Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR386W (PHR1)56555530120.0
Kwal_14.241559755214860.0
KLLA0D00462g59558413101e-175
Kwal_23.513047987665.8
AER051C77763666.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR386W
         (555 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR386W (PHR1) [5159] chr15 (1066835..1068532) Deoxyribodipyrimi...  1164   0.0  
Kwal_14.2415                                                          577   0.0  
KLLA0D00462g 41415..43202 similar to sp|P05066 Saccharomyces cer...   509   e-175
Kwal_23.5130                                                           30   5.8  
AER051C [2556] [Homologous to ScYDL060W (TSR1) - SH] (731793..73...    30   6.6  

>YOR386W (PHR1) [5159] chr15 (1066835..1068532)
           Deoxyribodipyrimidine photolyase, involved in
           light-dependent repair of pyrimidine dimers [1698 bp,
           565 aa]
          Length = 565

 Score = 1164 bits (3012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/555 (100%), Positives = 555/555 (100%)

Query: 1   MKRTVISSSNAYASKRSRLDIEHDFEQYHSLNKKYYPRPITRTGANQFNNKSRAKPMEIV 60
           MKRTVISSSNAYASKRSRLDIEHDFEQYHSLNKKYYPRPITRTGANQFNNKSRAKPMEIV
Sbjct: 1   MKRTVISSSNAYASKRSRLDIEHDFEQYHSLNKKYYPRPITRTGANQFNNKSRAKPMEIV 60

Query: 61  EKLQKKQKTSFENVSTVMHWFRNDLRLYDNVGLYKSVALFQQLRQKNAKAKLYAVYVINE 120
           EKLQKKQKTSFENVSTVMHWFRNDLRLYDNVGLYKSVALFQQLRQKNAKAKLYAVYVINE
Sbjct: 61  EKLQKKQKTSFENVSTVMHWFRNDLRLYDNVGLYKSVALFQQLRQKNAKAKLYAVYVINE 120

Query: 121 DDWRAHMDSGWKLMFIMGALKNLQQSLAELHIPLLLWEFHTPKSTLSNSKEFVEFFKEKC 180
           DDWRAHMDSGWKLMFIMGALKNLQQSLAELHIPLLLWEFHTPKSTLSNSKEFVEFFKEKC
Sbjct: 121 DDWRAHMDSGWKLMFIMGALKNLQQSLAELHIPLLLWEFHTPKSTLSNSKEFVEFFKEKC 180

Query: 181 MNVSSGTGTIITANIEYQTDELYRDIRLLENEDHRLQLKYYHDSCIVAPGLITTDRGTNY 240
           MNVSSGTGTIITANIEYQTDELYRDIRLLENEDHRLQLKYYHDSCIVAPGLITTDRGTNY
Sbjct: 181 MNVSSGTGTIITANIEYQTDELYRDIRLLENEDHRLQLKYYHDSCIVAPGLITTDRGTNY 240

Query: 241 SVFTPWYKKWVLYVNNYKKSTSEICHLHIIEPLKYNETFELKPFQYSLPDEFLQYIPKSK 300
           SVFTPWYKKWVLYVNNYKKSTSEICHLHIIEPLKYNETFELKPFQYSLPDEFLQYIPKSK
Sbjct: 241 SVFTPWYKKWVLYVNNYKKSTSEICHLHIIEPLKYNETFELKPFQYSLPDEFLQYIPKSK 300

Query: 301 WCLPDVSEEAALSRLKDFLGTKSSKYNNEKDMLYLGGTSGLSVYITTGRISTRLIVNQAF 360
           WCLPDVSEEAALSRLKDFLGTKSSKYNNEKDMLYLGGTSGLSVYITTGRISTRLIVNQAF
Sbjct: 301 WCLPDVSEEAALSRLKDFLGTKSSKYNNEKDMLYLGGTSGLSVYITTGRISTRLIVNQAF 360

Query: 361 QSCNGQIMSKALKDNSSTQNFIKEVAWRDFYRHCMCNWPYTSMGMPYRLDTLDIKWENNP 420
           QSCNGQIMSKALKDNSSTQNFIKEVAWRDFYRHCMCNWPYTSMGMPYRLDTLDIKWENNP
Sbjct: 361 QSCNGQIMSKALKDNSSTQNFIKEVAWRDFYRHCMCNWPYTSMGMPYRLDTLDIKWENNP 420

Query: 421 VAFEKWCTGNTGIPIVDAIMRKLLYTGYINNRSRMITASFLSKNLLIDWRWGERWFMKHL 480
           VAFEKWCTGNTGIPIVDAIMRKLLYTGYINNRSRMITASFLSKNLLIDWRWGERWFMKHL
Sbjct: 421 VAFEKWCTGNTGIPIVDAIMRKLLYTGYINNRSRMITASFLSKNLLIDWRWGERWFMKHL 480

Query: 481 IDGDSSSNVGGWGFCSSTGIDAQPYFRVFNMDIQAKKYDPQMIFVKQWVPELISSENKRP 540
           IDGDSSSNVGGWGFCSSTGIDAQPYFRVFNMDIQAKKYDPQMIFVKQWVPELISSENKRP
Sbjct: 481 IDGDSSSNVGGWGFCSSTGIDAQPYFRVFNMDIQAKKYDPQMIFVKQWVPELISSENKRP 540

Query: 541 ENYPKPLVDLKHSRE 555
           ENYPKPLVDLKHSRE
Sbjct: 541 ENYPKPLVDLKHSRE 555

>Kwal_14.2415
          Length = 597

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/552 (50%), Positives = 384/552 (69%), Gaps = 20/552 (3%)

Query: 21  IEHDFEQYHSLNKKYYPRPITRTGANQFNNKSRAKPMEIVEKLQKKQK--TSFENVSTVM 78
           +  +FE Y+ L+ +YYP+PIT   A++FNN  R KP+ +++   KKQ     F+ VSTV+
Sbjct: 39  VAENFEAYYDLDSRYYPKPITWKQAHEFNNGKRTKPITLLDDYIKKQALPAGFK-VSTVI 97

Query: 79  HWFRNDLRLYDNVGLYKSVALFQQLRQKNAKAKLYAVYVINEDDWRAHMDSGWKLMFIMG 138
           HWFR DLR++DNVGLY +V   ++ ++ N +A+L A+Y INE DWRAH+DSGWKL F + 
Sbjct: 98  HWFRTDLRVHDNVGLYNAVQQVKKAKKSNPQAQLIALYTINEHDWRAHLDSGWKLTFALN 157

Query: 139 ALKNLQQSLAELHIPLLLWEFHTPKSTLSNSKEFVEFFKEKCMNVSSGTGTIITANIEYQ 198
           A+++L++ L  +++ L+L  F + +  LS S ++ ++FKE+C+++S G+  ++ AN +Y+
Sbjct: 158 AVESLRKKLESMNVSLILRVFQSEEPLLSCSAKYADWFKEQCLSISQGS-VLVAANAQYE 216

Query: 199 TDELYRDIRLLENEDHRLQLKYYHDSCIVAPGLITTDRGTNYSVFTPWYKKWVLYVNNYK 258
           +DELYRD +L + +D+R Q + YHD C V PG +TT +G+ Y+VFTPWYKKWV Y+  ++
Sbjct: 217 SDELYRDWKLCKRQDNRFQFQVYHDQCTVQPGSLTTGKGSQYTVFTPWYKKWVEYLTTHQ 276

Query: 259 KSTSEICHLHIIEPL-KYNET-FELKPFQYSLPDEFLQYIPKS-KWCLPDVSEEAALSRL 315
           K   ++  + II+   K NE    L+   Y+L  EF+  +P      LP  +EE A   L
Sbjct: 277 KG-KDVVKMQIIDSDDKINEKPSTLQSDDYTLAKEFVANLPAEISELLPPATEENAHQIL 335

Query: 316 KDFLGTKSSK-YNNEKDMLYLGGTSGLSVYITTGRISTRLIVNQAFQSCNGQIMSKALKD 374
            DF+    +K YN +KD++ L  TS LS YIT+G ISTR +VN+ F      +M K ++ 
Sbjct: 336 DDFIKKGDAKQYNEKKDIIPLDSTSHLSCYITSGLISTRAVVNRGFHENGDSLMRKDIRQ 395

Query: 375 NSSTQNFIKEVAWRDFYRHCMCNWPYTSMGMPYRLDTLDIKWENNPVAFEKWCTGNTGIP 434
           N+S +NFIKEVAWRDFY+H  CNWPY SM +  + +T+DIKW N+   F KWC G TG+P
Sbjct: 396 NNSMENFIKEVAWRDFYKHVACNWPYMSMEIAIKFETMDIKWVNDEEMFRKWCMGETGLP 455

Query: 435 IVDAIMRKLLYTGYINNRSRMITASFLSKNLLIDWRWGERWFMKHLIDGDSSSNVGGWGF 494
           IVDAIMRKLLYTGYINNRSRMI ASFLSKNLL+DWRWGERWF KHL+D D +SN GGWGF
Sbjct: 456 IVDAIMRKLLYTGYINNRSRMIVASFLSKNLLVDWRWGERWFRKHLMDADLTSNSGGWGF 515

Query: 495 CSSTGIDAQPYFRVFNMDIQAKKYDPQMIFVKQWVPELIS-----------SENKRPENY 543
           CSSTGIDAQPYFR+FNM +Q++KYDP+  FVK+W+PEL +           +       Y
Sbjct: 516 CSSTGIDAQPYFRIFNMKLQSEKYDPKGAFVKEWIPELRNINDVKILREGLANQPSVNGY 575

Query: 544 PKPLVDLKHSRE 555
           PKP+VDLK SRE
Sbjct: 576 PKPIVDLKESRE 587

>KLLA0D00462g 41415..43202 similar to sp|P05066 Saccharomyces
           cerevisiae YOR386w PHR1 deoxyribodipyrimidine
           photo-lyase singleton, hypothetical start
          Length = 595

 Score =  509 bits (1310), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 261/584 (44%), Positives = 363/584 (62%), Gaps = 56/584 (9%)

Query: 21  IEHDFEQYHSLNKKYYPRPITRTGANQFNNKSRAKPMEIV-EKLQKKQKTSFENVST--- 76
           I+ +  +  S N  YY  PIT   AN+FNN  R +P+ ++ + +    K S + +     
Sbjct: 9   IKKNVSECLSPNPVYYRNPITFKKANEFNNGKRERPLALLGDSIHADSKNSRQQLDDTVD 68

Query: 77  ---VMHWFRNDLRLYDNVGLYKSVALFQQLRQKNAKAKLYAVYVINEDDWRAHMDSGWKL 133
              V+HWFR DLR+ DN GL  + AL Q     +    + A+YVINE DW AHM+SGWKL
Sbjct: 69  NRLVIHWFRGDLRVRDNTGL--AYALNQ-----SKSGSVEALYVINEHDWIAHMESGWKL 121

Query: 134 MFIMGALKNLQQSLAELHIPLLLWEFHTPKSTLSNSKEFVEFF----------------- 176
            F + AL++L + LA+L + L +  F      LSNS+E+ ++F                 
Sbjct: 122 KFQLDALRSLSRELAKLGVRLHVKYFIPESPCLSNSREYAQWFSHIIEEIAASKNYDGNS 181

Query: 177 -------------------KEKCMNVSSGTGTI-ITANIEYQTDELYRDIRLLE-----N 211
                              K+   N   G+  I +TAN++Y+ DELYRD+++       +
Sbjct: 182 KDDTKDDTDADEPALKKRKKDNDENQKGGSPNILVTANLQYEVDELYRDLKICRLQTQSS 241

Query: 212 EDHRLQLKYYHDSCIVAPGLITTDRGTNYSVFTPWYKKWVLYVNNYKKSTSEICHLHIIE 271
                 LK +HD CI+ PG++ T +G+ Y++FTPWYKKWV ++   +K    IC    I 
Sbjct: 242 NSANFTLKLFHDMCIIEPGILKTGKGSQYTIFTPWYKKWVSFLEANQKDKHTICIEASIP 301

Query: 272 PLKYNETFELKPFQYSLPDEFLQYIPKSKWCLPDVSEEAALSRLKDFLGTKSSKYNNEKD 331
                E    +  +Y LPD+F+  +P+    +P   EE AL +L +F+  ++SKYNN+KD
Sbjct: 302 QSSNREKVNPEEIKYQLPDKFMSEMPEQTLNIPKADEETALKKLTEFISKRASKYNNDKD 361

Query: 332 MLYLGGTSGLSVYITTGRISTRLIVNQAFQSCNGQIMSKALKDNSSTQNFIKEVAWRDFY 391
           +L L GTS LS Y+T+G IS R I+NQ++Q+ N ++M+K +K N+S + FIKEVAWRDFY
Sbjct: 362 LLDLTGTSLLSCYVTSGVISARTILNQSYQANNSRLMNKDIKKNNSLETFIKEVAWRDFY 421

Query: 392 RHCMCNWPYTSMGMPYRLDTLDIKWENNPVAFEKWCTGNTGIPIVDAIMRKLLYTGYINN 451
           +H +  WP+ SM +P++ +TL+IKWEN+   FEKWC G TGIPIVDAIM K+L TGYINN
Sbjct: 422 KHAISYWPFLSMDLPFKFETLNIKWENDVFLFEKWCYGETGIPIVDAIMLKMLKTGYINN 481

Query: 452 RSRMITASFLSKNLLIDWRWGERWFMKHLIDGDSSSNVGGWGFCSSTGIDAQPYFRVFNM 511
           RSRMITASFL+KNLLIDWRWGERWF KHLID D++SNVGGWGFC+STGID QPYFRVFNM
Sbjct: 482 RSRMITASFLAKNLLIDWRWGERWFRKHLIDYDTASNVGGWGFCASTGIDCQPYFRVFNM 541

Query: 512 DIQAKKYDPQMIFVKQWVPELISSENKRPENYPKPLVDLKHSRE 555
            +Q++KYDP+  F++ W+    +  +   E  P  +VDL+ SRE
Sbjct: 542 KLQSEKYDPEGKFIRHWLENDENDSDNVHEPKPNAIVDLRDSRE 585

>Kwal_23.5130
          Length = 479

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 41/87 (47%), Gaps = 6/87 (6%)

Query: 251 VLYVNNYKKSTSEICHLHIIEPLKYNETFELKPFQYSLPDEFLQYIPKSKWCLPDVSEEA 310
           V+Y+N +K +  ++C    I     N TFE  PFQ SL     +   +S   LP+  E +
Sbjct: 6   VIYMN-FKSTKKKVCSSQKI----INRTFEPGPFQMSLISRIFRLGKRSPATLPEQHEYS 60

Query: 311 ALSRLKDFLGTKSSKYNNEKDMLYLGG 337
             +R ++ +       N++K  L  GG
Sbjct: 61  KWTR-EELIQKVVELENDKKRNLEEGG 86

>AER051C [2556] [Homologous to ScYDL060W (TSR1) - SH]
           (731793..734126) [2334 bp, 777 aa]
          Length = 777

 Score = 30.0 bits (66), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 82  RNDLRLYDNVGLYKSVALFQQLRQKNAKAKLYAVYVINEDDWRAHMDSGWKLMFIMGALK 141
           ++DL   D + L  S +  ++L++      L+   V N D+   H  S WK M  +G+ K
Sbjct: 467 KDDLEFPDEIELDPSESAIERLKRYRGLKNLHNC-VWNVDEQDPHCPSEWKRMLRIGSYK 525

Query: 142 NLQ 144
           NL+
Sbjct: 526 NLK 528

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,913,239
Number of extensions: 928138
Number of successful extensions: 2455
Number of sequences better than 10.0: 13
Number of HSP's gapped: 2507
Number of HSP's successfully gapped: 14
Length of query: 555
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 448
Effective length of database: 12,891,983
Effective search space: 5775608384
Effective search space used: 5775608384
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)