Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YPL131W (RPL5)29727813560.0
Scas_700.4229727812601e-177
Kwal_26.865336427812571e-175
ACR104C29727812371e-173
CAGL0M02695g29726912371e-173
KLLA0D06941g29727812291e-172
Sklu_2406.429727811851e-165
YLR454W262845720.55
Scas_629.0d1267100671.8
Scas_691.35*263237653.6
KLLA0E02178g42941626.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPL131W
         (293 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPL131W (RPL5) [5314] chr16 (303120..304013) Ribosomal protein L...   526   0.0  
Scas_700.42                                                           489   e-177
Kwal_26.8653                                                          488   e-175
ACR104C [1151] [Homologous to ScYPL131W (RPL5) - SH] (541333..54...   481   e-173
CAGL0M02695g 308170..309063 highly similar to sp|P26321 Saccharo...   481   e-173
KLLA0D06941g complement(598560..599453) highly similar to sp|P26...   478   e-172
Sklu_2406.4 YPL131W, Contig c2406 3367-4260                           461   e-165
YLR454W (YLR454W) [3828] chr12 (1043995..1051881) Protein of unk...    32   0.55 
Scas_629.0d                                                            30   1.8  
Scas_691.35*                                                           30   3.6  
KLLA0E02178g 203854..205143 similar to sp|P42838 Saccharomyces c...    28   6.6  

>YPL131W (RPL5) [5314] chr16 (303120..304013) Ribosomal protein L5
           (yeast L1; YL3; rat L5), the sole 5S rRNA-associated
           ribosomal protein, involved in the binding of
           peptidyl-tRNA to the ribosome [894 bp, 297 aa]
          Length = 297

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/278 (92%), Positives = 258/278 (92%)

Query: 1   MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI 60
           MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI
Sbjct: 1   MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI 60

Query: 61  ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDXXXX 120
           ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLD    
Sbjct: 61  ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDETYK 120

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180
                           DGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 181 PGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240
           PGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY
Sbjct: 181 PGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240

Query: 241 TSAHEAIRADPAFKPTEKKFTKEQYAAESKKYRQTKLS 278
           TSAHEAIRADPAFKPTEKKFTKEQYAAESKKYRQTKLS
Sbjct: 241 TSAHEAIRADPAFKPTEKKFTKEQYAAESKKYRQTKLS 278

>Scas_700.42
          Length = 297

 Score =  489 bits (1260), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 234/278 (84%), Positives = 246/278 (88%)

Query: 1   MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI 60
           M F  + K+SAY SRFQTPFRRRREGKTDYYQRKRLV QHKAKYN+PKYRLVVRFTNKDI
Sbjct: 1   MTFNINQKNSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60

Query: 61  ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDXXXX 120
           ICQI+SSTITGD+VLAAAYSHELPRYGITHGLTNW+AAYATGLLIARR LQKLGLD    
Sbjct: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDETYK 120

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180
                           DGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLY+PHSENRF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYIPHSENRF 180

Query: 181 PGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240
           PGWDFE EE+DP+LLR+YIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY
Sbjct: 181 PGWDFEAEELDPDLLRTYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240

Query: 241 TSAHEAIRADPAFKPTEKKFTKEQYAAESKKYRQTKLS 278
           T AH AIRADPAFK TEKKFTKEQYAAESKK+RQ KL+
Sbjct: 241 TEAHAAIRADPAFKATEKKFTKEQYAAESKKFRQIKLT 278

>Kwal_26.8653
          Length = 364

 Score =  488 bits (1257), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 234/278 (84%), Positives = 245/278 (88%)

Query: 1   MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI 60
           M F K+ KSSAY SRFQTPFRRRREGKTDYYQRKRLV QHKAKYN+PKYRLVVRFTNKDI
Sbjct: 70  MVFLKEVKSSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 129

Query: 61  ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDXXXX 120
           ICQI+SSTITGDVVLAAAYSHELPRYGITHGLTNW+AAYATGLLIARR LQKLGLD    
Sbjct: 130 ICQIVSSTITGDVVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDETYQ 189

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180
                           DGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSE+RF
Sbjct: 190 GVEEVEGEYQLTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSESRF 249

Query: 181 PGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240
           PGWDFE EE+D + LR+YIFGGHVSQYMEELADDDEERF ELFKGYLADDIDAD++EDIY
Sbjct: 250 PGWDFEAEELDADTLRTYIFGGHVSQYMEELADDDEERFKELFKGYLADDIDADAVEDIY 309

Query: 241 TSAHEAIRADPAFKPTEKKFTKEQYAAESKKYRQTKLS 278
             AHE IRADP+FKPTEKKFTKEQYAAESKKYRQTKLS
Sbjct: 310 MEAHEKIRADPSFKPTEKKFTKEQYAAESKKYRQTKLS 347

>ACR104C [1151] [Homologous to ScYPL131W (RPL5) - SH]
           (541333..542226) [894 bp, 297 aa]
          Length = 297

 Score =  481 bits (1237), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 229/278 (82%), Positives = 247/278 (88%)

Query: 1   MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI 60
           MAF K  K+SAY SRFQTPFRRRREGKTDYY RKRLVTQHKAKYNTPKYRLVVRFTNKDI
Sbjct: 1   MAFIKSIKNSAYHSRFQTPFRRRREGKTDYYARKRLVTQHKAKYNTPKYRLVVRFTNKDI 60

Query: 61  ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDXXXX 120
           ICQ++SSTITGD+VLAAAYSHELPRYGITHGLTNW+AAYATGLLIARRTLQKLGLD    
Sbjct: 61  ICQVVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRTLQKLGLDETYK 120

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180
                           DGPRPFKV+LDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF
Sbjct: 121 GVEEPEGEYELTEAVEDGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 181 PGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240
           PGWDFE+EE+D +LLR+YIFGGHVS YMEELADDDEER+SELFKGY+AD I+AD++EDIY
Sbjct: 181 PGWDFESEELDADLLRTYIFGGHVSAYMEELADDDEERYSELFKGYIADGIEADAIEDIY 240

Query: 241 TSAHEAIRADPAFKPTEKKFTKEQYAAESKKYRQTKLS 278
           T AH AIRADP+FKPTEKKFTKEQYAAESKK+RQ KL+
Sbjct: 241 TEAHAAIRADPSFKPTEKKFTKEQYAAESKKFRQVKLT 278

>CAGL0M02695g 308170..309063 highly similar to sp|P26321
           Saccharomyces cerevisiae YPL131w RPL1, start by
           similarity
          Length = 297

 Score =  481 bits (1237), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 230/269 (85%), Positives = 240/269 (89%)

Query: 1   MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI 60
           M F ++ K+SAY SRFQTPFRRRREGKTDYYQRKRLV QHKAKYN+PKYRLVVRFTNKDI
Sbjct: 1   MVFIQNLKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60

Query: 61  ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDXXXX 120
           ICQI+SSTITGD+VLAAAYSHELPRYGITHGLTNWAAAYATGLLIARR LQKLGLD    
Sbjct: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRALQKLGLDETYK 120

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180
                           DGPRPFKV+LDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 181 PGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240
           PGWDFE EE+D ELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADS+EDIY
Sbjct: 181 PGWDFEAEELDAELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSIEDIY 240

Query: 241 TSAHEAIRADPAFKPTEKKFTKEQYAAES 269
            SAHEAIRADP+FKPTEKKFTKEQYAAES
Sbjct: 241 ASAHEAIRADPSFKPTEKKFTKEQYAAES 269

>KLLA0D06941g complement(598560..599453) highly similar to sp|P26321
           Saccharomyces cerevisiae YPL131w RPL1 60S large subunit
           ribosomal protein L5.e singleton, start by similarity
          Length = 297

 Score =  478 bits (1229), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 228/278 (82%), Positives = 244/278 (87%)

Query: 1   MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI 60
           MAF KD K+SAY SR+QTPFRRRREGKTDYY RKRLV QHKAKYNTPKYRLVVRFTNKDI
Sbjct: 1   MAFIKDIKTSAYHSRYQTPFRRRREGKTDYYARKRLVAQHKAKYNTPKYRLVVRFTNKDI 60

Query: 61  ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDXXXX 120
           I QI+SSTITGD+VLAAAYSHELPRYGITHGLTNW+AAYATGLL+ARRTLQKLGLD    
Sbjct: 61  ITQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLLARRTLQKLGLDETYP 120

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180
                           DGPRPFKV+LD+GLQRTTTGAR+FGALKGASDGGLYVPHSENRF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVYLDVGLQRTTTGARIFGALKGASDGGLYVPHSENRF 180

Query: 181 PGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240
           PGWDFE EE+D +LLR+YIFGGHVSQYMEELADDDEER+ ELFKGYLADDIDAD++EDIY
Sbjct: 181 PGWDFEAEELDADLLRTYIFGGHVSQYMEELADDDEERYRELFKGYLADDIDADAVEDIY 240

Query: 241 TSAHEAIRADPAFKPTEKKFTKEQYAAESKKYRQTKLS 278
             AH AIR DPAFKPTEKKFTKEQYAAESKKYRQ KL+
Sbjct: 241 ADAHAAIREDPAFKPTEKKFTKEQYAAESKKYRQVKLT 278

>Sklu_2406.4 YPL131W, Contig c2406 3367-4260
          Length = 297

 Score =  461 bits (1185), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 232/278 (83%), Positives = 245/278 (88%)

Query: 1   MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI 60
           M FQ + K+SAY SRFQTPFRRRREGKTDYYQRKRLV QHKAKYN+PKYRLVVRFTNKDI
Sbjct: 1   MGFQLNVKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60

Query: 61  ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDXXXX 120
           ICQI+SSTITGD+VLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLD    
Sbjct: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDETYK 120

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180
                           DGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 181 PGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240
           PGWDFE EE+DP++LR+YIF GHVSQYMEELADDDEERF ELFKGYLADDIDAD++EDIY
Sbjct: 181 PGWDFEAEELDPDMLRTYIFAGHVSQYMEELADDDEERFRELFKGYLADDIDADAIEDIY 240

Query: 241 TSAHEAIRADPAFKPTEKKFTKEQYAAESKKYRQTKLS 278
             AHEAIR DPAFK TEKKFTKEQYAAESKKY+Q KL+
Sbjct: 241 LEAHEAIREDPAFKATEKKFTKEQYAAESKKYKQYKLT 278

>YLR454W (YLR454W) [3828] chr12 (1043995..1051881) Protein of unknown
            function, has low similarity to uncharacterized C.
            albicans Orf6.6103p [7887 bp, 2628 aa]
          Length = 2628

 Score = 32.3 bits (72), Expect = 0.55,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 29/45 (64%), Gaps = 1/45 (2%)

Query: 29   DYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDIICQIIS-STITGD 72
            D +QRK ++T+++A  N  +  + ++F   D++CQ +   T++G+
Sbjct: 1728 DLHQRKEVLTEYQAGLNVRRRVMKLKFLAGDVVCQDVDIRTVSGE 1772

>Scas_629.0d
          Length = 1267

 Score = 30.4 bits (67), Expect = 1.8,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 46/100 (46%), Gaps = 3/100 (3%)

Query: 177 ENRFPGWDFETEEIDPELLRSYIFGGHVSQYMEELA---DDDEERFSELFKGYLADDIDA 233
           EN+ PG + +  +     L++++ G  V    + L     + +  F E+   ++ADD+D 
Sbjct: 366 ENKTPGLNTQYSDSIWLELKAWMNGRTVDDQRKSLILLRANSDTFFQEVLSFHVADDLDP 425

Query: 234 DSLEDIYTSAHEAIRADPAFKPTEKKFTKEQYAAESKKYR 273
           D   D+  +  +      +F P  K+  +E+  A +  ++
Sbjct: 426 DEAADLVRATLDNYDKITSFWPNMKQLYQEKPIANTDAFK 465

>Scas_691.35*
          Length = 2632

 Score = 29.6 bits (65), Expect = 3.6,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 29   DYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDIICQII 65
            D +QRK +VT++K K N  K    ++F + DI+   I
Sbjct: 1721 DLHQRKEVVTEYKKKLNVTKRVKKLKFLSADILTHRI 1757

>KLLA0E02178g 203854..205143 similar to sp|P42838 Saccharomyces
           cerevisiae YNL323w LEM3, start by similarity
          Length = 429

 Score = 28.5 bits (62), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 227 LADDIDADSLEDIYTSAHEAIRADPAFKPTEKKFTKEQYAA 267
           L DD+DA   ED     +E ++   + +P E KFT+++ A+
Sbjct: 37  LEDDVDASEFED---DENEVVKKPKSRRPKETKFTQQKIAS 74

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,623,341
Number of extensions: 362249
Number of successful extensions: 1065
Number of sequences better than 10.0: 18
Number of HSP's gapped: 1058
Number of HSP's successfully gapped: 18
Length of query: 293
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 192
Effective length of database: 13,099,691
Effective search space: 2515140672
Effective search space used: 2515140672
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)