Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR329C (SCD5)87285736820.0
Scas_663.2473758310041e-124
CAGL0E05302g8295639391e-113
Kwal_26.70526325248063e-96
KLLA0F02596g6585256851e-78
ADR356C8064266122e-67
YPL023C (MET12)657112731.5
Sklu_2257.3144528703.2
CAGL0L12188g1398122694.2
YGL229C (SAP4)81887695.0
KLLA0D13398g132455685.4
YIR006C (PAN1)148028669.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR329C
         (857 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR329C (SCD5) [5110] chr15 complement(936726..939344) Multicopy...  1422   0.0  
Scas_663.24                                                           391   e-124
CAGL0E05302g complement(514064..516553) weakly similar to sp|P34...   366   e-113
Kwal_26.7052                                                          315   3e-96
KLLA0F02596g 235864..237840 some similarities with sp|P34758 Sac...   268   1e-78
ADR356C [2097] [Homologous to ScYOR329C (SCD5) - SH] (1333929..1...   240   2e-67
YPL023C (MET12) [5414] chr16 complement(504335..506308) Methylen...    33   1.5  
Sklu_2257.3 YIR006C, Contig c2257 2908-7245                            32   3.2  
CAGL0L12188g 1308672..1312868 similar to tr|Q12267 Saccharomyces...    31   4.2  
YGL229C (SAP4) [1769] chr7 complement(64502..66958) Member of th...    31   5.0  
KLLA0D13398g 1153371..1157345 some similarities with sp|P32521 S...    31   5.4  
YIR006C (PAN1) [2671] chr9 complement(365463..369905) Protein in...    30   9.5  

>YOR329C (SCD5) [5110] chr15 complement(936726..939344) Multicopy
           suppressor of lethality caused by clathrin deficiency
           [2619 bp, 872 aa]
          Length = 872

 Score = 1422 bits (3682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 736/857 (85%), Positives = 736/857 (85%)

Query: 1   MSFDWLNVPGLDLSSGDQAEKRPSNGLGPPSVSFDFGINTAAPHDSSFWDQGSRSHSDTT 60
           MSFDWLNVPGLDLSSGDQAEKRPSNGLGPPSVSFDFGINTAAPHDSSFWDQGSRSHSDTT
Sbjct: 1   MSFDWLNVPGLDLSSGDQAEKRPSNGLGPPSVSFDFGINTAAPHDSSFWDQGSRSHSDTT 60

Query: 61  LSYRNNHSNTAADNATNVSSPQKDNPPNGEVRTLSGGDVYAESPEDMQVPLSLSQNQLTH 120
           LSYRNNHSNTAADNATNVSSPQKDNPPNGEVRTLSGGDVYAESPEDMQVPLSLSQNQLTH
Sbjct: 61  LSYRNNHSNTAADNATNVSSPQKDNPPNGEVRTLSGGDVYAESPEDMQVPLSLSQNQLTH 120

Query: 121 EEIRTYLRWYHYICLRTHGKLVRLNDVFRFLTNFNLSQKVKDRIVEIFRSCKNALNIGQF 180
           EEIRTYLRWYHYICLRTHGKLVRLNDVFRFLTNFNLSQKVKDRIVEIFRSCKNALNIGQF
Sbjct: 121 EEIRTYLRWYHYICLRTHGKLVRLNDVFRFLTNFNLSQKVKDRIVEIFRSCKNALNIGQF 180

Query: 181 FAVLRLVSRAIIYGILPLRRMILEKAPVPKPRPILXXXXXXXXXXXXXXXXXXAKTGDQK 240
           FAVLRLVSRAIIYGILPLRRMILEKAPVPKPRPIL                  AKTGDQK
Sbjct: 181 FAVLRLVSRAIIYGILPLRRMILEKAPVPKPRPILSSENHEEVYEEVEDDDSSAKTGDQK 240

Query: 241 VDFDSFASXXXXXXXXXXXXXXXXXNLNFKSKKVRFSEHITFQDPPNLNQESSNNSEARK 300
           VDFDSFAS                 NLNFKSKKVRFSEHITFQDPPNLNQESSNNSEARK
Sbjct: 241 VDFDSFASLLLTGKTTRKRVRRRIKNLNFKSKKVRFSEHITFQDPPNLNQESSNNSEARK 300

Query: 301 QDPDAEDEDQDSNNDSPLDFTLPMDQLLKRLYKRRKNSGLVSSLPSEQQETEEEKKVLED 360
           QDPDAEDEDQDSNNDSPLDFTLPMDQLLKRLYKRRKNSGLVSSLPSEQQETEEEKKVLED
Sbjct: 301 QDPDAEDEDQDSNNDSPLDFTLPMDQLLKRLYKRRKNSGLVSSLPSEQQETEEEKKVLED 360

Query: 361 MKDSLSHFKQIQTVDSASLPISSVFLQNGNTLPTSNVNNTTVPQQLPLEPLKPTATGSAN 420
           MKDSLSHFKQIQTVDSASLPISSVFLQNGNTLPTSNVNNTTVPQQLPLEPLKPTATGSAN
Sbjct: 361 MKDSLSHFKQIQTVDSASLPISSVFLQNGNTLPTSNVNNTTVPQQLPLEPLKPTATGSAN 420

Query: 421 HLVREEYNQGLHPSNGAIQTGLQPLKPTATGSANYLMRSHMEQPQSIKPSSTPETVTNSG 480
           HLVREEYNQGLHPSNGAIQTGLQPLKPTATGSANYLMRSHMEQPQSIKPSSTPETVTNSG
Sbjct: 421 HLVREEYNQGLHPSNGAIQTGLQPLKPTATGSANYLMRSHMEQPQSIKPSSTPETVTNSG 480

Query: 481 GLQPLKPTATGSANYLMKQHISPSVNNPVSSMFQAQFTNQSSSPQSTGPAFLNSPNITLP 540
           GLQPLKPTATGSANYLMKQHISPSVNNPVSSMFQAQFTNQSSSPQSTGPAFLNSPNITLP
Sbjct: 481 GLQPLKPTATGSANYLMKQHISPSVNNPVSSMFQAQFTNQSSSPQSTGPAFLNSPNITLP 540

Query: 541 QSNQQQPYQEVNPTQAKIEPSNISPQHTYSNNVRINNGNIVSMPKVEITGAFPPQNTLPQ 600
           QSNQQQPYQEVNPTQAKIEPSNISPQHTYSNNVRINNGNIVSMPKVEITGAFPPQNTLPQ
Sbjct: 541 QSNQQQPYQEVNPTQAKIEPSNISPQHTYSNNVRINNGNIVSMPKVEITGAFPPQNTLPQ 600

Query: 601 HQQSHLLSPQNTIPQHQRSQLISPQNTFTQNQPILSPQHTYSNNQATMISXXXXXXXXXX 660
           HQQSHLLSPQNTIPQHQRSQLISPQNTFTQNQPILSPQHTYSNNQATMIS          
Sbjct: 601 HQQSHLLSPQNTIPQHQRSQLISPQNTFTQNQPILSPQHTYSNNQATMISPQNTYTNNQQ 660

Query: 661 XXXXXXXXXXXXXXXXXXXXXXXXXHMYSNVQKQNNLVPTQPSYTNSPSIQSPNFLSPQN 720
                                    HMYSNVQKQNNLVPTQPSYTNSPSIQSPNFLSPQN
Sbjct: 661 QPQHLPPPPPPRAQQQQQGAIVPPQHMYSNVQKQNNLVPTQPSYTNSPSIQSPNFLSPQN 720

Query: 721 AANSYFQXXXXXXXXXXXXXXXXXXVNGNNASNGISSFQNTSAAMNNTQSHXXXXXXXXX 780
           AANSYFQ                  VNGNNASNGISSFQNTSAAMNNTQSH         
Sbjct: 721 AANSYFQSLLSSSPSPNPTPSNASTVNGNNASNGISSFQNTSAAMNNTQSHQTYIQQQQQ 780

Query: 781 XXXXXXXXXXXLSQMQQHPGQLHLNNSDIHSQPNKPNYGMLGXXXXXXXXXXXXXFPFTA 840
                      LSQMQQHPGQLHLNNSDIHSQPNKPNYGMLG             FPFTA
Sbjct: 781 QQTQQRIYGGQLSQMQQHPGQLHLNNSDIHSQPNKPNYGMLGQQVHQQQQQQQQQFPFTA 840

Query: 841 DVNRSNSSDILGNLQSL 857
           DVNRSNSSDILGNLQSL
Sbjct: 841 DVNRSNSSDILGNLQSL 857

>Scas_663.24
          Length = 737

 Score =  391 bits (1004), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 272/583 (46%), Positives = 340/583 (58%), Gaps = 95/583 (16%)

Query: 1   MSFDWLNVPGLDLSSGDQAEKRPSNG-------------LGPPSVSFDFGI-----NTAA 42
           MSFDWLN+PGL+           + G             LGPPSVSFDFG      NT  
Sbjct: 1   MSFDWLNIPGLNTEDNTNINNNNNTGASTNNGPGGLNGSLGPPSVSFDFGFPMNGNNTGL 60

Query: 43  PHDSSFWDQGSRSHSDTTLSYRNNHSNTAADNATNVSSPQKDNPPNGEVRTLSGGDVYAE 102
           P      DQ  RS SDT++    N S+T A     VS                    Y+E
Sbjct: 61  PT----MDQSVRSQSDTSIV---NMSSTDA-----VSD-------------------YSE 89

Query: 103 SPEDMQVPLSLSQNQLTHEEIRTYLRWYHYICLRTHGKLVRLNDVFRFLTNFNLSQKVKD 162
           + +D++VPLSLSQ QLT+EE+RTYLRWY+YI  +THGKLVRL DVF+FL NFN++ ++K+
Sbjct: 90  TSDDLRVPLSLSQTQLTNEELRTYLRWYNYIIAKTHGKLVRLMDVFKFLCNFNITDQLKN 149

Query: 163 RIVEIFRSCKNALNIGQFFAVLRLVSRAIIYGILPLRRMILEKAPVPKPRPILXXXXXXX 222
           RI+ IFRSCKNALNIGQFFAVLRLVS+A++  +LP R+MIL+KAP+PKP+PI+       
Sbjct: 150 RIMAIFRSCKNALNIGQFFAVLRLVSKALLQNVLPTRKMILDKAPIPKPKPIITISTDND 209

Query: 223 XXXXXXXXXXX------AKTGDQKVDFDSFASXXXXXXXXXXXXXXXXXNLNFKSKKVRF 276
                                + KVDFDSF S                 N  FK+K+VRF
Sbjct: 210 QEVYEEVDEDTPNTANGNNNENGKVDFDSFTSLLLTGRTARKRIRRKIKNAVFKNKRVRF 269

Query: 277 SEHITFQDPPN--------------LNQESSNNSEARKQDPDAEDEDQDSNNDSPLDFTL 322
           +EHITFQ+PP               LNQ ++NN+          D+   +    PLD +L
Sbjct: 270 AEHITFQEPPKPNSGNENNNNNAMILNQTTNNNN---------MDDSSSAVPQGPLDLSL 320

Query: 323 PMDQLLKRLYKRRK-NSGLVSSLPSEQQETEEEKKVLEDMKDSLSHFKQIQTVDSAS-LP 380
           PMDQLLK++  R+K NS LVS+LP+EQQETEEEK+VLEDMKDSLSHFK I TVDSA+ LP
Sbjct: 321 PMDQLLKQMALRKKNNSALVSTLPNEQQETEEEKEVLEDMKDSLSHFKNITTVDSATLLP 380

Query: 381 ISSVFLQNGNTLPTSNVNNTTVPQ--QLPLEPLKPTATGSANHLVREEYNQGLHPSNGAI 438
            S+  +Q       +N  N   P   Q+PL+PLKPTATGSANHL R+E+ Q  +P + + 
Sbjct: 381 DSTSTMQPMYMNNENNALNQNNPSMNQVPLQPLKPTATGSANHLFRQEFAQNTNPISDSN 440

Query: 439 QTGLQPLKPTATGSANYLMRSHMEQPQSIKPSSTPETV-----TNSGGLQPLKPTATGSA 493
           Q  LQPLKPTATGSANYL RS+ EQP   + +   +       +N   LQ L PTATGSA
Sbjct: 441 QMPLQPLKPTATGSANYLFRSYFEQPTQNQTTQQAQPPQTNNNSNMNTLQ-LHPTATGSA 499

Query: 494 NYLMKQHI---SPSVNNPVSSMFQAQFTNQSSSPQSTGPAFLN 533
           NYLMKQ     S  + N  S +   Q  N   SPQ+TG  F+N
Sbjct: 500 NYLMKQQGPTPSQGIRNETSPI---QTPNIFVSPQTTG-QFMN 538

>CAGL0E05302g complement(514064..516553) weakly similar to sp|P34758
           Saccharomyces cerevisiae YOR329c SCD5 suppressor of
           clathrin deficiency, start by similarity
          Length = 829

 Score =  366 bits (939), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 240/563 (42%), Positives = 320/563 (56%), Gaps = 93/563 (16%)

Query: 1   MSFDWLNVPGLDLSSGDQAEKRPSNGLGPPSVSFDFGI--NTAAPHDSSFWDQGSRSHSD 58
           MSFDWLNVPGL+ ++ D    R ++ L  P+VSFDFG+  +++      F D+  +S SD
Sbjct: 1   MSFDWLNVPGLNTATDD----RQNSTL--PTVSFDFGVTDDSSKEQGMHFLDETMKSSSD 54

Query: 59  TTLSYRNNHSNTAAD-----------------------------NATNVSSPQKDNPPNG 89
            +L  + + +N+  D                               +N++  +  NP + 
Sbjct: 55  PSLVRKLDEANSKLDVPPVSGAYLQQNGLHRSQEALATEEDHKTQKSNINGNRYHNPIHE 114

Query: 90  EVRTLSGGDVYAESPEDMQVPLSLSQNQLTHEEIRTYLRWYHYICLRTHGKLVRLNDVFR 149
           E       D Y E+P+D++VPLSLSQNQLTHEE+RTY+RWY+YI  RTHGKL++L DVF+
Sbjct: 115 E------EDSYVETPDDLRVPLSLSQNQLTHEELRTYIRWYNYITARTHGKLIKLADVFQ 168

Query: 150 FLTNFNLSQKVKDRIVEIFRSCKNALNIGQFFAVLRLVSRAIIYGILPLRRMILEKAPVP 209
           FL NFN+ +++K RI +IFRSCKNALNIGQFFAVLRL++RA++  +LP R+MILEKAP+P
Sbjct: 169 FLANFNVREELKKRIFKIFRSCKNALNIGQFFAVLRLLARAMLEDMLPSRKMILEKAPIP 228

Query: 210 KPRPILXXXXXXXXXXXXXXXXXXAKTG---------DQKVDFDSFASXXXXXXXXXXXX 260
           +PRPIL                  A +G          +KVDFDSFAS            
Sbjct: 229 RPRPILNKEGGNEFYEEVEEDVP-ASSGTTTSNNQPPGEKVDFDSFASLLLTGKTVRKRI 287

Query: 261 XXXXXNLNFKSKKVRFSEHITFQDPPNLNQESSNNSEARKQDPDAEDEDQDSNNDSPLDF 320
                N  FK+KKVRF+E +TFQD P+  ++  N    +      +D+    + D PLD 
Sbjct: 288 RRKVKNSVFKNKKVRFAEKVTFQDAPHYGKDKQN----KDTSTTTDDDSSYVSTDEPLDL 343

Query: 321 TLPMDQLLKRLYKRRKNSGLVSSLPSEQQETEEEKKVLEDMKDSLSHFKQIQTVDSA--- 377
           +LPMDQLLK + KR+KNS LVSS+P+EQQETEEE+++L DMKDSLSHFKQIQ  DS    
Sbjct: 344 SLPMDQLLKVIAKRKKNSALVSSVPTEQQETEEEREILSDMKDSLSHFKQIQGPDSVTQI 403

Query: 378 ---------SLPISSVFLQNGNTLPTSNVNNTTVPQQLPLEPLKPTATGSANHLVREEYN 428
                    S   ++ +   G+  P      T+ PQ+  LEPLKPTATGSANHL++   +
Sbjct: 404 PPLVAQGQQSTIFNTGYKVTGDQPP---AQTTSQPQEPVLEPLKPTATGSANHLMKSHMS 460

Query: 429 QGLHPSNG--------AIQTG----LQPLKPTATGSANYLMRSHMEQPQSIKPSSTPETV 476
               P           AIQ      L+PLKPTATGSANYLM+      Q  KP    +T 
Sbjct: 461 PNSIPGAFDSQPVQVPAIQATSSDVLEPLKPTATGSANYLMK------QQFKPVDNQQTS 514

Query: 477 TNSGGL---QPLKPTATGSANYL 496
            N G +   QP+  T   + N L
Sbjct: 515 GNIGHVASPQPVGVTFQSTGNQL 537

>Kwal_26.7052
          Length = 632

 Score =  315 bits (806), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 216/524 (41%), Positives = 291/524 (55%), Gaps = 65/524 (12%)

Query: 1   MSFDWLNVPGLDLSSGDQAEKRPSNGLGPPSVSFDFGINTAAPHDSSFWDQGSRSHSDTT 60
           MSFDWLNVPGL    GD A         PPSVSF+FG  +  P +        RS S TT
Sbjct: 1   MSFDWLNVPGLPSDDGDYA----GASEPPPSVSFNFGNVSLEPVEQ-------RSQSITT 49

Query: 61  LSYRNNHSNTAADNATNVSSPQKDNPPNGEVRTLSGGDVYAESPEDMQVPLSLSQNQLTH 120
             +   +S      A+ VS+  +D+  +GE + ++    YAE+ ED+QVPLSLS++QLT 
Sbjct: 50  TKHDRVNS---THEASQVSNRTQDH--HGESQLVN----YAETKEDLQVPLSLSKSQLTR 100

Query: 121 EEIRTYLRWYHYICLRTHGKLVRLNDVFRFLTNFNLSQKVKDRIVEIFRSCKNALNIGQF 180
           EE RTYLRWY YI  R   KL+ L+D+FRF+ NF L++  K+RI  IF++C+N+LNIGQF
Sbjct: 101 EEARTYLRWYGYISSRKEAKLISLDDIFRFMGNFPLAEMAKERIERIFKTCRNSLNIGQF 160

Query: 181 FAVLRLVSRAIIYGILPLRRMILEKAPVPKPRPILXXXXXXXXXXXXXXXXXXAKTGDQ- 239
           FA+LRL+SRA+   ++P+RRMI + APVPKP+ IL                  ++ G + 
Sbjct: 161 FAILRLISRALTENVMPMRRMISQAAPVPKPKSIL-----AAGNEEVYEEVEDSQDGPEL 215

Query: 240 KVDFDSFASXXXXXXXXXXXXXXXXXNLNFKSKKVRFSEH-ITFQDPPNLNQESSNNSEA 298
           KVDFDSFAS                 N + K K+VRF++  +TFQD              
Sbjct: 216 KVDFDSFAS-LLLTGQKKKKMRRRITNHHKKQKRVRFTDKLVTFQD-----------HAQ 263

Query: 299 RKQDPDAEDEDQDSNNDSPLDFTLPMDQLLKRLYKRRKNSGLVSS-LPSEQQETEEEKKV 357
            K D +A + +   +++ PLD +LPMDQLLK+L  RR NS LVS     ++ E++EEK+V
Sbjct: 264 PKTDENASEGNGVPDDNEPLDLSLPMDQLLKKLAARRNNSALVSKPPSEQEPESQEEKEV 323

Query: 358 LEDMKDSLSHFKQIQTVDSASLPISSVFLQNGNTLPTSNVNNTTVPQQLPLEPLKPTATG 417
           L+DM++SL+HF+QI  VDS S+         G     S V    V +   LEPLKPTATG
Sbjct: 324 LDDMRESLNHFQQIHNVDSVSV--------GGLPAQVSTVQKNAVAENH-LEPLKPTATG 374

Query: 418 SANHLVREEYNQGLHPSNGAIQTGLQPLKPTATGSANYLMRSHMEQP-----QSIKPSST 472
           SAN+L R    Q        I   LQPLKPTATGSANYL RS  +       + ++P  T
Sbjct: 375 SANYLFRSSQQQT---PQVTISEPLQPLKPTATGSANYLFRSSQQSAPAADQKPLQPIKT 431

Query: 473 PETVTNSGGLQPLKP--------TATGSANYLMKQHISPSVNNP 508
                    LQPL+P        T T + ++   Q + P+   P
Sbjct: 432 NGADQAPNFLQPLQPNISSKSSQTGTPAMHHFSGQPLQPTAQQP 475

>KLLA0F02596g 235864..237840 some similarities with sp|P34758
           Saccharomyces cerevisiae YOR329c SCD5 suppressor of
           clathrin deficiency singleton, hypothetical start
          Length = 658

 Score =  268 bits (685), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 195/525 (37%), Positives = 277/525 (52%), Gaps = 47/525 (8%)

Query: 1   MSFDWLNVPGLDLSSGDQAEKRPSNGLGPPSVSFDFGINTAAPHDSSFWDQGSRSHSDTT 60
           MSFDWLNVPGLD+S+  QA    S+     S SF        P +               
Sbjct: 1   MSFDWLNVPGLDISNDSQASVSSSSPPPAVSFSFTTADRPQEPSNLQQPQSQQSLRG--- 57

Query: 61  LSYRNNHSNTAADNATNVSSPQ-KDNPPNGEVRTLSGGDV---YAESPEDMQVPLSLSQN 116
              R  +  T + + +N    Q K +  +G + + S  D+   Y E+ +++QVPL++ + 
Sbjct: 58  ---REGNKLTVSGSTSNFQDSQSKSHTIDGALHSHSESDIASSYVETAQELQVPLAVPEF 114

Query: 117 QLTHEEIRTYLRWYHYICLRTHGKLVRLNDVFRFLTNFNLSQKVKDRIVEIFRSCKNALN 176
           QLT +E + YLRW+  +  R H + + L+DVF FL NF +   +K+RI  IFR+C+ A+N
Sbjct: 115 QLTPDERKAYLRWFRDLSSRIHSRPITLDDVFNFLANFRIDDTIKERITHIFRTCRYAVN 174

Query: 177 IGQFFAVLRLVSRAIIYGILPLRRMILEKAPVPKPRPILXXXXXXXXXXXXXXXXXXAKT 236
             QF+A++RLV+  +    LP R MI EKAPV +P+ IL                  A  
Sbjct: 175 EEQFYAIIRLVAHGLQQHFLPTRSMIPEKAPVLRPKSILSANAGQEVYEEVEEDPNNAT- 233

Query: 237 GDQKVDFDSFASXXXXXXXXXXXXXXXXXNLNFKSKKVRFSEH-ITFQDPPNLNQESSNN 295
            D+KVDFD FAS                     + KKVRFS++ +TF +  +    SS +
Sbjct: 234 -DKKVDFDGFASLLLTGKAIQKNIRRRIMKRRDQIKKVRFSKNLVTFANDLSTKAMSSIS 292

Query: 296 SEARKQ--DPD-AEDEDQDSNNDSPLDFTLPMDQLLKRLYKR-RKNSGLVSSLPSEQQ-E 350
              +     PD A   +   ++DS LD +LPM+QLL +L  R R NS LV  LPS+ Q E
Sbjct: 293 RSGKPAVTAPDNAASTESSPSDDSTLDLSLPMEQLLAKLSSRNRNNSALVKELPSDTQPE 352

Query: 351 TEEEKKVLEDMKDSLSHFKQIQTVDSAS-LPISSVFLQNGNTLPTSNVNNTTVPQQLPLE 409
           T+EE++VLEDMKDSLSHF+QIQ VDS + LP +           +S  ++ +  ++  LE
Sbjct: 353 TQEEREVLEDMKDSLSHFRQIQKVDSVTQLPNNM----------SSYESSNSSGREQALE 402

Query: 410 PLKPTATGSANHLVRE----EYNQGLHPSNGAIQTGLQPLKPTATGSANYLMR------- 458
           PLKPTATGSAN+L R+     +N   + ++  I   L+PLKPTATGSAN + +       
Sbjct: 403 PLKPTATGSANYLFRQTVPPSHNIDANKNDNHI---LEPLKPTATGSANEIFKNIFRRSK 459

Query: 459 --SHMEQPQSIKPSSTPETVTNSGGLQPLKPTATGSANYLMKQHI 501
              H+ Q     P   P+        + +KPT+TGSANYLMKQ  
Sbjct: 460 PAEHLPQQGRTAPFVPPQRKVQ--FTEAMKPTSTGSANYLMKQQF 502

>ADR356C [2097] [Homologous to ScYOR329C (SCD5) - SH]
           (1333929..1336349) [2421 bp, 806 aa]
          Length = 806

 Score =  240 bits (612), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 158/426 (37%), Positives = 220/426 (51%), Gaps = 68/426 (15%)

Query: 1   MSFDWLNVPGLDLSSGDQAEKRPSNGLGPPSVSFDFGINTAAPHDSSFWDQGSRSHSDTT 60
           MSFDWLNVPGL++  G ++    +    PP+VSF+F                        
Sbjct: 1   MSFDWLNVPGLNVKDGPESS---AGSAPPPTVSFNF------------------------ 33

Query: 61  LSYRNNHSNTAADNATNVSSPQKDNPPNGEVRTLSGGDVYAESPEDMQVPLSLSQNQLTH 120
                             S  Q+++   G  RT    + Y E+ ED++VPLSLS +QL  
Sbjct: 34  ------------------SEEQREDESAGR-RTQDTQEEYRETAEDLRVPLSLSGSQLAP 74

Query: 121 EEIRTYLRWYHYICLRTHGKLVRLN-DVFRFLTNFNLSQKVKDRIVEIFRSCKNALNIGQ 179
           EE++TY  WY  +  R   + +RL  D+FRFL NF LS  VK+R   IFR+C+ A++ GQ
Sbjct: 75  EELKTYRLWYKCMVSRRRSRTLRLEEDIFRFLGNFQLSDSVKERTRSIFRTCQMAVSPGQ 134

Query: 180 FFAVLRLVSRAIIYGILPLRRMILEKAPVPKPRPILXXXXXXXXXXXXXXXXXXAKTGDQ 239
           F+A++R ++ A+   +LP RRMILE+A VP+PR IL                  A   D 
Sbjct: 135 FYAIMRTIAHALQANVLPTRRMILERAAVPEPRSILSLDAGPETYEEVEEDPKSA--ADN 192

Query: 240 KVDFDSFASXXXXXXXXXXXXXXXXXNLNFKSKKVRFSEHITFQDPPNLNQESSNNSEAR 299
           +VDFDSFAS                   N + KKV FSE++        ++E      A 
Sbjct: 193 RVDFDSFASLLLTGKTVRKNIRRKINKRNGRVKKVSFSENLV-----TFHEELPEEEAAE 247

Query: 300 KQDPDAEDEDQDSNNDSPLDFTLPMDQLLKRLYKRR-KNSGLVSSLPSEQQETEEEKKVL 358
                +ED ++      PLDF++PMDQLLK++ +R+ +N+ LVS  P +Q ET EE++ L
Sbjct: 248 DAADGSEDPNE------PLDFSMPMDQLLKKMAERKTRNTALVSEAP-KQPETVEEREEL 300

Query: 359 EDMKDSLSHFKQIQTVDSASLPISSVFLQNGNTLPTSNVNNTTVPQQLPLEPLKPTATGS 418
            DM+DSL+HFK IQT D+ +      F        +SN ++   P    LEPLKPTATGS
Sbjct: 301 ADMRDSLNHFKHIQTADNVA---QGSFATQYMASVSSNADSGEEPA---LEPLKPTATGS 354

Query: 419 ANHLVR 424
           ANHL R
Sbjct: 355 ANHLFR 360

>YPL023C (MET12) [5414] chr16 complement(504335..506308)
           Methylenetetrahydrofolate reductase (MTHFR), involved in
           methionine biosynthesis [1974 bp, 657 aa]
          Length = 657

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 48/112 (42%), Gaps = 3/112 (2%)

Query: 299 RKQDPDAEDEDQDSNNDSPLDFTLPMDQLLKRLYKRRKNSGLVSSLPSEQQETEEEKKVL 358
           R   P  ED     +N+SP  + + + + +K+ Y  +   G V++ P    E E E    
Sbjct: 108 RGDPPIGEDWLDSQSNESPFKYAVDLVRYIKQSYGDKFCVG-VAAYPEGHCEGEAEGHEQ 166

Query: 359 EDMKDSLSHFKQIQTVDSASLPISSVFLQNGNTLPTSNVNNTTVPQQLPLEP 410
           + +KD L + K+ +    A   I+ +F      L    +    + Q LPL P
Sbjct: 167 DPLKD-LVYLKE-KVEAGADFVITQLFYDVEKFLTFEMLFRERISQDLPLFP 216

>Sklu_2257.3 YIR006C, Contig c2257 2908-7245
          Length = 1445

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 16/28 (57%)

Query: 404 QQLPLEPLKPTATGSANHLVREEYNQGL 431
           QQ PLEPLKPTATG  N       N  L
Sbjct: 155 QQQPLEPLKPTATGFVNSFANNGVNNDL 182

>CAGL0L12188g 1308672..1312868 similar to tr|Q12267 Saccharomyces
           cerevisiae YLR086w Stable Maintenance of Chromosomes,
           start by similarity
          Length = 1398

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 62/122 (50%), Gaps = 17/122 (13%)

Query: 333 KRRKNSGLVSSLPSEQQETEEEKKVLEDMKDSLSHFKQIQTV--DSASLPISSVFLQNGN 390
           K+ +N  +V++L S+++E EE+ K+L+D  +S     +IQT+  + +SL         G 
Sbjct: 443 KKVENEQIVNNLDSKRKEFEEQSKILQDKINSTDQ--EIQTIIEEQSSLA-------EGT 493

Query: 391 TLPTSNVNNTTVPQQLPLEPLKPTATGSANHLVRE--EYNQGLHPSNGAIQTGLQPLKPT 448
           T+ ++N++     ++  LE +K        HL  +  EY + L P N   Q   + +K T
Sbjct: 494 TVLSTNLD----IEKEKLENIKLKLREKTEHLTIQIAEYEKELSPWNEQSQQLKKEIKIT 549

Query: 449 AT 450
            +
Sbjct: 550 ES 551

>YGL229C (SAP4) [1769] chr7 complement(64502..66958) Member of the
           SAP family of proteins that associate with Sit4p [2457
           bp, 818 aa]
          Length = 818

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 37/87 (42%), Gaps = 24/87 (27%)

Query: 93  TLSGGDVYAESPE----------DMQVPL---SLSQNQLTHEEIRTYLRWYHYICLRTHG 139
            L GG   AES E          DM  P    ++ +N++ HEE            ++ H 
Sbjct: 737 ILGGGQFCAESDENTNQDFLEKADMSKPAHPSTMDENEIVHEE-----------DVKLHD 785

Query: 140 KLVRLNDVFRFLTNFNLSQKVKDRIVE 166
           K+  L D    LT  ++  K+KD IV+
Sbjct: 786 KVAELIDELGQLTELDIHDKIKDVIVD 812

>KLLA0D13398g 1153371..1157345 some similarities with sp|P32521
           Saccharomyces cerevisiae YIR006c PAN1 actin-cytoskeleton
           assembly protein singleton, hypothetical start
          Length = 1324

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 13/55 (23%)

Query: 379 LPISSVFLQNGNTLPTSNVNNTTVP----------QQLPLEPLKPTATGSANHLV 423
           +P+++ F Q    + T+ VN  T P          QQ PLEPLKPTATG  N   
Sbjct: 126 MPMNTSFNQG---MSTTAVNAPTGPLQPQQTGFYSQQQPLEPLKPTATGFINSFA 177

>YIR006C (PAN1) [2671] chr9 complement(365463..369905) Protein
           involved in organization of the actin cytoskeleton and
           in endocytosis, binds to the ARP2/3 complex to stimulate
           actin polymerization [4443 bp, 1480 aa]
          Length = 1480

 Score = 30.0 bits (66), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 17/28 (60%), Gaps = 4/28 (14%)

Query: 405 QLPLEPLKPTATGSANHLVREEYNQGLH 432
           Q PLEPLKPTATG  N       N GL+
Sbjct: 230 QAPLEPLKPTATGFVNSFA----NNGLN 253

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.126    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,038,301
Number of extensions: 1227730
Number of successful extensions: 7620
Number of sequences better than 10.0: 380
Number of HSP's gapped: 7449
Number of HSP's successfully gapped: 444
Length of query: 857
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 747
Effective length of database: 12,788,129
Effective search space: 9552732363
Effective search space used: 9552732363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)