Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPR005C (HAL1)29429015360.0
Scas_576.8d357751355e-09
AGL056W39652820.025
CAGL0L09251g28282730.31
ACL160C68458730.37
KLLA0B10263g107966720.53
KLLA0E13992g45386681.3
Scas_528.1197103671.4
YLR049C428113653.4
Scas_709.1856261627.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR005C
         (290 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR005C (HAL1) [5441] chr16 complement(565782..566666) Protein i...   596   0.0  
Scas_576.8d                                                            57   5e-09
AGL056W [4255] [Homologous to ScYPR005C - SH] complement(605224....    36   0.025
CAGL0L09251g complement(1001979..1002827) no similarity, hypothe...    33   0.31 
ACL160C [889] [Homologous to ScYLR207W (HRD3) - SH] (75271..7732...    33   0.37 
KLLA0B10263g 896677..899916 similar to sp|Q04336 Saccharomyces c...    32   0.53 
KLLA0E13992g 1236690..1238051 no similarity, hypothetical start        31   1.3  
Scas_528.1                                                             30   1.4  
YLR049C (YLR049C) [3466] chr12 complement(243887..245173) Protei...    30   3.4  
Scas_709.18                                                            28   7.9  

>YPR005C (HAL1) [5441] chr16 complement(565782..566666) Protein
           involved in ion homeostasis [885 bp, 294 aa]
          Length = 294

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/290 (100%), Positives = 290/290 (100%)

Query: 1   MHFKDLGLHDYTLKNLMYENNCCKFYDAVDENNISYVLKFVPSDVTSEGDTFPFVDRFQV 60
           MHFKDLGLHDYTLKNLMYENNCCKFYDAVDENNISYVLKFVPSDVTSEGDTFPFVDRFQV
Sbjct: 1   MHFKDLGLHDYTLKNLMYENNCCKFYDAVDENNISYVLKFVPSDVTSEGDTFPFVDRFQV 60

Query: 61  KEGVFLVYSSNDFGKEGTDYFTYTGSGGNEVHISGTSSEAGIKPQFIETCHPKHLKRGTK 120
           KEGVFLVYSSNDFGKEGTDYFTYTGSGGNEVHISGTSSEAGIKPQFIETCHPKHLKRGTK
Sbjct: 61  KEGVFLVYSSNDFGKEGTDYFTYTGSGGNEVHISGTSSEAGIKPQFIETCHPKHLKRGTK 120

Query: 121 EQEDINSSTSKKSAVINNFSGEKTPNPRPQSSNISERETYVGILNVKCKNKNSSKIRSEK 180
           EQEDINSSTSKKSAVINNFSGEKTPNPRPQSSNISERETYVGILNVKCKNKNSSKIRSEK
Sbjct: 121 EQEDINSSTSKKSAVINNFSGEKTPNPRPQSSNISERETYVGILNVKCKNKNSSKIRSEK 180

Query: 181 LVSSVIETKHTPGLASILSKEGTTYPNNADGKHISIVNPSSKIYHSSHKQIVKTPIPKSG 240
           LVSSVIETKHTPGLASILSKEGTTYPNNADGKHISIVNPSSKIYHSSHKQIVKTPIPKSG
Sbjct: 181 LVSSVIETKHTPGLASILSKEGTTYPNNADGKHISIVNPSSKIYHSSHKQIVKTPIPKSG 240

Query: 241 LSPIERCPFNGQNIKCYSPRPLDHESPQRDFNNNFQLRILKSSVLQRRQS 290
           LSPIERCPFNGQNIKCYSPRPLDHESPQRDFNNNFQLRILKSSVLQRRQS
Sbjct: 241 LSPIERCPFNGQNIKCYSPRPLDHESPQRDFNNNFQLRILKSSVLQRRQS 290

>Scas_576.8d
          Length = 357

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 42/75 (56%), Gaps = 2/75 (2%)

Query: 11 YTLKNLMYENNCCKFYDAVDENNISYVLKFV--PSDVTSEGDTFPFVDRFQVKEGVFLVY 68
          YT+KNL+ + +  + YDAVD N   YVLK +  P     +      +D F V+ G   VY
Sbjct: 16 YTVKNLICKTDVYQAYDAVDCNGTCYVLKVIINPRGCPKDSPIPGLIDAFPVRTGWCQVY 75

Query: 69 SSNDFGKEGTDYFTY 83
           ++ F  EG+DYF+Y
Sbjct: 76 PAHSFEDEGSDYFSY 90

>AGL056W [4255] [Homologous to ScYPR005C - SH]
           complement(605224..606414) [1191 bp, 396 aa]
          Length = 396

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 6/52 (11%)

Query: 55  VDRFQVKEGVFLVYSSNDFGKEGTDYFTYTGSGGNEVHISG-----TSSEAG 101
           ++RF V E  F+VY   +  +EG DYF Y  SG  E   SG     T+ +AG
Sbjct: 63  LERFMVGEDAFVVYGRGELEEEGLDYFNYL-SGDAEEAESGRADGRTARDAG 113

>CAGL0L09251g complement(1001979..1002827) no similarity,
           hypothetical start
          Length = 282

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 16/82 (19%)

Query: 212 KHISIVNPS--SKIYHSSHKQIVKTPIPKSGLSPIERCPFNGQNIK-CYSPRPLDHESPQ 268
           +HI  VN     ++ H  H+ IV+TP+PKS       CP     ++     + L  +  Q
Sbjct: 209 EHIHFVNNPVLQRVCHRQHRPIVRTPVPKS-------CPAYHDGVQDNIQQKKLSCQKGQ 261

Query: 269 RDFNNNFQLRILKSSVLQRRQS 290
                 F+L++L+SS+L+RR +
Sbjct: 262 ------FELQMLQSSMLKRRST 277

>ACL160C [889] [Homologous to ScYLR207W (HRD3) - SH] (75271..77325)
           [2055 bp, 684 aa]
          Length = 684

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 5/58 (8%)

Query: 3   FKDLGL-HDYTLKNLMYENNCCKFYDAVDENNISYVLKFVPSDVTSEGDTFPFVDRFQ 59
            +DLGL H Y  ++    N   +FY   ++    Y+L F+ +D++ EG     +DRF+
Sbjct: 408 LRDLGLLHHYEYRDY---NRAAEFYKLAEDEASLYMLNFIQNDLSQEG-LIAAMDRFR 461

>KLLA0B10263g 896677..899916 similar to sp|Q04336 Saccharomyces
           cerevisiae YMR196w singleton, start by similarity
          Length = 1079

 Score = 32.3 bits (72), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 15/66 (22%), Positives = 31/66 (46%)

Query: 102 IKPQFIETCHPKHLKRGTKEQEDINSSTSKKSAVINNFSGEKTPNPRPQSSNISERETYV 161
           ++ +  +T  P        +++D +S   ++    +NF    TP P P+S    +R+ + 
Sbjct: 357 VRYKLTDTRLPMFEDEMVIDEDDFDSLFDRREQEADNFYWRVTPAPIPESLRAVQRQAFA 416

Query: 162 GILNVK 167
           G+L  K
Sbjct: 417 GLLWSK 422

>KLLA0E13992g 1236690..1238051 no similarity, hypothetical start
          Length = 453

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 9/86 (10%)

Query: 5  DLGLHDYTLKNLMYENNCCKFYDAVDENNISYVL----KFVPSDVTSEGDTFPFVDRFQV 60
          DLG   Y LK+++  +     Y A + N  + VL    K +P    +  D   + DRF  
Sbjct: 11 DLGT--YQLKSILGNDKGNVIYCAKNSNGSTVVLIETDKVLPVKAKTRLDD-TYKDRFYD 67

Query: 61 KE--GVFLVYSSNDFGKEGTDYFTYT 84
          K+    F VY  +    EG DYF Y+
Sbjct: 68 KDHTKTFTVYGQDYLDIEGNDYFAYS 93

>Scas_528.1
          Length = 197

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 9/103 (8%)

Query: 125 INSSTSKKSAVINNFSGEK-TPNPRPQSSNISER-----ETYVGILNVKCKNKNSSKIRS 178
           I   T + +  IN    E   PN R   S I  R     E   G+  ++  + N+ +I+S
Sbjct: 17  IRPLTVEDAEQINKLESEGFPPNERAPMSTIEFRLKACPELCSGLF-IRDFDPNTKEIKS 75

Query: 179 EKLVSSVIETKHTPGLASILSKEGTTYPNNAD--GKHISIVNP 219
           EKL+  ++ TK T G    L   G  +  ++D  G H  +++P
Sbjct: 76  EKLIGHILGTKITGGSYITLESMGLVHDESSDVIGIHSVVIDP 118

>YLR049C (YLR049C) [3466] chr12 complement(243887..245173) Protein
           of unknown function [1287 bp, 428 aa]
          Length = 428

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 52/113 (46%), Gaps = 17/113 (15%)

Query: 102 IKPQFIETCHPKHLKRGTKEQED---INSSTSKKSAVINNFSGEKTPNPRPQSSNISERE 158
           I+PQ       K+L   +  QE+   INS     S + NN       +  P   N+ + E
Sbjct: 120 IRPQ-------KNLSVDSLIQENKRKINSEKESLSLIANNNDETLCTHTDPSIQNLIKSE 172

Query: 159 TYVGILNVKCKNKN--SSKIRSEKLVSSVIETKHTPG----LASILSKEGTTY 205
           T   ILN+K +N+N    +++ EK  S+ + + HT G    L  ++SK    +
Sbjct: 173 TKRNILNLKFQNRNLFRRELKLEKFWSN-LRSCHTSGDETDLLLVISKHNLYW 224

>Scas_709.18
          Length = 562

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 28/61 (45%), Gaps = 7/61 (11%)

Query: 99  EAGIKPQFIETCHPKHLKRGT-KEQEDINSSTSKKSAVINNFSGEKTPNPRPQSSNISER 157
           E GI     ET   + LK+   KE+ED+N     K     N   E   NP P S N+S+ 
Sbjct: 27  EEGISA---ETIRKRWLKQQEDKEKEDVNKEVDTKGE---NSQTESDENPNPVSLNVSDE 80

Query: 158 E 158
           E
Sbjct: 81  E 81

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.131    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,935,219
Number of extensions: 529223
Number of successful extensions: 1345
Number of sequences better than 10.0: 67
Number of HSP's gapped: 1341
Number of HSP's successfully gapped: 69
Length of query: 290
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 189
Effective length of database: 13,099,691
Effective search space: 2475841599
Effective search space used: 2475841599
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 61 (28.1 bits)