chr4 complement(509732..512104)
           Transcriptional activator of lysine pathway genes with
           2-aminoadipate semialdehyde as coinducer [2373 bp, 790
           aa]
          Length = 790

 Score = 28.1 bits (61), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 5/45 (11%)

Query: 112 SGETTDSAVVSSIAT---NRLKRKRQRDGPSCDSCRIKKIKCNAT 153
           S  T + AV S++     N +KRK  R+G  C  C+ +++KC+ T
Sbjct: 130 SSLTPNPAVTSTVTDKKGNTVKRKYSRNG--CSECKRRRMKCDET 172

>KLLA0D05038g 433653..435674 weakly similar to sp|P40971
           Saccharomyces cerevisiae YDR034c LYS14 transcriptional
           activator of lysine pathway genes singleton, start by
           similarity
          Length = 673

 Score = 28.1 bits (61), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 113 GETTDSAVVSSIATNRLKRKRQRDGPSCDSCRIKKIKCNAT 153
            +TT    VS++ T   K+KR+     C  C+ KK+KC+ T
Sbjct: 2   ADTTPDTAVSNV-TEPAKKKRKYSKNGCLECKRKKVKCDET 41

>KLLA0C17050g 1490472..1493339 some similarities with
           ca|CA3454|IPF10533.exon1 Candida albicans unknown
           function, exon 1, hypothetical start
          Length = 955

 Score = 28.1 bits (61), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 17/24 (70%)

Query: 128 RLKRKRQRDGPSCDSCRIKKIKCN 151
           +++ KRQR   SC +C  +KIKC+
Sbjct: 34  KIQHKRQRQILSCVACHKRKIKCD 57

>Sklu_2376.6 , Contig c2376 12573-15341 reverse complement
          Length = 922

 Score = 28.1 bits (61), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 16/22 (72%)

Query: 130 KRKRQRDGPSCDSCRIKKIKCN 151
           K+KRQR    C +C+ +KIKC+
Sbjct: 18  KKKRQRTTVVCTNCKKRKIKCD 39

>KLLA0C03201g complement(286973..288925) similar to sp|P39529
           Saccharomyces cerevisiae YJL206c, start by similarity
          Length = 650

 Score = 28.1 bits (61), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 10/35 (28%), Positives = 22/35 (62%)

Query: 118 SAVVSSIATNRLKRKRQRDGPSCDSCRIKKIKCNA 152
           S + +  +TN+L+  R +   +C SC+ +K++C+ 
Sbjct: 14  SVLATEPSTNQLEPVRHKVKHACSSCKERKVRCDG 48

>CAGL0G08844g complement(846590..849133) similar to sp|P40467
           Saccharomyces cerevisiae YIL130w, hypothetical start
          Length = 847

 Score = 28.1 bits (61), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 18/26 (69%)

Query: 127 NRLKRKRQRDGPSCDSCRIKKIKCNA 152
           +R + KR++   +CD CR KK+KC+ 
Sbjct: 7   HRQEGKRRKVTRACDDCRKKKVKCDG 32

>YER184C (YER184C) [1612] chr5 complement(556291..558675) Protein
           with similarity to transcription factors, has
           Zn[2]-Cys[6] fungal-type binuclear cluster domain in the
           N-terminal region [2385 bp, 794 aa]
          Length = 794

 Score = 28.1 bits (61), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 125 ATNRLKRKRQRDGPSCDSCRIKKIKCNA 152
           A   L +++ R   +CD C  KKIKCN+
Sbjct: 3   AKRGLAKQKSRVTKACDRCHRKKIKCNS 30

>CAGL0M03025g complement(341849..345613) similar to sp|P39113
           Saccharomyces cerevisiae YMR280c CAT8 transcription
           factor involved in gluconeogenesis, hypothetical start
          Length = 1254

 Score = 28.1 bits (61), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 21/43 (48%)

Query: 112 SGETTDSAVVSSIATNRLKRKRQRDGPSCDSCRIKKIKCNATI 154
           +G    ++V  S   +R      R   +CD CR+KK KC+  I
Sbjct: 32  AGPANGNSVSGSNTGSRGSTPTYRVAQACDRCRLKKTKCDGKI 74

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.131    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,702,288
Number of extensions: 364406
Number of successful extensions: 1250
Number of sequences better than 10.0: 71
Number of HSP's gapped: 1233
Number of HSP's successfully gapped: 73
Length of query: 264
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 164
Effective length of database: 13,134,309
Effective search space: 2154026676
Effective search space used: 2154026676
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)