Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPL135W (ISU1)1651638621e-120
CAGL0M02629g2131516623e-89
ACR112C1541516225e-84
YOR226C (ISU2)1561566201e-83
Scas_640.221601356192e-83
Kwal_26.86801581476182e-83
KLLA0D07161g1801336193e-83
Scas_700.391611346165e-83
Sklu_2012.41501256042e-81
CAGL0J04048g1451315964e-80
Scas_625.476141641.6
YOL076W (MDM20)79658623.4
AFR018C150821605.8
Scas_707.3691580596.2
YNL169C (PSD1)50046588.8
CAGL0M08294g989124589.2
CAGL0G04521g14631569.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPL135W
         (163 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPL135W (ISU1) [5310] chr16 (297552..298049) Protein with simila...   336   e-120
CAGL0M02629g 303016..303657 some similarities with tr|Q03020 Sac...   259   3e-89
ACR112C [1159] [Homologous to ScYPL135W (ISU1) - SH; ScYOR226C (...   244   5e-84
YOR226C (ISU2) [5017] chr15 complement(761614..762084) Protein w...   243   1e-83
Scas_640.22                                                           243   2e-83
Kwal_26.8680                                                          242   2e-83
KLLA0D07161g complement(612348..612890) some similarities with s...   243   3e-83
Scas_700.39                                                           241   5e-83
Sklu_2012.4 YPL135W, Contig c2012 4922-5374 reverse complement        237   2e-81
CAGL0J04048g 381327..381764 highly similar to tr|Q12056 Saccharo...   234   4e-80
Scas_625.4                                                             29   1.6  
YOL076W (MDM20) [4744] chr15 (187023..189413) Protein required f...    28   3.4  
AFR018C [3210] [Homologous to ScYBL017C (PEP1) - SH] (466218..47...    28   5.8  
Scas_707.36                                                            27   6.2  
YNL169C (PSD1) [4427] chr14 complement(316169..317671) Phosphati...    27   8.8  
CAGL0M08294g 825250..828219 similar to sp|P36048 Saccharomyces c...    27   9.2  
CAGL0G04521g 432221..432661 similar to sp|P42949 Saccharomyces c...    26   9.8  

>YPL135W (ISU1) [5310] chr16 (297552..298049) Protein with
           similarity to iron-sulfur cluster nitrogen fixation
           proteins [498 bp, 165 aa]
          Length = 165

 Score =  336 bits (862), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 163/163 (100%), Positives = 163/163 (100%)

Query: 1   MLPVITRFARPALMAIRPVNAMGVLRASSITKRLYHPKVIEHYTHPRNVGSLDKKLPNVG 60
           MLPVITRFARPALMAIRPVNAMGVLRASSITKRLYHPKVIEHYTHPRNVGSLDKKLPNVG
Sbjct: 1   MLPVITRFARPALMAIRPVNAMGVLRASSITKRLYHPKVIEHYTHPRNVGSLDKKLPNVG 60

Query: 61  TGLVGAPACGDVMRLQIKVNDSTGVIEDVKFKTFGCGSAIASSSYMTELVQGMTLDDAAK 120
           TGLVGAPACGDVMRLQIKVNDSTGVIEDVKFKTFGCGSAIASSSYMTELVQGMTLDDAAK
Sbjct: 61  TGLVGAPACGDVMRLQIKVNDSTGVIEDVKFKTFGCGSAIASSSYMTELVQGMTLDDAAK 120

Query: 121 IKNTEIAKELSLPPVKLHCSMLAEDAIKAAIKDYKSKRNTPTM 163
           IKNTEIAKELSLPPVKLHCSMLAEDAIKAAIKDYKSKRNTPTM
Sbjct: 121 IKNTEIAKELSLPPVKLHCSMLAEDAIKAAIKDYKSKRNTPTM 163

>CAGL0M02629g 303016..303657 some similarities with tr|Q03020
           Saccharomyces cerevisiae YPL135w ISU1 or tr|Q12056
           Saccharomyces cerevisiae YOR226c ISU2, hypothetical
           start
          Length = 213

 Score =  259 bits (662), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 136/151 (90%), Gaps = 2/151 (1%)

Query: 12  ALMAIRPVNAMGVLRASSITKRLYHPKVIEHYTHPRNVGSLDKKLPNVGTGLVGAPACGD 71
           A+ AI  + A G +  ++I +R+YHPKVIEHYTHPRNVGS+DK LPNVGTGLVGAPACGD
Sbjct: 62  AMGAIGAIGAKGTM--NNIGRRMYHPKVIEHYTHPRNVGSMDKTLPNVGTGLVGAPACGD 119

Query: 72  VMRLQIKVNDSTGVIEDVKFKTFGCGSAIASSSYMTELVQGMTLDDAAKIKNTEIAKELS 131
           VMRLQIKVND TGVIEDVKFKTFGCGSAIASSSYMTELV GMTLDDAAKIKNT IAKELS
Sbjct: 120 VMRLQIKVNDKTGVIEDVKFKTFGCGSAIASSSYMTELVHGMTLDDAAKIKNTTIAKELS 179

Query: 132 LPPVKLHCSMLAEDAIKAAIKDYKSKRNTPT 162
           LPPVKLHCSMLAEDAIKAAIKDYKSKR + T
Sbjct: 180 LPPVKLHCSMLAEDAIKAAIKDYKSKRTSTT 210

>ACR112C [1159] [Homologous to ScYPL135W (ISU1) - SH; ScYOR226C
           (ISU2) - SH] (549554..550018) [465 bp, 154 aa]
          Length = 154

 Score =  244 bits (622), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 119/151 (78%), Positives = 131/151 (86%), Gaps = 6/151 (3%)

Query: 8   FARPALMAIRPVNAMGVLRASSITKRLYHPKVIEHYTHPRNVGSLDKKLPNVGTGLVGAP 67
           F + A   +RPV  +G  R      R YHPKVI+HYT+PRNVG+LDKKL NVGTGLVGAP
Sbjct: 4   FRQTATAIVRPVGTIGYAR------RCYHPKVIDHYTNPRNVGTLDKKLTNVGTGLVGAP 57

Query: 68  ACGDVMRLQIKVNDSTGVIEDVKFKTFGCGSAIASSSYMTELVQGMTLDDAAKIKNTEIA 127
           ACGDVMRLQI+V+DSTGVIE+VKFKTFGCGSAIASSSYMTELV+G TL DA KIKNTEIA
Sbjct: 58  ACGDVMRLQIQVDDSTGVIENVKFKTFGCGSAIASSSYMTELVRGKTLADAEKIKNTEIA 117

Query: 128 KELSLPPVKLHCSMLAEDAIKAAIKDYKSKR 158
           +ELSLPPVKLHCSMLAEDAIKAAIKDY+SKR
Sbjct: 118 RELSLPPVKLHCSMLAEDAIKAAIKDYRSKR 148

>YOR226C (ISU2) [5017] chr15 complement(761614..762084) Protein with
           similarity to iron-sulfur cluster nitrogen fixation
           proteins [471 bp, 156 aa]
          Length = 156

 Score =  243 bits (620), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 136/156 (87%), Gaps = 5/156 (3%)

Query: 4   VITRFARPALMAIRPVNAMGVLRASSITKRLYHPKVIEHYTHPRNVGSLDKKLPNVGTGL 63
           +  R A PA    +P+    + RA+   KRLYHPKVI+HYT+PRNVGS+DK L NVGTG+
Sbjct: 1   MFARLANPA--HFKPLTGSHITRAA---KRLYHPKVIDHYTNPRNVGSMDKSLANVGTGI 55

Query: 64  VGAPACGDVMRLQIKVNDSTGVIEDVKFKTFGCGSAIASSSYMTELVQGMTLDDAAKIKN 123
           VGAPACGDV++LQI+VND +G+IE+VKFKTFGCGSAIASSSYMTELV+GM+LD+A KIKN
Sbjct: 56  VGAPACGDVIKLQIQVNDKSGIIENVKFKTFGCGSAIASSSYMTELVRGMSLDEAVKIKN 115

Query: 124 TEIAKELSLPPVKLHCSMLAEDAIKAAIKDYKSKRN 159
           TEIAKELSLPPVKLHCSMLAEDAIKAAIKDYK+KRN
Sbjct: 116 TEIAKELSLPPVKLHCSMLAEDAIKAAIKDYKTKRN 151

>Scas_640.22
          Length = 160

 Score =  243 bits (619), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 125/135 (92%)

Query: 28  SSITKRLYHPKVIEHYTHPRNVGSLDKKLPNVGTGLVGAPACGDVMRLQIKVNDSTGVIE 87
           S +TKRLYH KVIEHYT+PRNVGSLDK L NVGTG+VGAPACGDV++LQI+VND TG+IE
Sbjct: 23  SLLTKRLYHAKVIEHYTNPRNVGSLDKSLSNVGTGIVGAPACGDVIKLQIQVNDDTGIIE 82

Query: 88  DVKFKTFGCGSAIASSSYMTELVQGMTLDDAAKIKNTEIAKELSLPPVKLHCSMLAEDAI 147
           +VKFKTFGCGSAIASSSYMTELV GM++DDAAKIKN EIAKELSLPPVKLHCSMLAEDAI
Sbjct: 83  NVKFKTFGCGSAIASSSYMTELVNGMSVDDAAKIKNIEIAKELSLPPVKLHCSMLAEDAI 142

Query: 148 KAAIKDYKSKRNTPT 162
           KAAIKDYK+KR   T
Sbjct: 143 KAAIKDYKTKRTHST 157

>Kwal_26.8680
          Length = 158

 Score =  242 bits (618), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 117/147 (79%), Positives = 132/147 (89%), Gaps = 1/147 (0%)

Query: 18  PVNAMGVLRA-SSITKRLYHPKVIEHYTHPRNVGSLDKKLPNVGTGLVGAPACGDVMRLQ 76
           PV A G + + +S+ +R YHPKVI+HYT+PRNVGSLDKKL NVGTGLVGAPACGDVM+LQ
Sbjct: 11  PVAARGGMGSMASVARRAYHPKVIDHYTNPRNVGSLDKKLENVGTGLVGAPACGDVMKLQ 70

Query: 77  IKVNDSTGVIEDVKFKTFGCGSAIASSSYMTELVQGMTLDDAAKIKNTEIAKELSLPPVK 136
           I+VND TGVIE+VKFKTFGCGSAIASSSYMTELV+G TLD A++IKNTEIAKELSLPPVK
Sbjct: 71  IQVNDETGVIENVKFKTFGCGSAIASSSYMTELVRGKTLDVASQIKNTEIAKELSLPPVK 130

Query: 137 LHCSMLAEDAIKAAIKDYKSKRNTPTM 163
           LHCSMLAEDAIKAAIKDY+SKR    +
Sbjct: 131 LHCSMLAEDAIKAAIKDYRSKRKATVL 157

>KLLA0D07161g complement(612348..612890) some similarities with
           sgd|S0006056 Saccharomyces cerevisiae YPL135w ISU1,
           hypothetical start
          Length = 180

 Score =  243 bits (619), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 114/133 (85%), Positives = 125/133 (93%)

Query: 28  SSITKRLYHPKVIEHYTHPRNVGSLDKKLPNVGTGLVGAPACGDVMRLQIKVNDSTGVIE 87
           S  + R YHPKVI+HYT+PRNVGSLDK LPNVGTGLVGAPACGDVM+LQI+VND TGVIE
Sbjct: 44  SMASARFYHPKVIDHYTNPRNVGSLDKNLPNVGTGLVGAPACGDVMKLQIQVNDETGVIE 103

Query: 88  DVKFKTFGCGSAIASSSYMTELVQGMTLDDAAKIKNTEIAKELSLPPVKLHCSMLAEDAI 147
           +VKFKTFGCGSAIASSSYMTELV+G TL+DAAKIKNTEIA+ELSLPPVKLHCSMLAEDAI
Sbjct: 104 NVKFKTFGCGSAIASSSYMTELVRGKTLEDAAKIKNTEIARELSLPPVKLHCSMLAEDAI 163

Query: 148 KAAIKDYKSKRNT 160
           KAAIKDY++KR T
Sbjct: 164 KAAIKDYQAKRPT 176

>Scas_700.39
          Length = 161

 Score =  241 bits (616), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 125/134 (93%)

Query: 30  ITKRLYHPKVIEHYTHPRNVGSLDKKLPNVGTGLVGAPACGDVMRLQIKVNDSTGVIEDV 89
           I +RLYHPKVI+HYTHPRNVGSLDKK  NVGTGLVGAPACGDVMRLQI+VND TG+IE+V
Sbjct: 26  IQRRLYHPKVIDHYTHPRNVGSLDKKALNVGTGLVGAPACGDVMRLQIQVNDDTGIIENV 85

Query: 90  KFKTFGCGSAIASSSYMTELVQGMTLDDAAKIKNTEIAKELSLPPVKLHCSMLAEDAIKA 149
           KFKTFGCGSAIASSSYMTE+V+GM+++DA  IKNT+IAKELSLPPVKLHCSMLAEDAIKA
Sbjct: 86  KFKTFGCGSAIASSSYMTEMVKGMSVNDAFLIKNTQIAKELSLPPVKLHCSMLAEDAIKA 145

Query: 150 AIKDYKSKRNTPTM 163
           AI DYKSKR T T+
Sbjct: 146 AINDYKSKRTTKTV 159

>Sklu_2012.4 YPL135W, Contig c2012 4922-5374 reverse complement
          Length = 150

 Score =  237 bits (604), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 111/125 (88%), Positives = 121/125 (96%)

Query: 30  ITKRLYHPKVIEHYTHPRNVGSLDKKLPNVGTGLVGAPACGDVMRLQIKVNDSTGVIEDV 89
           +T+RLYHPKVI+HYT+PRNVGSLDK L NVGTGLVGAPACGDVM+LQI+VND TGVIE+V
Sbjct: 16  LTRRLYHPKVIDHYTNPRNVGSLDKNLTNVGTGLVGAPACGDVMKLQIQVNDDTGVIENV 75

Query: 90  KFKTFGCGSAIASSSYMTELVQGMTLDDAAKIKNTEIAKELSLPPVKLHCSMLAEDAIKA 149
           KFKTFGCGSAIASSSYMTELV+G TLDDAAKI+NTEIA+ELSLPPVKLHCSMLAEDAIKA
Sbjct: 76  KFKTFGCGSAIASSSYMTELVRGKTLDDAAKIRNTEIARELSLPPVKLHCSMLAEDAIKA 135

Query: 150 AIKDY 154
           AIKDY
Sbjct: 136 AIKDY 140

>CAGL0J04048g 381327..381764 highly similar to tr|Q12056
           Saccharomyces cerevisiae YOR226c ISU2 or tr|Q03020
           Saccharomyces cerevisiae YPL135w ISU1, hypothetical
           start
          Length = 145

 Score =  234 bits (596), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 106/131 (80%), Positives = 125/131 (95%)

Query: 33  RLYHPKVIEHYTHPRNVGSLDKKLPNVGTGLVGAPACGDVMRLQIKVNDSTGVIEDVKFK 92
           R+YHPKVIEHYT+PRNVGS+DK L NVGTG+VGAPACGDV++LQI+VND+TGVIE+ KFK
Sbjct: 14  RMYHPKVIEHYTNPRNVGSMDKTLRNVGTGVVGAPACGDVIKLQIQVNDNTGVIEEAKFK 73

Query: 93  TFGCGSAIASSSYMTELVQGMTLDDAAKIKNTEIAKELSLPPVKLHCSMLAEDAIKAAIK 152
           TFGCGSAIASSSY+TELVQG+T++DA KIKN EIAKELSLPPVKLHCSMLAEDAIKAA++
Sbjct: 74  TFGCGSAIASSSYLTELVQGITIEDAEKIKNIEIAKELSLPPVKLHCSMLAEDAIKAAVR 133

Query: 153 DYKSKRNTPTM 163
           DYK+KR++ T+
Sbjct: 134 DYKTKRSSTTL 144

>Scas_625.4
          Length = 761

 Score = 29.3 bits (64), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 27/41 (65%), Gaps = 6/41 (14%)

Query: 55  KLPNVG--TGLVGAPACGDVMRLQIKVNDSTGVIEDVKFKT 93
           KLP V   +GL+ +P CG    ++++ ND++GV  ++K KT
Sbjct: 363 KLPPVSIQSGLLYSPDCG----VELQFNDASGVRYELKVKT 399

>YOL076W (MDM20) [4744] chr15 (187023..189413) Protein required for
           transport of mitochondria into growing buds and for
           organization of actin cables, interacts genetically with
           Cin8p [2391 bp, 796 aa]
          Length = 796

 Score = 28.5 bits (62), Expect = 3.4,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 100 IASSSYMTELVQGMTLDDAAKIKNTEIAKEL--SLPPVKLHCSMLAEDAIKAAIKDYK 155
           + S +Y+T++    TLD   +IK+ EI K +  SL  ++  C  + +   KA ++ Y+
Sbjct: 701 MVSHTYLTKMATLKTLDSLKRIKDKEIQKLIKNSLKELRSCCDDVFKGYSKALVQAYE 758

>AFR018C [3210] [Homologous to ScYBL017C (PEP1) - SH]
           (466218..470744) [4527 bp, 1508 aa]
          Length = 1508

 Score = 27.7 bits (60), Expect = 5.8,   Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 15/21 (71%)

Query: 120 KIKNTEIAKELSLPPVKLHCS 140
           KIK  E  K+L++ PVK+ CS
Sbjct: 653 KIKGNECTKDLNIEPVKVDCS 673

>Scas_707.36
          Length = 915

 Score = 27.3 bits (59), Expect = 6.2,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 13/80 (16%)

Query: 85  VIEDVKFKTFGC--GSAIASSSYMTELVQGMTLDDAAKIKNTEIAKELSLPPVKL----- 137
           V E ++F TF     + I+  S++ E V    L +    KN   AK +S+P +K+     
Sbjct: 343 VNEKLRFPTFETLQDNHISEISHIREFVHAKDLLNKLLEKNP--AKRISIPDIKVHPFVC 400

Query: 138 ----HCSMLAEDAIKAAIKD 153
               H  +L+ED +++ +K+
Sbjct: 401 WDFKHTKLLSEDQLESKLKE 420

>YNL169C (PSD1) [4427] chr14 complement(316169..317671)
           Phosphatidylserine decarboxylase, mitochondrial isozyme,
           converts phosphatidyl-L-serine to
           phosphatidylethanolamine [1503 bp, 500 aa]
          Length = 500

 Score = 26.9 bits (58), Expect = 8.8,   Method: Composition-based stats.
 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 60  GTGLVGAPACGDVMRLQIKVNDSTGVIEDVKFKTFGCGSAIASSSY 105
           G  ++ +P+ G ++++ I +N  TG IE VK  T+     + + S+
Sbjct: 201 GEDVIASPSDGKILQVGI-INSETGEIEQVKGMTYSIKEFLGTHSH 245

>CAGL0M08294g 825250..828219 similar to sp|P36048 Saccharomyces
           cerevisiae YKL173w U5 snRNP-specific protein, start by
           similarity
          Length = 989

 Score = 26.9 bits (58), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 56/124 (45%), Gaps = 13/124 (10%)

Query: 1   MLPVITRFARPALMAIRPVNAMGVLRASSITKRLYHPKVIEHYTHPRNVGSLDKKLPNVG 60
           ++P++ +    AL+  +P+    +     I K++Y+P V+E     R    +       G
Sbjct: 820 LIPLMRKACNVALLTAKPIVVEPIYEMDIIMKKVYYP-VLEEVLKKRRSAYIYATETIPG 878

Query: 61  TGLVGAPACGDVMRLQIKVNDSTGVIEDVKFKTFGCGSAIASSSYMTEL---VQGMTLDD 117
           T L+        ++ Q+ V +S G+  D++  +   G+AI  S    ++   V G  +D+
Sbjct: 879 TPLIE-------VKTQVPVIESFGLETDIRLSS--EGNAIIQSHQWNDIWRKVPGDVMDE 929

Query: 118 AAKI 121
            A I
Sbjct: 930 DAPI 933

>CAGL0G04521g 432221..432661 similar to sp|P42949 Saccharomyces
           cerevisiae YJL104w, start by similarity
          Length = 146

 Score = 26.2 bits (56), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 112 GMTLDDAAKIKNTEIAKELSLPPVKLHCSML 142
           G+TLD++ KI N + AK+L L  V      L
Sbjct: 57  GITLDESCKILNLDAAKDLKLDKVNQRFDYL 87

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,949,377
Number of extensions: 190909
Number of successful extensions: 482
Number of sequences better than 10.0: 23
Number of HSP's gapped: 482
Number of HSP's successfully gapped: 23
Length of query: 163
Length of database: 16,596,109
Length adjustment: 94
Effective length of query: 69
Effective length of database: 13,342,017
Effective search space: 920599173
Effective search space used: 920599173
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 57 (26.6 bits)