Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPL138C (SPP1)35334816860.0
Scas_700.373693597511e-97
CAGL0M02585g3603616911e-88
Sklu_1701.23343476812e-87
Kwal_26.86973323506578e-84
ACR115W3483466273e-79
KLLA0D07260g3423566257e-79
CAGL0H02035g274671171e-06
Scas_541.4282581162e-06
KLLA0A06974g295551125e-06
Sklu_2376.2271561125e-06
YHR090C (YNG2)282511081e-05
Scas_666.2*318481082e-05
AEL100W285511028e-05
YNL097C (PHO23)330371038e-05
CAGL0G06556g31635983e-04
ADL263W29337965e-04
KLLA0C13409g39137967e-04
KLLA0C16203g145429968e-04
Kwal_26.838431857940.001
Kwal_56.24206150247930.002
AFL127C152132930.002
Sklu_2428.1120565870.005
Kwal_55.2172419344830.012
Scas_549.520151820.019
YMR176W (ECM5)141154850.020
YOR064C (YNG1)21941780.072
Scas_720.39145530770.15
YKL005C (BYE1)59442730.42
YKR029C (SET3)75150720.65
Kwal_27.1110738855700.89
Sklu_2214.464474691.3
KLLA0F25828g62349682.0
KLLA0F02882g79649672.4
Kwal_47.1815546539672.6
CAGL0M10285g60720663.0
Sklu_2303.679529654.3
CAGL0L03091g78247654.8
Scas_629.2360216645.2
KLLA0F27643g47844646.0
Sklu_2426.4297204636.2
CAGL0L08470g16025616.4
Kwal_26.805963175637.6
Kwal_26.791454737637.6
KLLA0E18898g44652637.9
YJR119C72834629.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPL138C
         (348 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPL138C (SPP1) [5308] chr16 complement(291365..292426) Component...   654   0.0  
Scas_700.37                                                           293   1e-97
CAGL0M02585g complement(297048..298130) similar to tr|Q03012 Sac...   270   1e-88
Sklu_1701.2 YPL138C, Contig c1701 2003-3007 reverse complement        266   2e-87
Kwal_26.8697                                                          257   8e-84
ACR115W [1162] [Homologous to ScYPL138C (SPP1) - SH] complement(...   246   3e-79
KLLA0D07260g 619630..620658 similar to sgd|S0006059 Saccharomyce...   245   7e-79
CAGL0H02035g 182137..182961 similar to sp|P38806 Saccharomyces c...    50   1e-06
Scas_541.4                                                             49   2e-06
KLLA0A06974g complement(630572..631459) similar to sp|P38806 Sac...    48   5e-06
Sklu_2376.2 YHR090C, Contig c2376 1317-2132 reverse complement         48   5e-06
YHR090C (YNG2) [2380] chr8 complement(283778..284626) Component ...    46   1e-05
Scas_666.2*                                                            46   2e-05
AEL100W [2406] [Homologous to ScYHR090C (YNG2) - SH] complement(...    44   8e-05
YNL097C (PHO23) [4494] chr14 complement(441366..442358) Protein ...    44   8e-05
CAGL0G06556g 628181..629131 similar to sp|P50947 Saccharomyces c...    42   3e-04
ADL263W [1478] [Homologous to ScYNL097C (PHO23) - SH] complement...    42   5e-04
KLLA0C13409g complement(1143660..1144835) some similarities with...    42   7e-04
KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q...    42   8e-04
Kwal_26.8384                                                           41   0.001
Kwal_56.24206                                                          40   0.002
AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..19...    40   0.002
Sklu_2428.11 YOR064C, Contig c2428 18153-18770                         38   0.005
Kwal_55.21724                                                          37   0.012
Scas_549.5                                                             36   0.019
YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in...    37   0.020
YOR064C (YNG1) [4872] chr15 complement(446080..446739) Component...    35   0.072
Scas_720.39                                                            34   0.15 
YKL005C (BYE1) [3252] chr11 complement(432736..434520) Protein w...    33   0.42 
YKR029C (SET3) [3284] chr11 complement(497220..499475) Component...    32   0.65 
Kwal_27.11107                                                          32   0.89 
Sklu_2214.4 YMR075W, Contig c2214 8469-10403 reverse complement        31   1.3  
KLLA0F25828g complement(2401463..2403334) similar to sp|Q04779 S...    31   2.0  
KLLA0F02882g 269162..271552 weakly similar to sp|P36124 Saccharo...    30   2.4  
Kwal_47.18155                                                          30   2.6  
CAGL0M10285g complement(1029427..1031250) similar to sp|P36106 S...    30   3.0  
Sklu_2303.6 YJR119C, Contig c2303 8969-11356                           30   4.3  
CAGL0L03091g complement(354241..356589) similar to sp|P36124 Sac...    30   4.8  
Scas_629.23                                                            29   5.2  
KLLA0F27643g complement(2561213..2562649) similar to sp|P40034 S...    29   6.0  
Sklu_2426.4 YDR315C, Contig c2426 3710-4603 reverse complement         29   6.2  
CAGL0L08470g complement(928438..928920) no similarity, hypotheti...    28   6.4  
Kwal_26.8059                                                           29   7.6  
Kwal_26.7914                                                           29   7.6  
KLLA0E18898g 1670923..1672263 weakly similar to sgd|S0006102 Sac...    29   7.9  
YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protei...    28   9.8  

>YPL138C (SPP1) [5308] chr16 complement(291365..292426) Component of
           SET1 and COMPASS complex, may be involved in chromatin
           remodeling [1062 bp, 353 aa]
          Length = 353

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/348 (91%), Positives = 318/348 (91%)

Query: 1   MSLPQWCPPHSTLKRNPTTGEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDL 60
           MSLPQWCPPHSTLKRNPTTGEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDL
Sbjct: 1   MSLPQWCPPHSTLKRNPTTGEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDL 60

Query: 61  VFSFYCPYCQAGITGKNKDAIINGEGSLPKTLWKRKCRISDCYKPCLQDSKYCSEEHGRE 120
           VFSFYCPYCQAGITGKNKDAIINGEGSLPKTLWKRKCRISDCYKPCLQDSKYCSEEHGRE
Sbjct: 61  VFSFYCPYCQAGITGKNKDAIINGEGSLPKTLWKRKCRISDCYKPCLQDSKYCSEEHGRE 120

Query: 121 FVNDIWSRLKTDEDRAVVKKMVEQTGHIDKFKKFGQLDFIDNNIVVKTDDEKEIFDQIVV 180
           FVNDIWSRLKTDEDRAVVKKMVEQTGHIDKFKKFGQLDFIDNNIVVKTDDEKEIFDQIVV
Sbjct: 121 FVNDIWSRLKTDEDRAVVKKMVEQTGHIDKFKKFGQLDFIDNNIVVKTDDEKEIFDQIVV 180

Query: 181 RDMTLKTLEDDLQEVQEISLPLFXXXXXXXXVYLGWLDNVYTEMRKLDDDAASHVECGXX 240
           RDMTLKTLEDDLQEVQEISLPLF        VYLGWLDNVYTEMRKLDDDAASHVECG  
Sbjct: 181 RDMTLKTLEDDLQEVQEISLPLFKKKLELLEVYLGWLDNVYTEMRKLDDDAASHVECGKE 240

Query: 241 XXXXXXXXXXXXXXXXXXXXNICGYCSTYERIPCSVEEFVRDFGSNEEATKIHEVCTKWK 300
                               NICGYCSTYERIPCSVEEFVRDFGSNEEATKIHEVCTKWK
Sbjct: 241 DSKGTKRKKKKNSSRSRARKNICGYCSTYERIPCSVEEFVRDFGSNEEATKIHEVCTKWK 300

Query: 301 CNRHLDWVSTNQEQYLQQIDSLESMQERLQHLIQARKKQLNIQYYEEI 348
           CNRHLDWVSTNQEQYLQQIDSLESMQERLQHLIQARKKQLNIQYYEEI
Sbjct: 301 CNRHLDWVSTNQEQYLQQIDSLESMQERLQHLIQARKKQLNIQYYEEI 348

>Scas_700.37
          Length = 369

 Score =  293 bits (751), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 147/359 (40%), Positives = 217/359 (60%), Gaps = 17/359 (4%)

Query: 2   SLPQWCPPHSTLKRNPTTGEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLV 61
           SLP WCPP+S  K++P T E VYCICKRPD+GELMVGCDGCDDWFHF+CL IP  ++ LV
Sbjct: 6   SLPAWCPPYSKQKKDPETNEAVYCICKRPDHGELMVGCDGCDDWFHFSCLKIPTVYQKLV 65

Query: 62  FSFYCPYCQAGITGKNKDAIINGEGSLPKTLWKRKCRISDCYKPCLQDSKYCSEEHGREF 121
           FSF+CPYCQAGITG   +A+ + +   PKTLWKRKCR+ DCY P ++ SKYCS+EHG EF
Sbjct: 66  FSFFCPYCQAGITGPKANALGDDQIPYPKTLWKRKCRLPDCYLPVMEKSKYCSKEHGVEF 125

Query: 122 ---------VNDIWSRLKTDEDR-AVVKKMVEQT--GHIDKFKKFGQLDFIDNNIVVKTD 169
                    V+D+   L++++D+ + V+ M++++    ++ F   G  DFID    V  +
Sbjct: 126 MKGIMDKLDVSDVGKTLRSEDDKESFVRDMIKRSENDQVEAFINLGASDFIDKE--VPKE 183

Query: 170 DEKEIFDQIVVRDMTLKTLEDDLQEVQEISLPLFXXXXXXXXVYLGWLDNVYTEMRKLDD 229
              E++ +I+  D  +  L+ + + V+ I++P           Y  W +++  ++ K  +
Sbjct: 184 LNPELYQKIITNDDRMIDLQRNQETVEGITIPEIKKNITLLEKYASWANDINIKLNKSVE 243

Query: 230 DAASHVECGXXXXXXXXXXXXXXXXXXXXXXNICGYCSTYERIPCSVEEFVRDFGSNEEA 289
           D    +                         +ICGY  ++E IPCSVE+F+ ++ SN+  
Sbjct: 244 DEGDAM--SSPTKKSTKGKKKKPHNKNKPKRSICGYIKSFETIPCSVEDFISEYDSNDPT 301

Query: 290 -TKIHEVCTKWKCNRHLDWVSTNQEQYLQQIDSLESMQERLQHLIQARKKQLNIQYYEE 347
            T I  VC   KC RH  WVS   +QY+QQ++S +S  ER++ L+ +R+ QL+IQYYE+
Sbjct: 302 ITHIQGVCLNSKCQRHAGWVSMRMDQYVQQLESSQSYLERIKLLMHSRRNQLHIQYYEQ 360

>CAGL0M02585g complement(297048..298130) similar to tr|Q03012
           Saccharomyces cerevisiae YPL138c, hypothetical start
          Length = 360

 Score =  270 bits (691), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 145/361 (40%), Positives = 202/361 (55%), Gaps = 23/361 (6%)

Query: 3   LPQWCPPHSTLKRNPTTGEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLVF 62
           LP+WCPP+ST K +  TGEDVYCICK+PDYGELMVGCDGCDDWFHF C+ IPE +++LV 
Sbjct: 5   LPEWCPPYSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCDDWFHFECMKIPETYRNLVE 64

Query: 63  SFYCPYCQAGITGKNKDAIINGEGSLPKTLWKRKCRISDCYKPCLQDSKYCSEEHGREFV 122
           SF CPYC+ GITG        G+G  PK+LWK+KCR+ DCY+PC   SKYCS+EHG+E++
Sbjct: 65  SFICPYCRVGITGPGS----KGDGECPKSLWKKKCRLQDCYEPCESGSKYCSKEHGKEYM 120

Query: 123 ----------NDIWSRLKTDEDRAVVKKMVEQT-GHIDKFKKFGQLDFIDNNIVVKTDDE 171
                     ND+ +R   + D  ++K +   T  +++KFK FG   FID++I  + D  
Sbjct: 121 SRLLNKVKIKNDLNNRYANESDDKLLKDVYHATKNNVEKFKTFGSSSFIDSDI-DRVDRH 179

Query: 172 KEIFDQIVVRDMTLKTLEDDLQEVQEISLPLFXXXXXXXXVYLGWLDNVYTEMRKLDDDA 231
            EI+D+I+  D   K L  +   +    +            YL W+ +V  ++   +D+ 
Sbjct: 180 GEIYDKIINDDKYYKDLLTEKDNITNNQIEGLKKKVEELDKYLDWISSV-NKLINGEDNT 238

Query: 232 ASHVECGXXXXXXXXXXXXXXXXXXXXXXNICGYCSTYERIPCSVEEFVRDFG----SNE 287
               E                         ICGY     +IPC+ EEF   +     S  
Sbjct: 239 IEQEE--NVNDTIKTKKKKKKSQKRRSKKAICGYSLNLAKIPCNPEEFYNKYSEITTSTP 296

Query: 288 EATKIHEVCTKWKCNRHLDWVSTNQEQYLQQIDSLESMQERLQHLIQARKKQLNIQYYEE 347
           +  +I  +C K +CN+H DW +   +QY +QI SLE+  +RL   I  RK+QLNI Y+E 
Sbjct: 297 DCNEIEGICIKLRCNKHSDWSTMTSDQYTRQIISLETHLKRLDLSISTRKRQLNINYFEH 356

Query: 348 I 348
           I
Sbjct: 357 I 357

>Sklu_1701.2 YPL138C, Contig c1701 2003-3007 reverse complement
          Length = 334

 Score =  266 bits (681), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 138/347 (39%), Positives = 201/347 (57%), Gaps = 25/347 (7%)

Query: 2   SLPQWCPPHSTLKRNPTTGEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLV 61
           +LP WCPP++T K++  TGEDVYCICK+PD G+LMVGCDGCDDWFHF CL I  +FK+LV
Sbjct: 3   TLPAWCPPYNTKKKDLDTGEDVYCICKKPDNGDLMVGCDGCDDWFHFECLKISPKFKELV 62

Query: 62  FSFYCPYCQAGITGKNKDAIINGEGSLPKTLWKRKCRISDCYKPCLQDSKYCSEEHGREF 121
           FSFYCPYCQAGITG            LPKT+WKRKCR+  CYK C +DSKYC +EHG+++
Sbjct: 63  FSFYCPYCQAGITGPGSIT----PNRLPKTIWKRKCRLVGCYKECAKDSKYCCKEHGKKY 118

Query: 122 VNDIWSRLKTDEDRA--VVKKMVEQTGHIDKFKKFGQLDFIDNNIVVKTDDEKEIFDQIV 179
           +  +W R++  +     +VKKM+  +  ++     G+      +I    D +  +++++V
Sbjct: 119 MCTLWERVRCKDKNPSHIVKKMLSASESVEALTNIGKGPIPTASI----DRDPVLYNKLV 174

Query: 180 VRDMTLKTLEDDLQEVQEISLPLFXXXXXXXXVYLGWLDNVYTEMRKLDDDAASHVECGX 239
             D +L  L   L ++     P           YL WL  V   +   +DDA    +   
Sbjct: 175 ANDSSLIDLNRQLDKINAEEKPQVEQQIGALNRYLEWLKEVNGRLFASEDDAKVKSK--- 231

Query: 240 XXXXXXXXXXXXXXXXXXXXXNICGYCSTYERIPCSVEEFVRDFGSNEEATKIHEVCTKW 299
                                ++CGY + Y+ IPCS+E+FV ++  +EEAT +H VC K 
Sbjct: 232 ---------PKSRRKKTGKQKSMCGYKADYQ-IPCSLEDFVSEY--DEEATIVHGVCCKL 279

Query: 300 KCNRHLDWVSTNQEQYLQQIDSLESMQERLQHLIQARKKQLNIQYYE 346
           +C+RH DW       +  Q+ +L++  +RLQ L++ R+ QLN+Q+YE
Sbjct: 280 RCSRHADWSGVLSNGFELQLQTLQTSIQRLQLLVRVRQSQLNMQFYE 326

>Kwal_26.8697
          Length = 332

 Score =  257 bits (657), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 131/350 (37%), Positives = 204/350 (58%), Gaps = 29/350 (8%)

Query: 1   MSLPQWCPPHSTLKRNPTTGEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDL 60
           ++LP+WCP +++LK++P +GE+V+CICK+PD GELMVGCDGCDDWFHF+CL +P++F +L
Sbjct: 2   VALPEWCPAYNSLKKDPLSGEEVFCICKKPDSGELMVGCDGCDDWFHFSCLRVPQKFNEL 61

Query: 61  VFSFYCPYCQAGITGKNKDAIINGEGSLPKTLWKRKCRISDCYKPCLQDSKYCSEEHGRE 120
           VFSFYCPYCQ G+TG    +      +LPKTLW+RKCR+ +CYKPC ++SKYCSEEH  E
Sbjct: 62  VFSFYCPYCQCGVTGPGSRS-----RNLPKTLWRRKCRVLECYKPCSENSKYCSEEHALE 116

Query: 121 FVNDIWSRLKTDE-DRAVVKKMVEQTGHIDKFKKFGQLDFIDNNIVVKTDDEKEIFDQIV 179
           ++  +  R+++   D   V + + Q   +  F+K GQ     N++   ++D   +   ++
Sbjct: 117 YMRSLLDRVESRSYDAPTVLRQMLQNTDLASFQKMGQ-----NDVPTPSED---LAPGLL 168

Query: 180 VRDMTLKTLEDDLQEVQEISLPLFXXXXXXXXVYLGWLDNVYTEM-RKLDDDAASHVECG 238
             D  ++ L   + +V + + P           Y+ W  +V  ++    + + AS     
Sbjct: 169 DDDKRIRELSSQINDVHKQAKPEVEAQFQKLANYVAWNKSVNAQLFGSQNSELASKAS-- 226

Query: 239 XXXXXXXXXXXXXXXXXXXXXXNICGYCSTYERIPCSVEEFVRDFGSNEEATKIHEVCTK 298
                                  ICGY + +E I CS EEFV  +  NE+  ++H VC K
Sbjct: 227 ---------RAQKRKKKSVKPKAICGYHANFE-ITCSPEEFVSQY--NEDIPELHSVCCK 274

Query: 299 WKCNRHLDWVSTNQEQYLQQIDSLESMQERLQHLIQARKKQLNIQYYEEI 348
            +C RHLDW    +     Q+++LES  ERL  L++ R+ QL +Q+Y+++
Sbjct: 275 LRCARHLDWAGIQENALQFQLETLESSLERLTLLLKIRQDQLKVQFYKKL 324

>ACR115W [1162] [Homologous to ScYPL138C (SPP1) - SH]
           complement(554695..555741) [1047 bp, 348 aa]
          Length = 348

 Score =  246 bits (627), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 130/346 (37%), Positives = 188/346 (54%), Gaps = 33/346 (9%)

Query: 1   MSLPQWCPPHSTLKRNPTTGEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDL 60
           MSLP WCPP    K++P+TGEDVYCICK+PD GELMV CDGC DWFHFTC+ IP  +K L
Sbjct: 22  MSLPDWCPPFQGTKQDPSTGEDVYCICKKPDGGELMVQCDGCGDWFHFTCIRIPSAYKSL 81

Query: 61  VFSFYCPYCQAGITGKNKDAIINGEGSLPKTLWKRKCRISDCYKPCLQDSKYCSEEHGRE 120
           VFSFYCPYCQAGIT        +G G+LP+T+WKR+CR+  CY+ C +DSKYC  EHG  
Sbjct: 82  VFSFYCPYCQAGIT-------YSGTGALPRTVWKRRCRMEGCYRACARDSKYCGPEHGEA 134

Query: 121 FVNDIWSRLKTDEDRAVVKKMVEQTGHIDKFKKFGQLDFIDNNIVVKTDDEKEIFDQIVV 180
           ++  +  R      +AVV++MV +TG  +     G L       + + D +  ++D++V 
Sbjct: 135 YMRALVERAGPG-GQAVVQQMV-RTGQFESLGT-GALP------LARRDVDPALYDRVVG 185

Query: 181 RDMTLKTLEDDLQEVQEISLPLFXXXXXXXXVYLGWLDNVYTEMRKLDDDAASHVECGXX 240
            D  L  LE + +EV+E               YL W+  V        +DA  H      
Sbjct: 186 ADARLGELEAEAREVREARRSALCAQLAALSAYLAWVREV--------NDALFH------ 231

Query: 241 XXXXXXXXXXXXXXXXXXXXNICGYCSTYERIPCSVEEFVRDFGSNEEATKIHEVCTKWK 300
                                +CG+ + Y+  P    +F   +   ++A  +H VC + +
Sbjct: 232 DTEEAAPRRGKARARRKPKRALCGFRADYQ-APLPAADFAASYA--DDAALLHGVCCRLR 288

Query: 301 CNRHLDWVSTNQEQYLQQIDSLESMQERLQHLIQARKKQLNIQYYE 346
           C RH DW S        ++++L+S ++RLQ LI  RK+ L+++++E
Sbjct: 289 CPRHQDWASMRLGSVQFELEALDSAEQRLQLLISMRKEHLSLRFHE 334

>KLLA0D07260g 619630..620658 similar to sgd|S0006059 Saccharomyces
           cerevisiae YPL138c, start by similarity
          Length = 342

 Score =  245 bits (625), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 137/356 (38%), Positives = 197/356 (55%), Gaps = 35/356 (9%)

Query: 1   MSLPQWCPPHSTLKRNPTTGEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDL 60
           MSLP WCP + + K +P TGE+VYCICK+PD GELMVGCDGCDDWFHF+CL IPE+++DL
Sbjct: 1   MSLPSWCPRYDSRKHDPKTGEEVYCICKKPDTGELMVGCDGCDDWFHFSCLKIPEKYRDL 60

Query: 61  VFSFYCPYCQAGITGKNKDAIINGEGSLPKTLWKRKCRISDCYKPCLQD--SKYCSEEHG 118
           VFSFYC YC AGITG    A+ING G LPKTLWKRKCR+ +CY  C  +  SKYCS++H 
Sbjct: 61  VFSFYCSYCSAGITGP---ALING-GKLPKTLWKRKCRLPECYTECDANSRSKYCSKKHA 116

Query: 119 REFVNDIWSRLKTD--EDRAVVKKMVEQTGHIDKFKKFGQLDFIDNNIVVKTDDEKEIFD 176
            ++V  I  +L     +  A++++++ +T  +++FK  G+    D    V +   K+ + 
Sbjct: 117 VQYVQSIVDKLNLPGVDKIALLRQLLNETTSLEEFKTLGR----DKLPEVTSPLSKDQYS 172

Query: 177 QIVVRDMTLKTLEDDLQEVQEISLPLFXXXXXXXXVYLGWLDNVYTEMRKLDDDAASHVE 236
           +++  D  L  L ++  E+  + L            Y+ W+  V       ++  + H  
Sbjct: 173 KLLENDQHLNKLINEHDELVSVKLSKLNEEDAVIEKYVNWIGEV-------NERLSPHFN 225

Query: 237 CGXXXXXXXXXXXXXXXXXXXXXXNICGYCSTYERIPCSVEEFVRDF-----GSNEEATK 291
                                    ICGY + +  IP SVEEF+          N   T 
Sbjct: 226 ----------QPTGRKKSKSASKVTICGYHNEFT-IPRSVEEFLDKLLQLKEDENSNITS 274

Query: 292 IHEVCTKWKCNRHLDWVSTNQEQYLQQIDSLESMQERLQHLIQARKKQLNIQYYEE 347
           +  VC K KC +H DW++ +Q    +Q DSLE+++ RL  LI  R  QL I ++E+
Sbjct: 275 VDGVCVKTKCAKHQDWITLSQNDLSEQKDSLENVKRRLDLLISVRTNQLRISFFEQ 330

>CAGL0H02035g 182137..182961 similar to sp|P38806 Saccharomyces
           cerevisiae YHR090c YNG2, start by similarity
          Length = 274

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 41/67 (61%), Gaps = 7/67 (10%)

Query: 11  STLKRNPTTGEDVYCICKRPDYGELMVGCDGCD---DWFHFTCLHIPEQFKDLVFSFYCP 67
           S++  N    +++YC C+R  +GE MV CDG +   +WFH+ C+++ E  K    ++YCP
Sbjct: 204 SSMNDNEKEDQNLYCFCQRVSFGE-MVACDGPNCKYEWFHYECVNLTEPPKG---TWYCP 259

Query: 68  YCQAGIT 74
            C+  ++
Sbjct: 260 DCKQEMS 266

>Scas_541.4
          Length = 282

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 7/58 (12%)

Query: 23  VYCICKRPDYGELMVGCDGCD---DWFHFTCLHIPEQFKDLVFSFYCPYCQAGITGKN 77
           +YC C+   YGE MV CDG +   +WFH+ C+++ E  K L   +YCP C+  +  KN
Sbjct: 223 LYCFCQSVSYGE-MVACDGPNCKYEWFHYGCVNLKEPPKGL---WYCPDCRQEMAKKN 276

>KLLA0A06974g complement(630572..631459) similar to sp|P38806
           Saccharomyces cerevisiae YHR090c YNG2 component of NuA4
           histone acetyltransferase complex, start by similarity
          Length = 295

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 7/55 (12%)

Query: 23  VYCICKRPDYGELMVGCDGCD---DWFHFTCLHIPEQFKDLVFSFYCPYCQAGIT 74
           +YC C+R  YGE MV CDG +   +WFH++C+++ E  K     +YCP C+  I 
Sbjct: 234 LYCFCQRVSYGE-MVACDGPNCKYEWFHYSCVNLTEPPKG---QWYCPECRLEIA 284

>Sklu_2376.2 YHR090C, Contig c2376 1317-2132 reverse complement
          Length = 271

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 7/56 (12%)

Query: 23  VYCICKRPDYGELMVGCDGCD---DWFHFTCLHIPEQFKDLVFSFYCPYCQAGITG 75
           +YC C+   YGE MV CDG +   +WFH+TC+++ E  K    ++YCP C+  I  
Sbjct: 210 LYCFCQSVSYGE-MVACDGENCKYEWFHYTCVNLKEPPKG---AWYCPECRQEIAN 261

>YHR090C (YNG2) [2380] chr8 complement(283778..284626) Component of
           NuA4 histone acetyltransferase complex, involved in
           transcriptional regulation and chromatin remodeling [849
           bp, 282 aa]
          Length = 282

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%), Gaps = 7/51 (13%)

Query: 23  VYCICKRPDYGELMVGCDGCD---DWFHFTCLHIPEQFKDLVFSFYCPYCQ 70
           +YC C+R  +GE MV CDG +   +WFH+ C+++ E  K    ++YCP C+
Sbjct: 223 LYCFCQRVSFGE-MVACDGPNCKYEWFHYDCVNLKEPPKG---TWYCPECK 269

>Scas_666.2*
          Length = 318

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 30/48 (62%), Gaps = 5/48 (10%)

Query: 9   PHSTLKRNPTTGEDVYCICKRPDYGELMVGCDGCD---DWFHFTCLHI 53
           P++ LK N   GE +YC C +  YGE MVGCDG D   +WFH  C+ +
Sbjct: 253 PNNGLKTN-EYGEPLYCYCNQVAYGE-MVGCDGADCELEWFHLQCIGL 298

>AEL100W [2406] [Homologous to ScYHR090C (YNG2) - SH]
           complement(438074..438931) [858 bp, 285 aa]
          Length = 285

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 7/51 (13%)

Query: 23  VYCICKRPDYGELMVGCDGCD---DWFHFTCLHIPEQFKDLVFSFYCPYCQ 70
           +YC C+   YGE MV CDG +   +WFH+ C+++ E  K     +YCP C+
Sbjct: 225 LYCFCQSVSYGE-MVACDGPNCKYEWFHYGCVNLDEPPKG---QWYCPECR 271

>YNL097C (PHO23) [4494] chr14 complement(441366..442358) Protein
           involved in chromatin remodeling and possibly
           transcription regulation, involved in expression of PHO5
           [993 bp, 330 aa]
          Length = 330

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (64%), Gaps = 4/37 (10%)

Query: 20  GEDVYCICKRPDYGELMVGCDGCD---DWFHFTCLHI 53
           GE +YC C +  YGE MVGCDG D   +WFH  C+ +
Sbjct: 278 GEPLYCYCNQVAYGE-MVGCDGADCELEWFHLPCIGL 313

>CAGL0G06556g 628181..629131 similar to sp|P50947 Saccharomyces
           cerevisiae YNL097c PHO23, start by similarity
          Length = 316

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 23/35 (65%), Gaps = 4/35 (11%)

Query: 20  GEDVYCICKRPDYGELMVGCDGCD---DWFHFTCL 51
           GE +YC C +  YGE MVGCDG D   +WFH  C+
Sbjct: 262 GEPLYCYCNQVAYGE-MVGCDGEDCELEWFHLPCI 295

>ADL263W [1478] [Homologous to ScYNL097C (PHO23) - SH]
           complement(242858..243739) [882 bp, 293 aa]
          Length = 293

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 25/37 (67%), Gaps = 4/37 (10%)

Query: 20  GEDVYCICKRPDYGELMVGCDGCD---DWFHFTCLHI 53
           GE +YC C +  YGE MVGCDG +   +WFH  C+++
Sbjct: 243 GEALYCYCNQVAYGE-MVGCDGENCQLEWFHLPCINL 278

>KLLA0C13409g complement(1143660..1144835) some similarities with
           sp|P50947 Saccharomyces cerevisiae YNL097c PHO23
           involved in transcriptional regulation of PHO5,
           hypothetical start
          Length = 391

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 24/37 (64%), Gaps = 4/37 (10%)

Query: 20  GEDVYCICKRPDYGELMVGCDGCD---DWFHFTCLHI 53
           GE +YC C +  YGE MVGCDG +   +WFH  C+ +
Sbjct: 339 GEALYCYCNQVAYGE-MVGCDGENCQLEWFHLPCIGL 374

>KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q03214
            Saccharomyces cerevisiae YMR176w ECM5 involved in cell
            wall biogenesis and architecture singleton, start by
            similarity
          Length = 1454

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 21/29 (72%)

Query: 24   YCICKRPDYGELMVGCDGCDDWFHFTCLH 52
            YC C+R D G +MV C+ C +W+H +C++
Sbjct: 1278 YCFCRRGDNGNVMVQCEICSEWYHTSCIN 1306

>Kwal_26.8384
          Length = 318

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 7/57 (12%)

Query: 20  GEDVYCICKRPDYGELMVGCDGCD---DWFHFTCLHIPEQFKDLVFSFYCPYCQAGI 73
           GE +YC C +  YGE MVGCDG +   +WFH  C+ +    K     +YC  C+  +
Sbjct: 266 GEALYCYCNQVAYGE-MVGCDGDNCILEWFHLPCIGLETLPKG---KWYCDDCKRAL 318

>Kwal_56.24206
          Length = 1502

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 6    WCPPHSTLKRNPTTGEDVYCICKRPDYGELMVGCDGCDDWFHFTCLH 52
            W P       +P   +  YC C+  D G  MV C+ C +W+H  C++
Sbjct: 1261 WIP-------DPNKSDGHYCFCRGGDSGSRMVACEVCGEWYHMNCIN 1300

>AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..198039)
            [4566 bp, 1521 aa]
          Length = 1521

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 21/32 (65%)

Query: 21   EDVYCICKRPDYGELMVGCDGCDDWFHFTCLH 52
            + VYC C++ D G  MV C+ C +W+H  C++
Sbjct: 1294 QSVYCFCRQGDVGSTMVECEICREWYHVACIN 1325

>Sklu_2428.11 YOR064C, Contig c2428 18153-18770
          Length = 205

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 4/65 (6%)

Query: 20  GEDVYCICKRPDYGELMVGCD--GCD-DWFHFTCLHIPEQFKDLVFSFYCPYCQAGITGK 76
           G++++C C+   YG  MV CD  GC  +WFH+ C+ + +  ++    +    C++  + K
Sbjct: 141 GQELFCFCRDISYGP-MVACDNPGCPIEWFHYACVGLLKAPRNNAKWYCSTKCRSTASKK 199

Query: 77  NKDAI 81
            K  I
Sbjct: 200 RKSEI 204

>Kwal_55.21724
          Length = 193

 Score = 36.6 bits (83), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query: 15  RNPTTGEDVYCICKRPDYGELMVGCDGCD---DWFHFTCLHIPE 55
           R     E VYCIC+   YG  M+ CD      +WFH+ C+ + +
Sbjct: 112 RPSHPAEPVYCICREVSYGA-MIACDNSKCPIEWFHYGCIGLTQ 154

>Scas_549.5
          Length = 201

 Score = 36.2 bits (82), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 8/51 (15%)

Query: 24  YCICKRPDYGELMVGCDGCD---DWFHFTCLHIPEQFKDLVFSFYC-PYCQ 70
           YC C R  YGE M+ CD  +   +WFH+ C+ + +  K     +YC P C+
Sbjct: 128 YCFCNRESYGE-MIACDNPNCPYEWFHYDCIGMTQPPKG---KWYCSPNCK 174

>YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in cell
            wall structure or biosynthesis [4236 bp, 1411 aa]
          Length = 1411

 Score = 37.4 bits (85), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 6/54 (11%)

Query: 24   YCICKRPDYGELMVGCDGCDDWFHFTCLH----IPEQFKDLVF--SFYCPYCQA 71
            YC C+R + G  MV C+ C +W+H  C+     +P    +++F  S   P C A
Sbjct: 1240 YCFCRRVEEGTAMVECEICKEWYHVDCISNGELVPPDDPNVLFVCSICTPPCMA 1293

>YOR064C (YNG1) [4872] chr15 complement(446080..446739) Component of
           NuA3 histone acetyltransferase complex, required for
           interaction of NuA3 complex with chromatin, has
           similarity to human retinoblastoma binding protein 2
           [660 bp, 219 aa]
          Length = 219

 Score = 34.7 bits (78), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 4/41 (9%)

Query: 21  EDVYCICKRPDYGELMVGCD--GCD-DWFHFTCLHIPEQFK 58
           E+VYC C+   YG  MV CD   C  +WFH+ C+ + +  K
Sbjct: 154 EEVYCFCRNVSYGP-MVACDNPACPFEWFHYGCVGLKQAPK 193

>Scas_720.39
          Length = 1455

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 23   VYCICKRPDYGELMVGCDGCDDWFHFTCLH 52
            VYC C+  D G  M+ C+ C +W+H  C++
Sbjct: 1261 VYCFCRGGDIGT-MIQCELCQEWYHTACIN 1289

>YKL005C (BYE1) [3252] chr11 complement(432736..434520) Protein with
           similarity to Drosophila transcription factor TFIIS,
           contains a PHD finger [1785 bp, 594 aa]
          Length = 594

 Score = 32.7 bits (73), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 4/42 (9%)

Query: 36  MVGCDGCDDWFHFTCLHIPEQFKDLVFS----FYCPYCQAGI 73
           MV CDGCD W H  C+   +   D + S    +YC  C   +
Sbjct: 94  MVQCDGCDTWQHIKCMTDGKDTIDGLMSEDSKYYCELCDPSL 135

>YKR029C (SET3) [3284] chr11 complement(497220..499475) Component of
           the Set3p complex with histone deacetylase activity that
           represses meiotic-specific sporulation gene expression,
           has similarity to E(z) Enhancer of zeste in the
           C-terminal domain, contains a PHD finger and a SET
           domain [2256 bp, 751 aa]
          Length = 751

 Score = 32.3 bits (72), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 4   PQWCPPHSTLKRNPTTGEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHI 53
           PQW  P S +  +P  G  + CIC   D     + CD C+ W H  C  I
Sbjct: 101 PQWPVPDSYIV-DPDAGI-ITCICDLNDDDGFTIQCDHCNRWQHAICYGI 148

>Kwal_27.11107
          Length = 388

 Score = 31.6 bits (70), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 3/55 (5%)

Query: 22 DVYCICKR---PDYGELMVGCDGCDDWFHFTCLHIPEQFKDLVFSFYCPYCQAGI 73
          D  CIC     PD   L + C+ C  W H  C+ I E        ++C  C+  +
Sbjct: 34 DTRCICSETDPPDDSGLYIQCEQCSVWQHGFCVGITEGEDSAPDKYWCEQCRPDL 88

>Sklu_2214.4 YMR075W, Contig c2214 8469-10403 reverse complement
          Length = 644

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 4/74 (5%)

Query: 9   PHSTLKRNPTTGEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLV-FSFYCP 67
           P  + +  P   +D    C +P    + + CD C   FHF C + P    +L    + C 
Sbjct: 238 PPPSAEEAPIENDDFCASCMQPG---VFLCCDTCPKSFHFACCNPPLDPNNLPEGDWSCQ 294

Query: 68  YCQAGITGKNKDAI 81
            CQ  +   NK A+
Sbjct: 295 ECQFNMNHPNKAAV 308

>KLLA0F25828g complement(2401463..2403334) similar to sp|Q04779
           Saccharomyces cerevisiae YMR075w singleton, start by
           similarity
          Length = 623

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 1/49 (2%)

Query: 20  GEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPE-QFKDLVFSFYCP 67
           GE        PD   L++ CD C   +H  CL +P    K+L   + CP
Sbjct: 410 GESKMGTWDHPDSQRLIMTCDYCSTPWHLDCLPLPRASLKNLGSKWKCP 458

>KLLA0F02882g 269162..271552 weakly similar to sp|P36124
           Saccharomyces cerevisiae YKR029c, start by similarity
          Length = 796

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 20/49 (40%), Gaps = 1/49 (2%)

Query: 23  VYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLVFSFYCPYCQA 71
           + CIC   D     + CD C  W H  C  I E  KD    F C  C +
Sbjct: 226 ITCICGYEDDDGFTIQCDHCFRWQHAICYGI-EHEKDAPDDFLCNICNS 273

>Kwal_47.18155
          Length = 465

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 5/39 (12%)

Query: 23 VYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLV 61
           YC    PD   L V C+ CD W H TC+ I    KD+V
Sbjct: 7  AYCSSSDPD-KLLWVQCEVCDSWVHVTCVPI----KDIV 40

>CAGL0M10285g complement(1029427..1031250) similar to sp|P36106
          Saccharomyces cerevisiae YKL005c, hypothetical start
          Length = 607

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 13/20 (65%), Gaps = 1/20 (5%)

Query: 32 YGELMVGCDGCDDWFHFTCL 51
          YGE M+ CD CD W H  C+
Sbjct: 64 YGE-MIQCDQCDTWQHINCM 82

>Sklu_2303.6 YJR119C, Contig c2303 8969-11356
          Length = 795

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 14/29 (48%)

Query: 26  ICKRPDYGELMVGCDGCDDWFHFTCLHIP 54
           IC R  +    + CD CD  FH  CL  P
Sbjct: 261 ICHRTGHSTKSILCDSCDKAFHIFCLMPP 289

>CAGL0L03091g complement(354241..356589) similar to sp|P36124
           Saccharomyces cerevisiae YKR029c, hypothetical start
          Length = 782

 Score = 29.6 bits (65), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 21/47 (44%), Gaps = 1/47 (2%)

Query: 23  VYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLVFSFYCPYC 69
           + C+C   D     + CD C+ W H +C  I +  ++    F C  C
Sbjct: 137 ITCVCDFDDDDGFTIQCDHCNRWQHASCFGI-DNIENAPDDFLCDKC 182

>Scas_629.23
          Length = 602

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 10/16 (62%), Positives = 11/16 (68%)

Query: 36  MVGCDGCDDWFHFTCL 51
           MV CDGCD W H  C+
Sbjct: 85  MVQCDGCDMWQHIRCM 100

>KLLA0F27643g complement(2561213..2562649) similar to sp|P40034
          Saccharomyces cerevisiae YER051w singleton, start by
          similarity
          Length = 478

 Score = 29.3 bits (64), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 7/44 (15%)

Query: 19 TGEDVYC-ICKRPDYGE----LMVGCDGCDDWFHFTCLHIPEQF 57
          T   V C  CK+ D  +    + VGC+ CD W H TC  +P QF
Sbjct: 2  TSGTVKCHFCKKDDSEDKGQPIWVGCEFCDGWCHLTC--VPIQF 43

>Sklu_2426.4 YDR315C, Contig c2426 3710-4603 reverse complement
          Length = 297

 Score = 28.9 bits (63), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 76/204 (37%), Gaps = 64/204 (31%)

Query: 20  GEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLVFSFYCPYCQAGITGKNKD 79
            +DV  + K P+       C   D   HFT LH  +  K +V+ F               
Sbjct: 101 NDDVTTVIKLPNLIPRSYQCHVVD---HFTKLHFSDNMKGIVWEFK-------------- 143

Query: 80  AIINGEGSLPKTLWK-----RKC--------RISDCYKPCLQDSKYC---SEEHGR---- 119
                    PK LW      R C         IS CY   L + K     +E   +    
Sbjct: 144 ---------PKWLWSDLDICRNCTHNRLKEREISYCYSMLLMEDKVAHLITEIFSKACVP 194

Query: 120 -EFVNDIWSRLKTDEDRAVVKKMV---EQTG-HIDKFKKFGQLDFIDNNI---------- 164
            +F+ D+ + LK  +D  V++K+    EQ G HI   K    +D + +++          
Sbjct: 195 PQFIEDVCNYLK--QDNTVLRKLYRVQEQAGRHIPSLKSLKSIDDVSDDLCLSMMLKDVT 252

Query: 165 -VVKTDDEKEIFDQIVVRDMTLKT 187
             ++ + +K I  +IV  DM  KT
Sbjct: 253 CFLQWEGDKPISAKIVDVDMKPKT 276

>CAGL0L08470g complement(928438..928920) no similarity, hypothetical
           start
          Length = 160

 Score = 28.1 bits (61), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 15/25 (60%)

Query: 46  FHFTCLHIPEQFKDLVFSFYCPYCQ 70
           FH T LHI  + KD+V    C YC+
Sbjct: 94  FHHTSLHITVESKDVVLVHICMYCR 118

>Kwal_26.8059
          Length = 631

 Score = 28.9 bits (63), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 31/75 (41%), Gaps = 5/75 (6%)

Query: 8   PPHSTLKRNPTTGEDVYCI-CKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLVFS-FY 65
           PP        T   D +C  C++P    + + CD C   FHF C + P    +L    + 
Sbjct: 224 PPPIVSSTEATVENDDFCSSCRQPG---IFLCCDTCPRSFHFACCNPPLDPDNLPEGDWS 280

Query: 66  CPYCQAGITGKNKDA 80
           C  CQ  I   NK A
Sbjct: 281 CAECQFKIRCPNKAA 295

>Kwal_26.7914
          Length = 547

 Score = 28.9 bits (63), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 11/37 (29%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 36  MVGCDGCDDWFHFTCLHIPEQFKDLVFSFYCPYCQAG 72
           M+ CD C+ W H  C+   ++  DL   ++C  C   
Sbjct: 73  MIQCDKCNTWQHIKCMFGKDEVNDLD-EYFCNICSPA 108

>KLLA0E18898g 1670923..1672263 weakly similar to sgd|S0006102
          Saccharomyces cerevisiae YPL181w, start by similarity
          Length = 446

 Score = 28.9 bits (63), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 5/52 (9%)

Query: 22 DVYCICKR---PDYGELMVGCDGCDDWFHFTCLHIPEQFKDLVFSFYCPYCQ 70
          +  CIC +   PD   L + C+ C  W H  C+ I E+  +    ++C  C+
Sbjct: 31 ETRCICGKIEPPDDSGLYIQCEQCHVWQHGYCVGISEE--ETPDKYWCEQCK 80

>YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protein
           containing a PHD-finger and jumonji (jmjN) and jumonji
           (jmjC) domains, has low similarity to a region of
           selected mouse cDNA on the Y homolog (human SMCY), which
           is a male-specific protein that elicits transplant
           rejection in female recipients [2187 bp, 728 aa]
          Length = 728

 Score = 28.5 bits (62), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 18/34 (52%)

Query: 21  EDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIP 54
           +D   +C++ +  +  + CD CD  FH  CL  P
Sbjct: 235 DDACIVCRKTNDPKRTILCDSCDKPFHIYCLSPP 268

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,769,037
Number of extensions: 501708
Number of successful extensions: 1596
Number of sequences better than 10.0: 60
Number of HSP's gapped: 1591
Number of HSP's successfully gapped: 65
Length of query: 348
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 246
Effective length of database: 13,065,073
Effective search space: 3214007958
Effective search space used: 3214007958
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)