Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPL192C (PRM3)1331325593e-75
Scas_611.3d129361138e-08
CAGL0G09229g11128790.003
YOL119C (MCH4)50126660.49
Scas_673.2465538595.1
Kwal_47.1660372026585.7
Kwal_14.74772026585.7
YNL167C (SKO1)64742586.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPL192C
         (132 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPL192C (PRM3) [5255] chr16 complement(182654..183055) Nuclear m...   219   3e-75
Scas_611.3d                                                            48   8e-08
CAGL0G09229g complement(881448..881783) some similarities with s...    35   0.003
YOL119C (MCH4) [4704] chr15 complement(94855..96360) Member of t...    30   0.49 
Scas_673.24                                                            27   5.1  
Kwal_47.16603                                                          27   5.7  
Kwal_14.747                                                            27   5.7  
YNL167C (SKO1) [4429] chr14 complement(319416..321359) Transcrip...    27   6.7  

>YPL192C (PRM3) [5255] chr16 complement(182654..183055) Nuclear
           membrane protein involved in karyogamy [402 bp, 133 aa]
          Length = 133

 Score =  219 bits (559), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 113/132 (85%), Positives = 113/132 (85%)

Query: 1   MTAMKEDNAALITLKKNNDQEKLRVHKLTDASSNSADGFVINKAKNGGPLNKKSLVNNEQ 60
           MTAMKEDNAALITLKKNNDQEKLRVHKLTDASSNSADGFVINKAKNGGPLNKKSLVNNEQ
Sbjct: 1   MTAMKEDNAALITLKKNNDQEKLRVHKLTDASSNSADGFVINKAKNGGPLNKKSLVNNEQ 60

Query: 61  HIKKAVSPGRVXXXXXXXXXXXXXXXXXXXDASESKVQRENKGSFYQGAIFGSFLGAAVT 120
           HIKKAVSPGRV                   DASESKVQRENKGSFYQGAIFGSFLGAAVT
Sbjct: 61  HIKKAVSPGRVRKHKTTTSSTKSRTKSKKKDASESKVQRENKGSFYQGAIFGSFLGAAVT 120

Query: 121 TVLSNLAVKALQ 132
           TVLSNLAVKALQ
Sbjct: 121 TVLSNLAVKALQ 132

>Scas_611.3d
          Length = 129

 Score = 48.1 bits (113), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 30/36 (83%)

Query: 97  VQRENKGSFYQGAIFGSFLGAAVTTVLSNLAVKALQ 132
           + +++  +FY GA+FGSFLGA ++TV++NL VK+L+
Sbjct: 93  IAQKDSDAFYHGALFGSFLGATLSTVVTNLIVKSLE 128

>CAGL0G09229g complement(881448..881783) some similarities with
           sp|Q08931 Saccharomyces cerevisiae YPL192c PRM3,
           hypothetical start
          Length = 111

 Score = 35.0 bits (79), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 21/28 (75%)

Query: 99  RENKGSFYQGAIFGSFLGAAVTTVLSNL 126
           R  K  +++G + GSFLGAA+T+++S +
Sbjct: 78  RPQKSRYFEGMLVGSFLGAAITSMISKI 105

>YOL119C (MCH4) [4704] chr15 complement(94855..96360) Member of
          the monocarboxylate porter (MCP) family of the major
          facilitator superfamily (MFS), has similarity to
          mammalian monocarboxylate transporter proteins [1506
          bp, 501 aa]
          Length = 501

 Score = 30.0 bits (66), Expect = 0.49,   Method: Composition-based stats.
 Identities = 15/26 (57%), Positives = 19/26 (73%)

Query: 8  NAALITLKKNNDQEKLRVHKLTDASS 33
          NAA   LKKN+DQ  L V+KLT+ +S
Sbjct: 46 NAADAILKKNSDQVDLDVNKLTNVTS 71

>Scas_673.24
          Length = 655

 Score = 27.3 bits (59), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 2/38 (5%)

Query: 23  LRVH-KLTDASSNSADGFVINKAKNGGPLNKKSLVNNE 59
            R+H + TD S N+A+GFV   AKN    +K +  NNE
Sbjct: 100 WRLHQRFTDHSKNTANGFVP-TAKNSNLKSKATYANNE 136

>Kwal_47.16603
          Length = 720

 Score = 26.9 bits (58), Expect = 5.7,   Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 15/26 (57%)

Query: 104 SFYQGAIFGSFLGAAVTTVLSNLAVK 129
           + Y GAI G FLG  V   +SNL  K
Sbjct: 177 NIYGGAICGYFLGVCVIAAISNLLRK 202

>Kwal_14.747
          Length = 720

 Score = 26.9 bits (58), Expect = 5.7,   Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 15/26 (57%)

Query: 104 SFYQGAIFGSFLGAAVTTVLSNLAVK 129
           + Y GAI G FLG  V   +SNL  K
Sbjct: 177 NIYGGAICGYFLGVCVIAAISNLLRK 202

>YNL167C (SKO1) [4429] chr14 complement(319416..321359)
           Transcriptional repressor that is converted to a
           transcriptional activator by Hog1p-dependent
           phosphorylation in response to osmotic stress, member of
           the ATF/CREB subfamily of bZIP DNA-binding proteins
           [1944 bp, 647 aa]
          Length = 647

 Score = 26.9 bits (58), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 31  ASSNSADGFVINKAKNGG---PLNKKSLVNNEQHIKKAVSPG 69
            +SNS +GF  N ++  G    L+K  L  NE +I+  ++PG
Sbjct: 187 TTSNSGNGFPTNDSQMPGFLLNLSKSGLTPNESNIRTGLTPG 228

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.124    0.326 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,450,565
Number of extensions: 112846
Number of successful extensions: 289
Number of sequences better than 10.0: 14
Number of HSP's gapped: 288
Number of HSP's successfully gapped: 14
Length of query: 132
Length of database: 16,596,109
Length adjustment: 90
Effective length of query: 42
Effective length of database: 13,480,489
Effective search space: 566180538
Effective search space used: 566180538
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 55 (25.8 bits)