Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPL189C-A68683537e-46
Scas_611.5d65421862e-20
AFL069C58491765e-19
ADL364C50426630.23
Sklu_2381.257626620.37
CAGL0G05698g109551552.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPL189C-A
         (68 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPL189C-A (YPL189C-A) [5258] chr16 complement(188306..188512) Pr...   140   7e-46
Scas_611.5d                                                            76   2e-20
AFL069C [3124] [Homologous to ScYPL190CX - SH] (305964..306140) ...    72   5e-19
ADL364C [1377] [Homologous to ScYPR072W (NOT5) - SH] (66074..675...    29   0.23 
Sklu_2381.2 YPR072W, Contig c2381 3614-5344                            28   0.37 
CAGL0G05698g complement(541468..544755) highly similar to sp|P33...    26   2.6  

>YPL189C-A (YPL189C-A) [5258] chr16 complement(188306..188512)
          Protein of unknown function [207 bp, 68 aa]
          Length = 68

 Score =  140 bits (353), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 68/68 (100%), Positives = 68/68 (100%)

Query: 1  MRAVTRNKIVNNLYFSTFLIAFASVAIGSVLPCPAHSVDSDSPAVQQHKLQLAHEQELKR 60
          MRAVTRNKIVNNLYFSTFLIAFASVAIGSVLPCPAHSVDSDSPAVQQHKLQLAHEQELKR
Sbjct: 1  MRAVTRNKIVNNLYFSTFLIAFASVAIGSVLPCPAHSVDSDSPAVQQHKLQLAHEQELKR 60

Query: 61 KDALSKKI 68
          KDALSKKI
Sbjct: 61 KDALSKKI 68

>Scas_611.5d
          Length = 65

 Score = 76.3 bits (186), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 31/42 (73%), Positives = 39/42 (92%)

Query: 1  MRAVTRNKIVNNLYFSTFLIAFASVAIGSVLPCPAHSVDSDS 42
          MRAV RN+++NNLY +TF++ FASVAIG+VLPCPAHSVDSD+
Sbjct: 1  MRAVARNRLMNNLYLTTFVLTFASVAIGTVLPCPAHSVDSDT 42

>AFL069C [3124] [Homologous to ScYPL190CX - SH] (305964..306140)
          [177 bp, 58 aa]
          Length = 58

 Score = 72.4 bits (176), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 43/49 (87%)

Query: 1  MRAVTRNKIVNNLYFSTFLIAFASVAIGSVLPCPAHSVDSDSPAVQQHK 49
          ++A TRN++ N L+ +TFL+AF+SVA+GSVLPCPAHS+DSD+P  ++++
Sbjct: 3  LKAATRNRVTNKLFVTTFLVAFSSVALGSVLPCPAHSLDSDTPVRERNE 51

>ADL364C [1377] [Homologous to ScYPR072W (NOT5) - SH] (66074..67588)
           [1515 bp, 504 aa]
          Length = 504

 Score = 28.9 bits (63), Expect = 0.23,   Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%)

Query: 29  SVLPCPAHSVDSDSPAVQQHKLQLAH 54
           S+L CP  S+D+D+P + QH L L H
Sbjct: 352 SLLNCP-DSLDADTPHLYQHPLSLPH 376

>Sklu_2381.2 YPR072W, Contig c2381 3614-5344
          Length = 576

 Score = 28.5 bits (62), Expect = 0.37,   Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%)

Query: 29  SVLPCPAHSVDSDSPAVQQHKLQLAH 54
           S+L CP  S+D+D+P + QH L L H
Sbjct: 415 SLLNCP-DSLDADTPHLYQHPLSLPH 439

>CAGL0G05698g complement(541468..544755) highly similar to sp|P33327
           Saccharomyces cerevisiae YDL215c GDH2, start by
           similarity
          Length = 1095

 Score = 25.8 bits (55), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 3/51 (5%)

Query: 15  FSTFLIAFASVAIGSV-LPCPAHS--VDSDSPAVQQHKLQLAHEQELKRKD 62
           F  F I F  VA G + + C  +    D++S  V     QLA  Q+ K KD
Sbjct: 563 FKGFHIRFKDVARGGIRIVCSRNQDIYDTNSKTVIDENYQLASTQQRKNKD 613

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.130    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 1,955,632
Number of extensions: 59596
Number of successful extensions: 178
Number of sequences better than 10.0: 7
Number of HSP's gapped: 178
Number of HSP's successfully gapped: 7
Length of query: 68
Length of database: 16,596,109
Length adjustment: 41
Effective length of query: 27
Effective length of database: 15,176,771
Effective search space: 409772817
Effective search space used: 409772817
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)