Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR328W (PDR10)1564153678010.0
Scas_714.421520153254210.0
YOR153W (PDR5)1511150853710.0
CAGL0F02717g1542151053210.0
YDR406W (PDR15)1529150952860.0
CAGL0M01760g1499150752740.0
Scas_586.31531151352680.0
KLLA0F21692g1525150947570.0
Kwal_27.96661474145246360.0
KLLA0D03476g1560145539080.0
AGL142C1497143938130.0
ABR126W1512151337510.0
Kwal_27.1281791998728160.0
ABR125C1488134525850.0
YNR070W1333134325840.0
CAGL0I04862g1507140225800.0
YDR011W (SNQ2)1501140425770.0
Scas_716.811565140125740.0
Kwal_23.51611489133725710.0
KLLA0D03432g1483143925560.0
KLLA0B09702g1518140724340.0
CAGL0M07293g1515140824070.0
Kwal_26.671074078123320.0
YPL058C (PDR12)1511140923950.0
Kwal_26.670261757822950.0
Scas_632.2986155017960.0
Kwal_27.1282146642916390.0
Scas_717.6*1400135915910.0
Scas_716.8267562714241e-180
Scas_567.181064111641e-140
AFR326W1309137210031e-113
YIL013C (PDR11)14116489831e-110
CAGL0F01419g13986379801e-110
Scas_288.14944968941e-106
YOR011W (AUS1)13946309491e-106
Scas_643.112895759061e-101
Scas_145.1*2582388032e-97
Scas_108.13353416272e-72
Scas_167.1*2791885982e-69
Scas_522.76333405391e-57
Scas_664.274113405231e-57
AER190W10116115042e-51
KLLA0D04554g10225534935e-50
Kwal_0.32710196074802e-48
Scas_628.1310605694185e-41
CAGL0L07744g10552483846e-37
YCR011C (ADP1)10492723693e-35
Kwal_27.1271112465413687e-35
CAGL0I08019g12855213472e-32
Scas_710.506022543392e-32
KLLA0C04477g12535603444e-32
YOL075C12945773339e-31
Scas_566.14664143211e-30
Scas_202.11961522542e-24
Scas_40.12031742393e-22
YPL270W (MDL2)7732371565e-10
Sklu_2343.37742341521e-09
CAGL0A01133g8012361521e-09
ACR022W7542641493e-09
KLLA0D00748g7893381503e-09
Kwal_56.223297762311493e-09
Scas_468.16912361475e-09
YLR188W (MDL1)6952481413e-08
KLLA0C01991g7062401394e-08
Kwal_56.2384414942091371e-07
CAGL0E00385g6082081351e-07
Scas_693.4215122131361e-07
Scas_587.87152331351e-07
Kwal_26.94807192361342e-07
CAGL0M13739g7272191323e-07
AGL335W6912101314e-07
YMR301C (ATM1)6902021305e-07
Scas_574.87021761297e-07
KLLA0F20075g15162211298e-07
KLLA0A10131g7201751271e-06
Scas_612.11*15062401225e-06
CAGL0L06402g15352071182e-05
AGR047W14922241172e-05
CAGL0C03289g16482161172e-05
KLLA0E00462g16502421163e-05
Scas_622.916572051153e-05
YDR135C (YCF1)15152101144e-05
CAGL0E03982g16592471128e-05
Sklu_2316.113102051129e-05
AGL346W14001991092e-04
Kwal_34.1577014362441092e-04
YLL048C (YBT1)16611581064e-04
Scas_455.19251641046e-04
Kwal_33.1556112972101047e-04
KLLA0B14256g12711931039e-04
YKL209C (STE6)12902061039e-04
YLL015W (BPT1)15592201039e-04
YGR281W (YOR1)14772301010.001
AFR432W12842181000.002
CAGL0K00363g1227217970.004
AFR683C677248970.004
Scas_695.241288234960.006
Kwal_56.227471538246960.006
YHL035C1592225960.006
KLLA0D04059g1568239930.016
Scas_552.4720222910.019
CAGL0E03355g1535234890.038
Scas_707.8294155850.068
YDR091C608194860.089
YKR104W (NFT1)306224810.25
KLLA0A10857g752203800.41
AEL032W753191800.44
Kwal_33.13308706236800.48
Sklu_1870.3265148770.58
Scas_636.14608209780.80
Scas_706.21130441770.97
Scas_618.3793151771.0
KLLA0C17556g607194771.0
KLLA0F22451g45197761.1
KLLA0A01452g607171761.1
CAGL0G08041g607209761.2
AFL113C116347761.5
CAGL0J07788g130541761.5
CAGL0M05753g56893751.5
Kwal_14.1242269185731.7
Kwal_34.1624075238751.7
YOR341W (RPA190)1664166751.8
AFR637W129631752.0
Scas_712.29610180742.0
YNL250W (RAD50)131241742.4
KLLA0C02915g129631732.8
Kwal_33.13526129831732.8
ACL072C1627217724.1
CAGL0K12474g294174704.7
YDR061W539182715.0
Kwal_26.8730831171705.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR328W
         (1536 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR328W (PDR10) [5109] chr15 (931798..936492) Member of ATP-bind...  3009   0.0  
Scas_714.42                                                          2092   0.0  
YOR153W (PDR5) [4952] chr15 (619840..624375) Drug-efflux pump in...  2073   0.0  
CAGL0F02717g 261361..265989 tr|O74208 Candida glabrata ATP-bindi...  2054   0.0  
YDR406W (PDR15) [1232] chr4 (1279198..1283787) Member of ATP-bin...  2040   0.0  
CAGL0M01760g 203616..208115 highly similar to sp|P33302 Saccharo...  2036   0.0  
Scas_586.3                                                           2033   0.0  
KLLA0F21692g complement(2014152..2018729) gi|14571818|gb|AAK6729...  1837   0.0  
Kwal_27.9666                                                         1790   0.0  
KLLA0D03476g 296287..300969 similar to sp|P33302 Saccharomyces c...  1509   0.0  
AGL142C [4170] [Homologous to ScYPL058C (PDR12) - NSH] (434247.....  1473   0.0  
ABR126W [718] [Homologous to ScYOR153W (PDR5) - NSH; ScYDR406W (...  1449   0.0  
Kwal_27.12817                                                        1089   0.0  
ABR125C [717] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W ...  1000   0.0  
YNR070W (YNR070W) [4653] chr14 (765372..769373) Probable multidr...   999   0.0  
CAGL0I04862g complement(438338..442861) highly similar to sp|P32...   998   0.0  
YDR011W (SNQ2) [865] chr4 (465916..470421) Drug-efflux pump invo...   997   0.0  
Scas_716.81                                                           996   0.0  
Kwal_23.5161                                                          994   0.0  
KLLA0D03432g 287805..292256 similar to sp|P32568 Saccharomyces c...   989   0.0  
KLLA0B09702g complement(842245..846801) highly similar to sp|Q02...   942   0.0  
CAGL0M07293g complement(733072..737619) similar to sp|Q02785 Sac...   931   0.0  
Kwal_26.6710                                                          902   0.0  
YPL058C (PDR12) [5383] chr16 complement(445837..450372) Protein ...   927   0.0  
Kwal_26.6702                                                          888   0.0  
Scas_632.29                                                           696   0.0  
Kwal_27.12821                                                         635   0.0  
Scas_717.6*                                                           617   0.0  
Scas_716.82                                                           553   e-180
Scas_567.1                                                            452   e-140
AFR326W [3518] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W...   390   e-113
YIL013C (PDR11) [2652] chr9 complement(328205..332440) Membrane ...   383   e-110
CAGL0F01419g complement(142623..146819) highly similar to tr|Q08...   382   e-110
Scas_288.1                                                            348   e-106
YOR011W (AUS1) [4826] chr15 (349678..353862) Protein involved in...   370   e-106
Scas_643.1                                                            353   e-101
Scas_145.1*                                                           313   2e-97
Scas_108.1                                                            246   2e-72
Scas_167.1*                                                           234   2e-69
Scas_522.7                                                            212   1e-57
Scas_664.27                                                           206   1e-57
AER190W [2692] [Homologous to ScYCR011C (ADP1) - SH; ScYOL075C -...   198   2e-51
KLLA0D04554g complement(385733..388801) similar to sp|P25371 Sac...   194   5e-50
Kwal_0.327                                                            189   2e-48
Scas_628.13                                                           165   5e-41
CAGL0L07744g 849961..853128 similar to sp|P25371 Saccharomyces c...   152   6e-37
YCR011C (ADP1) [545] chr3 complement(133721..136870) Member of t...   146   3e-35
Kwal_27.12711                                                         146   7e-35
CAGL0I08019g complement(782863..786720) highly similar to sp|Q08...   138   2e-32
Scas_710.50                                                           135   2e-32
KLLA0C04477g complement(409543..413304) similar to sp|Q08234 Sac...   137   4e-32
YOL075C (YOL075C) [4745] chr15 complement(189657..193541) Member...   132   9e-31
Scas_566.1                                                            128   1e-30
Scas_202.1                                                            102   2e-24
Scas_40.1                                                              97   3e-22
YPL270W (MDL2) [5181] chr16 (30482..32803) Member of the ATP-bin...    65   5e-10
Sklu_2343.3 YPL270W, Contig c2343 2058-4382                            63   1e-09
CAGL0A01133g 112037..114442 similar to sp|P33311 Saccharomyces c...    63   1e-09
ACR022W [1070] [Homologous to ScYPL270W (MDL2) - SH] complement(...    62   3e-09
KLLA0D00748g complement(69839..72208) similar to sp|P33311 Sacch...    62   3e-09
Kwal_56.22329                                                          62   3e-09
Scas_468.1                                                             61   5e-09
YLR188W (MDL1) [3591] chr12 (528302..530389) Member of the ATP-b...    59   3e-08
KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces c...    58   4e-08
Kwal_56.23844                                                          57   1e-07
CAGL0E00385g 31723..33549 similar to sp|P33310 Saccharomyces cer...    57   1e-07
Scas_693.42                                                            57   1e-07
Scas_587.8                                                             57   1e-07
Kwal_26.9480                                                           56   2e-07
CAGL0M13739g complement(1346231..1348414) similar to sp|P40416 S...    55   3e-07
AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH] complement(...    55   4e-07
YMR301C (ATM1) [4255] chr13 complement(867554..869626) Member of...    55   5e-07
Scas_574.8                                                             54   7e-07
KLLA0F20075g complement(1868786..1873336) similar to sp|P39109 S...    54   8e-07
KLLA0A10131g complement(889688..891850) similar to sp|P40416 Sac...    54   1e-06
Scas_612.11*                                                           52   5e-06
CAGL0L06402g 718726..723333 highly similar to sp|P39109 Saccharo...    50   2e-05
AGR047W [4357] [Homologous to ScYDR135C (YCF1) - SH] complement(...    50   2e-05
CAGL0C03289g 328799..333745 similar to sp|P32386 Saccharomyces c...    50   2e-05
KLLA0E00462g complement(39173..44125) similar to sp|P32386 Sacch...    49   3e-05
Scas_622.9                                                             49   3e-05
YDR135C (YCF1) [981] chr4 complement(722998..727545) Vacuolar gl...    49   4e-05
CAGL0E03982g 378205..383184 similar to sp|P32386 Saccharomyces c...    48   8e-05
Sklu_2316.1 YKL209C, Contig c2316 84-4016 reverse complement           48   9e-05
AGL346W [3966] [Homologous to ScYGR281W (YOR1) - SH] complement(...    47   2e-04
Kwal_34.15770                                                          47   2e-04
YLL048C (YBT1) [3375] chr12 complement(41279..46264) Protein wit...    45   4e-04
Scas_455.1                                                             45   6e-04
Kwal_33.15561                                                          45   7e-04
KLLA0B14256g 1248654..1252469 similar to sp|P12866 Saccharomyces...    44   9e-04
YKL209C (STE6) [3066] chr11 complement(42424..46296) Membrane tr...    44   9e-04
YLL015W (BPT1) [3404] chr12 (116431..121110) Membrane transporte...    44   9e-04
YGR281W (YOR1) [2226] chr7 (1052829..1057262) Oligomycin-resista...    44   0.001
AFR432W [3624] [Homologous to ScYKL209C (STE6) - SH] complement(...    43   0.002
CAGL0K00363g complement(37452..41135) similar to sp|P12866 Sacch...    42   0.004
AFR683C [3876] [Homologous to ScYLR188W (MDL1) - SH] (1697345..1...    42   0.004
Scas_695.24                                                            42   0.006
Kwal_56.22747                                                          42   0.006
YHL035C (YHL035C) [2251] chr8 complement(27976..32754) Member of...    42   0.006
KLLA0D04059g complement(338422..343128) similar to sp|P14772 Sac...    40   0.016
Scas_552.4                                                             40   0.019
CAGL0E03355g complement(307242..311849) similar to sp|P14772 Sac...    39   0.038
Scas_707.8                                                             37   0.068
YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative...    38   0.089
YKR104W (NFT1) [3355] chr11 (656472..657392) Member of the ATP-b...    36   0.25 
KLLA0A10857g complement(941784..944042) highly similar to sp|P43...    35   0.41 
AEL032W [2474] [Homologous to ScYFR009W (GCN20) - SH] complement...    35   0.44 
Kwal_33.13308                                                          35   0.48 
Sklu_1870.3 YFL028C, Contig c1870 3336-4133                            34   0.58 
Scas_636.14                                                            35   0.80 
Scas_706.21                                                            34   0.97 
Scas_618.3                                                             34   1.0  
KLLA0C17556g complement(1544404..1546227) highly similar to sgd|...    34   1.0  
KLLA0F22451g 2098204..2099559 similar to sp|P33895 Saccharomyces...    34   1.1  
KLLA0A01452g 130078..131901 highly similar to sp|P40024 Saccharo...    34   1.1  
CAGL0G08041g complement(758811..760634) highly similar to tr|Q03...    34   1.2  
AFL113C [3082] [Homologous to ScYPL217C (BMS1) - SH] (223522..22...    34   1.5  
CAGL0J07788g complement(757051..760968) similar to sp|P12753 Sac...    34   1.5  
CAGL0M05753g complement(610837..612543) similar to sp|P53166 Sac...    33   1.5  
Kwal_14.1242                                                           33   1.7  
Kwal_34.16240                                                          33   1.7  
YOR341W (RPA190) [5120] chr15 (960982..965976) RNA polymerase I ...    33   1.8  
AFR637W [3829] [Homologous to ScYNL250W (RAD50) - SH] complement...    33   2.0  
Scas_712.29                                                            33   2.0  
YNL250W (RAD50) [4357] chr14 (175409..179347) Coiled-coil protei...    33   2.4  
KLLA0C02915g 261280..265170 similar to sp|P12753 Saccharomyces c...    33   2.8  
Kwal_33.13526                                                          33   2.8  
ACL072C [977] [Homologous to ScYLL048C (YBT1) - SH; ScYHL035C - ...    32   4.1  
CAGL0K12474g 1217183..1218067 similar to sp|P43569 Saccharomyces...    32   4.7  
YDR061W (YDR061W) [912] chr4 (574159..575778) Member of the non-...    32   5.0  
Kwal_26.8730                                                           32   5.8  

>YOR328W (PDR10) [5109] chr15 (931798..936492) Member of ATP-binding
            cassette (ABC) superfamily [4695 bp, 1564 aa]
          Length = 1564

 Score = 3009 bits (7801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1450/1536 (94%), Positives = 1450/1536 (94%)

Query: 1    MLQAPSSSNSGLNQGNAAPDGPPNETQPYEGLDAAAQEEIKELARXXXXXXXXXXXEKRI 60
            MLQAPSSSNSGLNQGNAAPDGPPNETQPYEGLDAAAQEEIKELAR           EKRI
Sbjct: 1    MLQAPSSSNSGLNQGNAAPDGPPNETQPYEGLDAAAQEEIKELARTLTSQSSLLSQEKRI 60

Query: 61   TGTGDPNTLTXXXXXXXXXXXXXXDIKGVNPILLDVNDPDYDETLDPRSENFSSVRWVRN 120
            TGTGDPNTLT              DIKGVNPILLDVNDPDYDETLDPRSENFSSVRWVRN
Sbjct: 61   TGTGDPNTLTAASSSSLSRSIFASDIKGVNPILLDVNDPDYDETLDPRSENFSSVRWVRN 120

Query: 121  MAQICENDSDFYKPFSLGCAWKDLSASGDSADITYQGTFGNMPIKYLKMSWRCISRRLFH 180
            MAQICENDSDFYKPFSLGCAWKDLSASGDSADITYQGTFGNMPIKYLKMSWRCISRRLFH
Sbjct: 121  MAQICENDSDFYKPFSLGCAWKDLSASGDSADITYQGTFGNMPIKYLKMSWRCISRRLFH 180

Query: 181  RTHGKSEDNDSGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTI 240
            RTHGKSEDNDSGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTI
Sbjct: 181  RTHGKSEDNDSGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTI 240

Query: 241  ITYNGFSNKEIKNHYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFA 300
            ITYNGFSNKEIKNHYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFA
Sbjct: 241  ITYNGFSNKEIKNHYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFA 300

Query: 301  KHMTEVAMATYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLD 360
            KHMTEVAMATYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLD
Sbjct: 301  KHMTEVAMATYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLD 360

Query: 361  SATALEFIKALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKY 420
            SATALEFIKALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKY
Sbjct: 361  SATALEFIKALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKY 420

Query: 421  FQRMGYVCPERQTTADYLTSITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQL 480
            FQRMGYVCPERQTTADYLTSITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQL
Sbjct: 421  FQRMGYVCPERQTTADYLTSITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQL 480

Query: 481  QVQVNKHLDTDSSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDP 540
            QVQVNKHLDTDSSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDP
Sbjct: 481  QVQVNKHLDTDSSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDP 540

Query: 541  SIQLFTVLSHAAMALILGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYE 600
            SIQLFTVLSHAAMALILGSMFYEVMLSTTTTTFYYRG                EIFSLYE
Sbjct: 541  SIQLFTVLSHAAMALILGSMFYEVMLSTTTTTFYYRGAAIFFAILFNAFSSLLEIFSLYE 600

Query: 601  TRPITEKHKTYSLYRPSADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFL 660
            TRPITEKHKTYSLYRPSADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFL
Sbjct: 601  TRPITEKHKTYSLYRPSADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFL 660

Query: 661  INIITVFAMSHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYI 720
            INIITVFAMSHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYI
Sbjct: 661  INIITVFAMSHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYI 720

Query: 721  NPLSYLFESLMINEFHGRNFPCAQYIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFI 780
            NPLSYLFESLMINEFHGRNFPCAQYIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFI
Sbjct: 721  NPLSYLFESLMINEFHGRNFPCAQYIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFI 780

Query: 781  QTNYGYRHKNKWRSVGIGLAXXXXXXXXXXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXX 840
            QTNYGYRHKNKWRSVGIGLA            CEYNEGAKQNGEMLVFPHS         
Sbjct: 781  QTNYGYRHKNKWRSVGIGLAYIIFFLFLYLFFCEYNEGAKQNGEMLVFPHSVVKKMKKKG 840

Query: 841  XXXXXXXXNQPTLSTSDAEKDVEMNNNSSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXX 900
                    NQPTLSTSDAEKDVEMNNNSSATDSRFLRDSDAAIMGNDKTVAKEHY     
Sbjct: 841  IVSEKKKKNQPTLSTSDAEKDVEMNNNSSATDSRFLRDSDAAIMGNDKTVAKEHYSSPSS 900

Query: 901  XXXXXXXXXXXDDIELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGA 960
                       DDIELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGA
Sbjct: 901  SASQSNSFSKSDDIELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGA 960

Query: 961  SGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLR 1020
            SGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLR
Sbjct: 961  SGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLR 1020

Query: 1021 FSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAA 1080
            FSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAA
Sbjct: 1021 FSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAA 1080

Query: 1081 KPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQE 1140
            KPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQE
Sbjct: 1081 KPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQE 1140

Query: 1141 GGQTVYFGELGKGCKTMINYFEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWR 1200
            GGQTVYFGELGKGCKTMINYFEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWR
Sbjct: 1141 GGQTVYFGELGKGCKTMINYFEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWR 1200

Query: 1201 DSEEYREMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYL 1260
            DSEEYREMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYL
Sbjct: 1201 DSEEYREMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYL 1260

Query: 1261 WSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELY 1320
            WSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELY
Sbjct: 1261 WSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELY 1320

Query: 1321 EARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGAL 1380
            EARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGAL
Sbjct: 1321 EARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGAL 1380

Query: 1381 FWLFACAFYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFM 1440
            FWLFACAFYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFM
Sbjct: 1381 FWLFACAFYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFM 1440

Query: 1441 YRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDG 1500
            YRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDG
Sbjct: 1441 YRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDG 1500

Query: 1501 SSETECHFCQFSSTNDYLATVSSSYSRRWMNYGIFS 1536
            SSETECHFCQFSSTNDYLATVSSSYSRRWMNYGIFS
Sbjct: 1501 SSETECHFCQFSSTNDYLATVSSSYSRRWMNYGIFS 1536

>Scas_714.42
          Length = 1520

 Score = 2092 bits (5421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 992/1532 (64%), Positives = 1178/1532 (76%), Gaps = 65/1532 (4%)

Query: 10   SGLNQGNAAPDGPPNET-----QPYEGLDAAAQEEIKELARXXX-XXXXXXXXEKRITGT 63
            S +N  + + D   N T       Y G D  A+EEI+ELAR             + I   
Sbjct: 10   SSINSIDPSNDNSANSTNSENLHEYHGFDQTAEEEIRELARTLTIQSVNNASVHESINEL 69

Query: 64   GDPNTLTXXXXXXXXXXXXXXDIKGVNPILLDVNDPDYDETLDPRSENFSSVRWVRNMAQ 123
             + +  T              +++G+NP+  +  +P Y+  LDP SE+FSS  WV+NMA 
Sbjct: 70   ENQSIFTP-------------EMEGINPVFTNPANPGYNPKLDPVSEDFSSKAWVQNMAN 116

Query: 124  ICENDSDFYKPFSLGCAWKDLSASGDSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTH 183
            I   D DFYKP+SLGC WK+LSASG+S+D+ YQ TF NMP K L   +R +         
Sbjct: 117  ISLADPDFYKPYSLGCVWKNLSASGESSDVAYQSTFLNMPYKILSTGYRKL--------- 167

Query: 184  GKSEDNDSGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITY 243
             KS   +  F+ILKPMDGC+NPGELLVVLGRPG+GCTTLLKSIS NTHGFKIS ++ I+Y
Sbjct: 168  -KSSKTEDRFEILKPMDGCLNPGELLVVLGRPGSGCTTLLKSISSNTHGFKISDESTISY 226

Query: 244  NGFSNKEIKNHYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHM 303
            +G + KE+K HYRGEVVYNAE+DIH+PHLTVFQTLYTVARLKTP NRIKGVDRDTFA+HM
Sbjct: 227  SGLTPKEVKRHYRGEVVYNAEADIHLPHLTVFQTLYTVARLKTPTNRIKGVDRDTFARHM 286

Query: 304  TEVAMATYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSAT 363
            TEVAMATYGLSHT +TKVGND VRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSAT
Sbjct: 287  TEVAMATYGLSHTRNTKVGNDLVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSAT 346

Query: 364  ALEFIKALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQR 423
            ALEFI+ALKTQATI+ SAATVAIYQCS+DAYDLFDKVCVL  GYQ+++GP  +AKKYFQ 
Sbjct: 347  ALEFIRALKTQATISNSAATVAIYQCSQDAYDLFDKVCVLDGGYQLYYGPGNKAKKYFQD 406

Query: 424  MGYVCPERQTTADYLTSITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQ 483
            MGY+CPERQTTAD+LTS+TSP+ER+ + + +K GI +PQT  +M  YW+ S+ YK+L  +
Sbjct: 407  MGYLCPERQTTADFLTSVTSPAERVINPEFIKKGIKVPQTPKDMGDYWLNSQNYKELMTE 466

Query: 484  VNKHLDTDSSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQ 543
            +++ L  +  + RE I+ AH+AKQSKRARPSSPYTVS+ LQVKY+L R+ WRI+N+ SI 
Sbjct: 467  IDRKLSENVEESRETIRGAHVAKQSKRARPSSPYTVSYGLQVKYLLERNFWRIRNNASIS 526

Query: 544  LFTVLSHAAMALILGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRP 603
            LF +  +++MA ILGSMFY+VM    T+TFY+RG                EIFSLYE RP
Sbjct: 527  LFMIFGNSSMAFILGSMFYKVMRKGDTSTFYFRGAAMFFAILFNAFSCLLEIFSLYEARP 586

Query: 604  ITEKHKTYSLYRPSADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINI 663
            ITEKH+TYSLY PSADAFAS  S++PTK   AV FNI +YFL+N + + G FFFY L+N+
Sbjct: 587  ITEKHRTYSLYHPSADAFASIISEIPTKFCIAVCFNIIFYFLVNFRMNGGVFFFYLLMNV 646

Query: 664  ITVFAMSHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPL 723
            + VF MSH+FRC+GS++K+L +AMVPAS+LLLA +MYTGFAIP+ +ML WS+WI YINPL
Sbjct: 647  VGVFCMSHMFRCVGSLTKSLSEAMVPASMLLLALSMYTGFAIPKKKMLRWSRWIWYINPL 706

Query: 724  SYLFESLMINEFHGRNFPCAQYIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTN 783
            SYLFESLMINEFH   +PCAQYIP GP Y N +G E  CSA+G++PG  Y+ GDD+I+ +
Sbjct: 707  SYLFESLMINEFHDVKYPCAQYIPFGPAYANISGTERVCSAVGAVPGQAYILGDDYIKES 766

Query: 784  YGYRHKNKWRSVGIGLAXXXXXXXXXXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXX 843
            YGY+H  KWRS+GIGLA            CEYNEGAKQ GE+LVFP S            
Sbjct: 767  YGYKHSEKWRSLGIGLAYAIFFLGVYLFLCEYNEGAKQAGEILVFPRSVIKRLK------ 820

Query: 844  XXXXXNQPTLSTSDAEKDVEMNNNSSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXX 903
                  +  L   +  +D+EM  ++S TD + L   + A                     
Sbjct: 821  -----KEGKLREKNTAEDIEMAADTSVTDKQLLSSDEMA--------------------- 854

Query: 904  XXXXXXXXDDIELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGA 963
                     +I LSKS+AIFHW+NLCYD+ IK+  RRIL+NVDGWVKPGTLTAL+GASGA
Sbjct: 855  ----EESGANIGLSKSEAIFHWRNLCYDVQIKDETRRILNNVDGWVKPGTLTALMGASGA 910

Query: 964  GKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSA 1023
            GKTTLLDCLAER TMG+ITGDV V+GRPRDQSFPRSIGYCQQQDLHLKT+TVRESLRFSA
Sbjct: 911  GKTTLLDCLAERVTMGVITGDVLVNGRPRDQSFPRSIGYCQQQDLHLKTSTVRESLRFSA 970

Query: 1024 YLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPK 1083
            YLRQ  DVSIEEK++YVE+VI++LEM+ YADA+VGV GEGLNVEQRKRLTIGVEL AKPK
Sbjct: 971  YLRQPADVSIEEKNQYVEDVIKILEMEAYADAVVGVAGEGLNVEQRKRLTIGVELTAKPK 1030

Query: 1084 LLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQ 1143
            LLVFLDEPTSGLDSQTAWS CQLMKKLA  GQAILCTIHQPSA+LMQEFDRLLF+Q GG+
Sbjct: 1031 LLVFLDEPTSGLDSQTAWSICQLMKKLADHGQAILCTIHQPSAILMQEFDRLLFMQRGGR 1090

Query: 1144 TVYFGELGKGCKTMINYFEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSE 1203
            TVYFG+LGKGC+TMI+YFE +G+H CP DANPAEWMLE+VGAAPG+HA+QDY  +WR+S 
Sbjct: 1091 TVYFGDLGKGCQTMIDYFERNGSHPCPADANPAEWMLEVVGAAPGSHANQDYHEVWRNSA 1150

Query: 1204 EYREMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSK 1263
            EY+ +Q+ELDWM +ELPK+    S  +Q+EFATS  YQ K+VS RLF QYWR+P YLWSK
Sbjct: 1151 EYKAVQEELDWMAQELPKKQVEESAADQREFATSVPYQAKIVSIRLFEQYWRSPEYLWSK 1210

Query: 1264 FFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEAR 1323
            F  TI ++LFIGFTFFKA+TSLQGLQNQML+IFMF  +FNPILQQYLP FVQQR+LYEAR
Sbjct: 1211 FILTIFNQLFIGFTFFKADTSLQGLQNQMLSIFMFVCIFNPILQQYLPSFVQQRDLYEAR 1270

Query: 1324 ERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWL 1383
            ERPSRTFSWKAFI SQI+VE+PWNLLAGT+AFF+YYYP+GFY NAS A QLHERGALFWL
Sbjct: 1271 ERPSRTFSWKAFIFSQIVVEVPWNLLAGTLAFFIYYYPIGFYANASAAGQLHERGALFWL 1330

Query: 1384 FACAFYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRV 1443
            F+CAFYVY+ SMG+  IS  ++AENAANLASL F MSLSFCGV+ TP  +PRFWIFMYRV
Sbjct: 1331 FSCAFYVYVGSMGLAAISFNQLAENAANLASLLFTMSLSFCGVMTTPGAMPRFWIFMYRV 1390

Query: 1444 SPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSE 1503
            SPLTY IDA L+VG+AN  V CS  ELL+  P SGMTC EYM PYM+  GTGYL D S+ 
Sbjct: 1391 SPLTYFIDATLAVGVANVDVHCSDYELLRFTPASGMTCGEYMTPYMEMMGTGYLKDSSAT 1450

Query: 1504 TECHFCQFSSTNDYLATVSSSYSRRWMNYGIF 1535
             +C FC  S TN+YL+ V+SSYSRRW NYGIF
Sbjct: 1451 DQCEFCTVSHTNEYLSQVNSSYSRRWRNYGIF 1482

>YOR153W (PDR5) [4952] chr15 (619840..624375) Drug-efflux pump
            involved in resistance to multiple drugs, member of the
            ATP-binding cassette (ABC) superfamily [4536 bp, 1511 aa]
          Length = 1511

 Score = 2073 bits (5371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 981/1508 (65%), Positives = 1163/1508 (77%), Gaps = 59/1508 (3%)

Query: 29   YEGLDAAAQEEIKELARXXXXXXXXXXXEKRITGTGDPNTLTXXXXXXXXXXXXXXDIKG 88
            Y G D   +  I++LAR              +T     N+                 ++G
Sbjct: 32   YNGFDEHTEARIQKLART-------------LTAQSMQNSTQSAPNKSDAQSIFSSGVEG 78

Query: 89   VNPILLDVNDPDYDETLDPRSENFSSVRWVRNMAQICENDSDFYKPFSLGCAWKDLSASG 148
            VNPI  D   P YD  LDP SENFSS  WV+NMA +   D DFYKP+SLGCAWK+LSASG
Sbjct: 79   VNPIFSDPEAPGYDPKLDPNSENFSSAAWVKNMAHLSAADPDFYKPYSLGCAWKNLSASG 138

Query: 149  DSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILKPMDGCINPGEL 208
             SAD+ YQ T  N+P K LK   R   R         S++ ++ FQILKPMDGC+NPGEL
Sbjct: 139  ASADVAYQSTVVNIPYKILKSGLRKFQR---------SKETNT-FQILKPMDGCLNPGEL 188

Query: 209  LVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAESDIH 268
            LVVLGRPG+GCTTLLKSIS NTHGF +  DT I+Y+G+S  +IK H+RGEVVYNAE+D+H
Sbjct: 189  LVVLGRPGSGCTTLLKSISSNTHGFDLGADTKISYSGYSGDDIKKHFRGEVVYNAEADVH 248

Query: 269  IPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGNDFVRG 328
            +PHLTVF+TL TVARLKTP+NRIKGVDR+++A H+ EVAMATYGLSHT +TKVGND VRG
Sbjct: 249  LPHLTVFETLVTVARLKTPQNRIKGVDRESYANHLAEVAMATYGLSHTRNTKVGNDIVRG 308

Query: 329  VSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATVAIYQ 388
            VSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFI+ALKTQA I+ ++ATVAIYQ
Sbjct: 309  VSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIRALKTQADISNTSATVAIYQ 368

Query: 389  CSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADYLTSITSPSERI 448
            CS+DAYDLF+KVCVL DGYQI++GP+ +AKKYF+ MGYVCP RQTTAD+LTS+TSPSER 
Sbjct: 369  CSQDAYDLFNKVCVLDDGYQIYYGPADKAKKYFEDMGYVCPSRQTTADFLTSVTSPSERT 428

Query: 449  KDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHLDTDSSQQREQIKNAHIAKQS 508
             +KDM+K GI IPQT  EMN YW++S  YK+L  +V++ L  D    RE IK AHIAKQS
Sbjct: 429  LNKDMLKKGIHIPQTPKEMNDYWVKSPNYKELMKEVDQRLLNDDEASREAIKEAHIAKQS 488

Query: 509  KRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYEVMLST 568
            KRARPSSPYTVS+ +QVKY+LIR++WR++N+    LF +L + +MALILGSMF+++M   
Sbjct: 489  KRARPSSPYTVSYMMQVKYLLIRNMWRLRNNIGFTLFMILGNCSMALILGSMFFKIMKKG 548

Query: 569  TTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFASTFSDV 628
             T+TFY+RG                EIFSLYE RPITEKH+TYSLY PSADAFAS  S++
Sbjct: 549  DTSTFYFRGSAMFFAILFNAFSSLLEIFSLYEARPITEKHRTYSLYHPSADAFASVLSEI 608

Query: 629  PTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTLPQAMV 688
            P+KL  AV FNI +YFL++ +R+ G FFFY LINI+ VF+MSHLFRC+GS++KTL +AMV
Sbjct: 609  PSKLIIAVCFNIIFYFLVDFRRNGGVFFFYLLINIVAVFSMSHLFRCVGSLTKTLSEAMV 668

Query: 689  PASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFHGRNFPCAQYIPS 748
            PAS+LLLA +MYTGFAIP+ ++L WSKWI YINPL+YLFESL+INEFHG  FPCA+Y+P 
Sbjct: 669  PASMLLLALSMYTGFAIPKKKILRWSKWIWYINPLAYLFESLLINEFHGIKFPCAEYVPR 728

Query: 749  GPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSVGIGLAXXXXXXXX 808
            GP Y N +  E  C+ +G++PG +YV GDDFI+  Y Y HK+KWR  GIG+A        
Sbjct: 729  GPAYANISSTESVCTVVGAVPGQDYVLGDDFIRGTYQYYHKDKWRGFGIGMAYVVFFFFV 788

Query: 809  XXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQPTLST-SDAEKDVEMNNN 867
                CEYNEGAKQ GE+LVFP S                 +   +   SD   D +M   
Sbjct: 789  YLFLCEYNEGAKQKGEILVFPRSIVKRMKKRGVLTEKNANDPENVGERSDLSSDRKMLQE 848

Query: 868  SSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXXXXXXXXDDIELSKSQAIFHWKN 927
            SS  +S                                       +I LSKS+AIFHW+N
Sbjct: 849  SSEEES-----------------------------------DTYGEIGLSKSEAIFHWRN 873

Query: 928  LCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFV 987
            LCY++ IK   RRIL+NVDGWVKPGTLTAL+GASGAGKTTLLDCLAER TMG+ITGD+ V
Sbjct: 874  LCYEVQIKAETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDILV 933

Query: 988  DGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVL 1047
            +G PRD+SFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQ  +VSIEEK++YVEEVI++L
Sbjct: 934  NGIPRDKSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPAEVSIEEKNRYVEEVIKIL 993

Query: 1048 EMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLM 1107
            EM+ YADA+VGV GEGLNVEQRKRLTIGVEL AKPKLLVFLDEPTSGLDSQTAWS CQLM
Sbjct: 994  EMEKYADAVVGVAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTAWSICQLM 1053

Query: 1108 KKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGAH 1167
            KKLA+ GQAILCTIHQPSA+LMQEFDRLLF+Q GG+TVYFG+LG+GCKTMI+YFE+HGAH
Sbjct: 1054 KKLANHGQAILCTIHQPSAILMQEFDRLLFMQRGGKTVYFGDLGEGCKTMIDYFESHGAH 1113

Query: 1168 KCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKELDWMERELPKRTEGSS 1227
            KCP DANPAEWMLE+VGAAPG+HA+QDY+ +WR+SEEYR +Q ELDWMERELPK+   ++
Sbjct: 1114 KCPADANPAEWMLEVVGAAPGSHANQDYYEVWRNSEEYRAVQSELDWMERELPKKGSITA 1173

Query: 1228 NEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQG 1287
             E++ EF+ S +YQ KLVS RLF QYWR+P YLWSKF  TI ++LFIGFTFFKA TSLQG
Sbjct: 1174 AEDKHEFSQSIIYQTKLVSIRLFQQYWRSPDYLWSKFILTIFNQLFIGFTFFKAGTSLQG 1233

Query: 1288 LQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSRTFSWKAFIVSQILVEIPWN 1347
            LQNQMLA+FMFTV+FNPILQQYLP FVQQR+LYEARERPSRTFSW +FI +QI VE+PWN
Sbjct: 1234 LQNQMLAVFMFTVIFNPILQQYLPSFVQQRDLYEARERPSRTFSWISFIFAQIFVEVPWN 1293

Query: 1348 LLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACAFYVYISSMGVLVISCIEIAE 1407
            +LAGTIA+F+YYYP+GFY NAS A QLHERGALFWLF+CAFYVY+ SMG+LVIS  ++AE
Sbjct: 1294 ILAGTIAYFIYYYPIGFYSNASAAGQLHERGALFWLFSCAFYVYVGSMGLLVISFNQVAE 1353

Query: 1408 NAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDALLSVGLANASVVCSS 1467
            +AANLASL F MSLSFCGV+ TP+ +PRFWIFMYRVSPLTY I ALL+VG+AN  V C+ 
Sbjct: 1354 SAANLASLLFTMSLSFCGVMTTPSAMPRFWIFMYRVSPLTYFIQALLAVGVANVDVKCAD 1413

Query: 1468 NELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECHFCQFSSTNDYLATVSSSYSR 1527
             ELL+  PPSGMTC +YMEPY+Q   TGYL D ++   C FCQ S+TNDYLA V+S YS 
Sbjct: 1414 YELLEFTPPSGMTCGQYMEPYLQLAKTGYLTDENATDTCSFCQISTTNDYLANVNSFYSE 1473

Query: 1528 RWMNYGIF 1535
            RW NYGIF
Sbjct: 1474 RWRNYGIF 1481

>CAGL0F02717g 261361..265989 tr|O74208 Candida glabrata ATP-binding
            cassette transporter, identified start
          Length = 1542

 Score = 2054 bits (5321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 969/1510 (64%), Positives = 1164/1510 (77%), Gaps = 29/1510 (1%)

Query: 27   QPYEGLDAAAQEEIKELARXXXXXXXXXXXEKRITGTGDPNTLTXXXXXXXXXXXXXXDI 86
            QPY G D   ++ I+ELAR                      +                D 
Sbjct: 16   QPYMGFDDNVEKRIRELARSLTQQSLTSSNRSVNKEAPADGSAPLDRVSTRASSIFSADF 75

Query: 87   KGVNPILLDVNDPDYDETLDPRSENFSSVRWVRNMAQICENDSDFYKPFSLGCAWKDLSA 146
            KGVNP+  D  + DYD  LDP S+ FSS  WV+NMA+I   D +FYKP+S+GC WKDLSA
Sbjct: 76   KGVNPVFSDEEEDDYDARLDPNSDEFSSKAWVQNMAKITTGDPEFYKPYSIGCCWKDLSA 135

Query: 147  SGDSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILKPMDGCINPG 206
            SG+SAD++YQ TF N+P+K L   WR            +       F+ILKPMDG + PG
Sbjct: 136  SGESADVSYQSTFLNLPVKLLNAVWR----------KARPARESDTFRILKPMDGLLKPG 185

Query: 207  ELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAESD 266
            ELLVVLGRPG+GCTTLLKSIS  THGF+IS D++I+YNG +  EIK HYRGEVVYNAE+D
Sbjct: 186  ELLVVLGRPGSGCTTLLKSISSTTHGFQISKDSVISYNGLTPNEIKKHYRGEVVYNAEAD 245

Query: 267  IHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGNDFV 326
            IH+PHLTV+QTL TVARLKTP+NR+KGV R+ FA H+T+VAMATYGLSHT DTKVGND V
Sbjct: 246  IHLPHLTVYQTLVTVARLKTPQNRVKGVTREDFANHVTDVAMATYGLSHTRDTKVGNDLV 305

Query: 327  RGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATVAI 386
            RGVSGGERKRVSIAEV ICGSKFQCWDNATRGLDSATALEF++ALKTQA I K+ ATVAI
Sbjct: 306  RGVSGGERKRVSIAEVWICGSKFQCWDNATRGLDSATALEFVRALKTQAHIAKNVATVAI 365

Query: 387  YQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADYLTSITSPSE 446
            YQCS+DAY+LF+KV VLY+GYQI+FG ++ AK YFQ+MGY CP+RQT  D+LTSITSP+E
Sbjct: 366  YQCSQDAYNLFNKVSVLYEGYQIYFGDAQHAKVYFQKMGYFCPKRQTIPDFLTSITSPAE 425

Query: 447  RIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHLDTDSSQQREQIKNAHIAK 506
            R  +K+ +  GI +PQT  +M +YW  SEEYKQL+ ++++ L   S   +E+IK AHIAK
Sbjct: 426  RRINKEYLDKGIKVPQTPLDMVEYWHNSEEYKQLREEIDETLAHQSEDDKEEIKEAHIAK 485

Query: 507  QSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYEVML 566
            QSKRARPSSPY VS+ +QVKYILIR+ WRIKN  S+ LF V  ++AMA ILGSMFY++  
Sbjct: 486  QSKRARPSSPYVVSYMMQVKYILIRNFWRIKNSASVTLFQVFGNSAMAFILGSMFYKIQK 545

Query: 567  STTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFASTFS 626
             ++  TFY+RG                EIFSLYE RPITEKH+TYSLY PSADAFAS  S
Sbjct: 546  GSSADTFYFRGAAMFFAILFNAFSSLLEIFSLYEARPITEKHRTYSLYHPSADAFASVIS 605

Query: 627  DVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTLPQA 686
            ++P K+ TA+ FNI +YFL+N +RDAG FFFYFLIN+I VFAMSHLFRC+GS++KTL +A
Sbjct: 606  EIPPKIVTAILFNIIFYFLVNFRRDAGRFFFYFLINVIAVFAMSHLFRCVGSLTKTLQEA 665

Query: 687  MVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFHGRNFPCAQYI 746
            MVPAS+LLLA +MYTGFAIPR +MLGWSKWI YINPL+YLFESLM+NEFH R FPC  YI
Sbjct: 666  MVPASMLLLALSMYTGFAIPRTKMLGWSKWIWYINPLAYLFESLMVNEFHDRRFPCNTYI 725

Query: 747  PSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSVGIGLAXXXXXX 806
            P G  Y + TG E  C+++G+ PGN+YV GDDF++ +Y Y +K+KWR  G+G+A      
Sbjct: 726  PRGGAYNDVTGTERVCASVGARPGNDYVLGDDFLKESYDYENKHKWRGFGVGMAYVIFFF 785

Query: 807  XXXXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQPTLSTSDAEKDVEMNN 866
                  CE+NEGAKQ GEMLVFPHS                 ++  + T   + D+E N+
Sbjct: 786  FVYLILCEFNEGAKQKGEMLVFPHS-----VVKRMKKEGKIRDKTKMHTD--KNDIENNS 838

Query: 867  NSSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXXXXXXXXD-DIELSKSQAIFHW 925
             S  +++            N+K + ++ Y                   + LSKS+AIFHW
Sbjct: 839  ESITSNAT-----------NEKNMLQDTYDENADSESITSGSRGGSPQVGLSKSEAIFHW 887

Query: 926  KNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDV 985
            +NLCYD+PIK   RRIL+NVDGWVKPGTLTAL+GASGAGKTTLLDCLAERTTMG+ITGDV
Sbjct: 888  QNLCYDVPIKTEVRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERTTMGVITGDV 947

Query: 986  FVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIE 1045
             V+GRPRD SF RSIGYCQQQDLHLKTATVRESLRFSAYLRQ   VSIEEK++YVE VI+
Sbjct: 948  MVNGRPRDTSFSRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSIEEKNEYVEAVIK 1007

Query: 1046 VLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQ 1105
            +LEM+ YADA+VGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAW+TCQ
Sbjct: 1008 ILEMETYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWATCQ 1067

Query: 1106 LMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHG 1165
            LMKKLA+ GQAILCTIHQPSA+LMQEFDRLLFLQ+GGQTVYFG+LGKGCKTMI YFE HG
Sbjct: 1068 LMKKLANHGQAILCTIHQPSAMLMQEFDRLLFLQKGGQTVYFGDLGKGCKTMIKYFEDHG 1127

Query: 1166 AHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKELDWMERELPKRTEG 1225
            AHKCPPDANPAEWMLE+VGAAPG+HA+QDY  +WR+SE+++++++EL+ ME+EL ++   
Sbjct: 1128 AHKCPPDANPAEWMLEVVGAAPGSHANQDYHEVWRNSEQFKQVKQELEQMEKELSQKELD 1187

Query: 1226 SSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFKANTSL 1285
            +  +  KEFATS  YQ +LV  RLF QYWRTP YLWSK+  TI ++LFIGFTFFKA+ +L
Sbjct: 1188 NDEDANKEFATSLWYQFQLVCVRLFQQYWRTPDYLWSKYILTIFNQLFIGFTFFKADHTL 1247

Query: 1286 QGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSRTFSWKAFIVSQILVEIP 1345
            QGLQNQML+IFM+TV+FNP+LQQYLP FVQQR+LYEARERPSRTFSWKAFI++QI+VE+P
Sbjct: 1248 QGLQNQMLSIFMYTVIFNPLLQQYLPTFVQQRDLYEARERPSRTFSWKAFILAQIVVEVP 1307

Query: 1346 WNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACAFYVYISSMGVLVISCIEI 1405
            WN++AGT+A+ +YYY VGFY NAS A+QLHERGALFWLF+ AFYVY+ S+G+ VIS  E+
Sbjct: 1308 WNIVAGTLAYCIYYYSVGFYANASQAHQLHERGALFWLFSIAFYVYVGSLGLFVISFNEV 1367

Query: 1406 AENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDALLSVGLANASVVC 1465
            AE AA++ SL F M+LSFCGV+ATP+ +PRFWIFMYRVSPLTYLIDALLS G+AN  + C
Sbjct: 1368 AETAAHIGSLMFTMALSFCGVMATPDAMPRFWIFMYRVSPLTYLIDALLSTGVANVDIRC 1427

Query: 1466 SSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECHFCQFSSTNDYLATVSSSY 1525
            S+ EL+   PP G+TC +YM PY+   GTGYL D S+  ECHFCQFS TND+LATVSS Y
Sbjct: 1428 SNTELVTFTPPQGLTCGQYMTPYLNVAGTGYLTDPSATDECHFCQFSYTNDFLATVSSKY 1487

Query: 1526 SRRWMNYGIF 1535
             RRW NYGIF
Sbjct: 1488 YRRWRNYGIF 1497

>YDR406W (PDR15) [1232] chr4 (1279198..1283787) Member of ATP-binding
            cassette (ABC) superfamily [4590 bp, 1529 aa]
          Length = 1529

 Score = 2040 bits (5286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 965/1509 (63%), Positives = 1165/1509 (77%), Gaps = 44/1509 (2%)

Query: 27   QPYEGLDAAAQEEIKELARXXXXXXXXXXXEKRITGTGDPNTLTXXXXXXXXXXXXXXDI 86
             PY G D+ A E + ELAR               +     ++                D+
Sbjct: 32   HPYRGFDSEAAERVHELARTLTSQSLLYTANSNNS-----SSSNHNAHNADSRSVFSTDM 86

Query: 87   KGVNPILLDVNDPDYDETLDPRSENFSSVRWVRNMAQICENDSDFYKPFSLGCAWKDLSA 146
            +GVNP+  + + P Y+  LDP S+ FSS  WV+NMA IC +D DFYKP+SLGC WK+LSA
Sbjct: 87   EGVNPVFTNPDTPGYNPKLDPNSDQFSSTAWVQNMANICTSDPDFYKPYSLGCVWKNLSA 146

Query: 147  SGDSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILKPMDGCINPG 206
            SGDSAD++YQ TF N+  K L    R +          K    +  FQILKPMDGC+NPG
Sbjct: 147  SGDSADVSYQSTFANIVPKLLTKGLRLL----------KPSKEEDTFQILKPMDGCLNPG 196

Query: 207  ELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAESD 266
            ELLVVLGRPG+GCTTLLKSIS N+HGFKI+ D+I++YNG S+ +I+ HYRGEVVYNAESD
Sbjct: 197  ELLVVLGRPGSGCTTLLKSISSNSHGFKIAKDSIVSYNGLSSSDIRKHYRGEVVYNAESD 256

Query: 267  IHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGNDFV 326
            IH+PHLTV+QTL+TVAR+KTP+NRIKGVDR+ +A H+TEVAMATYGLSHT DTKVGND V
Sbjct: 257  IHLPHLTVYQTLFTVARMKTPQNRIKGVDREAYANHVTEVAMATYGLSHTRDTKVGNDLV 316

Query: 327  RGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATVAI 386
            RGVSGGERKRVSIAEV+ICG++FQCWDNATRGLDSATALEFI+ALKTQA I K+AATVAI
Sbjct: 317  RGVSGGERKRVSIAEVAICGARFQCWDNATRGLDSATALEFIRALKTQADIGKTAATVAI 376

Query: 387  YQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADYLTSITSPSE 446
            YQCS+DAYDLFDKVCVL DGYQ++FGP+K AKKYFQ MGY CP RQTTAD+LTSITSP+E
Sbjct: 377  YQCSQDAYDLFDKVCVLDDGYQLYFGPAKDAKKYFQDMGYYCPPRQTTADFLTSITSPTE 436

Query: 447  RIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHLDTDSSQQREQIKNAHIAK 506
            RI  K+ ++ G  +PQT  +M +YW+QSE YK L   ++  L+ ++ + R  I++AH AK
Sbjct: 437  RIISKEFIEKGTRVPQTPKDMAEYWLQSESYKNLIKDIDSTLEKNTDEARNIIRDAHHAK 496

Query: 507  QSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYEVML 566
            Q+KRA PSSPY V++ +QVKY+LIR+ WR+K   S+ L+ V+ ++ MA ILGSMFY+VM 
Sbjct: 497  QAKRAPPSSPYVVNYGMQVKYLLIRNFWRMKQSASVTLWQVIGNSVMAFILGSMFYKVMK 556

Query: 567  STTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFASTFS 626
               T+TFY+RG                EIFSLYETRPITEKH+TYSLY PSADAFAS  S
Sbjct: 557  KNDTSTFYFRGAAMFFAILFNAFSCLLEIFSLYETRPITEKHRTYSLYHPSADAFASVLS 616

Query: 627  DVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTLPQA 686
            ++P KL TAV FNI +YFL++ +R+ G FFFYFLIN+I  F +SHLFRC+GS++KTL +A
Sbjct: 617  EMPPKLITAVCFNIIFYFLVDFRRNGGVFFFYFLINVIATFTLSHLFRCVGSLTKTLQEA 676

Query: 687  MVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFHGRNFPCAQYI 746
            MVPAS+LLLA +MYTGFAIP+ ++LGWS WI YINPL+YLFESLMINEFH R FPCAQYI
Sbjct: 677  MVPASMLLLAISMYTGFAIPKTKILGWSIWIWYINPLAYLFESLMINEFHDRRFPCAQYI 736

Query: 747  PSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSVGIGLAXXXXXX 806
            P+GP Y N TG +  CSA+G+ PGN+YV GDDF++ +Y Y HK+KWR  GIG+A      
Sbjct: 737  PAGPAYQNITGTQRVCSAVGAYPGNDYVLGDDFLKESYDYEHKHKWRGFGIGMAYVVFFF 796

Query: 807  XXXXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQPTLSTSDAEKDVEMNN 866
                  CEYNEGAKQ GEM+VF  S                  Q      D E +   + 
Sbjct: 797  FVYLILCEYNEGAKQKGEMVVFLRSKIKQLKKEGKL-------QEKHRPGDIENNAGSSP 849

Query: 867  NSSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXXXXXXXXDDIELSKSQAIFHWK 926
            +S+ T+ + L DS      +                           + LSKS+AIFHW+
Sbjct: 850  DSATTEKKILDDSSEGSDSSSDNAG----------------------LGLSKSEAIFHWR 887

Query: 927  NLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVF 986
            +LCYD+PIK G+RRIL+NVDGWVKPGTLTAL+GASGAGKTTLLDCLAER TMG+ITG++F
Sbjct: 888  DLCYDVPIKGGQRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGNIF 947

Query: 987  VDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEV 1046
            VDGR RD+SFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQ   VSIEEK++YVEEVI++
Sbjct: 948  VDGRLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSIEEKNRYVEEVIKI 1007

Query: 1047 LEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQL 1106
            LEM+ Y+DA+VGV GEGLNVEQRKRLTIGVELAA+PKLLVFLDEPTSGLDSQTAW TCQL
Sbjct: 1008 LEMQQYSDAVVGVAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDSQTAWDTCQL 1067

Query: 1107 MKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGA 1166
            M+KLA+ GQAILCTIHQPSA+LMQ+FDRLLFLQ+GGQTVYFG+LG+GCKTMI+YFE+ GA
Sbjct: 1068 MRKLATHGQAILCTIHQPSAILMQQFDRLLFLQKGGQTVYFGDLGEGCKTMIDYFESKGA 1127

Query: 1167 HKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKELDWMERELPKRTEGS 1226
            HKCPPDANPAEWMLE+VGAAPG+HA+QDY  +WR+S+EY+ +Q+ELDWME+ LP R++  
Sbjct: 1128 HKCPPDANPAEWMLEVVGAAPGSHATQDYNEVWRNSDEYKAVQEELDWMEKNLPGRSKEP 1187

Query: 1227 SNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQ 1286
            + EE K FA S  YQ K+V+ RLF QYWR+P YLWSKF  TI +++FIGFTFFKA+ SLQ
Sbjct: 1188 TAEEHKPFAASLYYQFKMVTIRLFQQYWRSPDYLWSKFILTIFNQVFIGFTFFKADRSLQ 1247

Query: 1287 GLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSRTFSWKAFIVSQILVEIPW 1346
            GLQNQML+IFM+TV+FNPILQQYLP FVQQR+LYEARERPSRTFSW AF +SQI+VEIPW
Sbjct: 1248 GLQNQMLSIFMYTVIFNPILQQYLPSFVQQRDLYEARERPSRTFSWLAFFLSQIIVEIPW 1307

Query: 1347 NLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACAFYVYISSMGVLVISCIEIA 1406
            N+LAGTIA+ +YYY VGFY NAS A QLHERGALFWLF+ AFYVYI SMG+L+IS  E+A
Sbjct: 1308 NILAGTIAYCIYYYAVGFYANASAAGQLHERGALFWLFSIAFYVYIGSMGLLMISFNEVA 1367

Query: 1407 ENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDALLSVGLANASVVCS 1466
            E AA++ +L F M+LSFCGV+ATP ++PRFWIFMYRVSPLTY+IDALL++G+AN  V CS
Sbjct: 1368 ETAAHMGTLLFTMALSFCGVMATPKVMPRFWIFMYRVSPLTYMIDALLALGVANVDVKCS 1427

Query: 1467 SNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECHFCQFSSTNDYLATVSSSYS 1526
            + E++K  PPSG TC +YM  Y++  GTGYL D S+   C FC  S+TN +LAT SS Y 
Sbjct: 1428 NYEMVKFTPPSGTTCGDYMASYIKLAGTGYLSDPSATDICSFCAVSTTNAFLATFSSHYY 1487

Query: 1527 RRWMNYGIF 1535
            RRW NYGIF
Sbjct: 1488 RRWRNYGIF 1496

>CAGL0M01760g 203616..208115 highly similar to sp|P33302 Saccharomyces
            cerevisiae YOR153w PDR5 or sp|Q04182 Saccharomyces
            cerevisiae YDR406w PDR15 or sp|P51533 Saccharomyces
            cerevisiae YOR328w, hypothetical start
          Length = 1499

 Score = 2036 bits (5274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 962/1507 (63%), Positives = 1162/1507 (77%), Gaps = 65/1507 (4%)

Query: 29   YEGLDAAAQEEIKELARXXXXXXXXXXXEKRITGTGDPNTLTXXXXXXXXXXXXXXDIKG 88
            Y G D   Q+++++LAR                      TLT              + +G
Sbjct: 28   YHGFDHHVQDQVRQLAR----------------------TLTQQSSLHQKKEHTLPE-EG 64

Query: 89   VNPILLDVNDPDYDETLDPRSENFSSVRWVRNMAQICENDSDFYKPFSLGCAWKDLSASG 148
            +NPI  +    DY+  LDP S+ FSS  WV+NM+ I  +D D+YKP+SLGC WKDL A+G
Sbjct: 65   INPIFTNTEADDYNPRLDPTSDEFSSAEWVQNMSNISNSDPDYYKPYSLGCYWKDLVATG 124

Query: 149  DSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILKPMDGCINPGEL 208
            +SADI YQ  F N P K LK  +  +           +   D  F+ILK M+G +NPGEL
Sbjct: 125  ESADIEYQANFLNGPYKGLKTVYNTV-------VPSTASSKDKNFKILKSMEGAVNPGEL 177

Query: 209  LVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAESDIH 268
            LVVLGRPG+GCTTLLKSIS NTHGF I+ ++ I+Y+G +  +I+ H+RGEVVYNAE+DIH
Sbjct: 178  LVVLGRPGSGCTTLLKSISSNTHGFNIAKESTISYSGMTPNDIRKHFRGEVVYNAEADIH 237

Query: 269  IPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGNDFVRG 328
            +PHLTV+QTL TVARLKTP+NR+KG+DR+T+A+H+TEVAMAT+GLSHT +TKVGND VRG
Sbjct: 238  LPHLTVYQTLLTVARLKTPQNRLKGIDRETYARHLTEVAMATFGLSHTRNTKVGNDLVRG 297

Query: 329  VSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATVAIYQ 388
            VSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFI+ALK QA+I+ +AATVAIYQ
Sbjct: 298  VSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIRALKVQASISNAAATVAIYQ 357

Query: 389  CSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADYLTSITSPSERI 448
            CS+DAYDLFDKVCVLYDGYQI+FGP+ +AK+YFQ+MGYV PERQTTAD+LT++TSPSERI
Sbjct: 358  CSQDAYDLFDKVCVLYDGYQIYFGPAGKAKEYFQKMGYVSPERQTTADFLTAVTSPSERI 417

Query: 449  KDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHLDTDSSQQREQIKNAHIAKQS 508
             ++D +  GI +PQT  EM +YW  SE++  L  +++  L  +      +IK+AH+A+QS
Sbjct: 418  INQDYINRGIFVPQTPKEMWEYWRASEDHADLIKEIDSKLSDNYDANLAEIKDAHVARQS 477

Query: 509  KRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYEVMLST 568
            KRARPSSPYTVS+ +Q+KY+LIR+ WRIK    + LF V+ +++MA ILGSMFY+VM   
Sbjct: 478  KRARPSSPYTVSYGMQIKYLLIRNFWRIKQSSGVTLFMVIGNSSMAFILGSMFYKVMKHN 537

Query: 569  TTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFASTFSDV 628
            TT+TFY+RG                EIFSL+E RPITEKH+TYSLY PSADAFAS  S+V
Sbjct: 538  TTSTFYFRGAAMFFAVLFNAFSSLLEIFSLFEARPITEKHRTYSLYHPSADAFASILSEV 597

Query: 629  PTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTLPQAMV 688
            P KL TAV FNI YYFL+N +R+ G FFFYFLINI+ VFAMSHLFRC+GSVSKTL  AMV
Sbjct: 598  PAKLITAVCFNIIYYFLVNFRRNGGVFFFYFLINIVAVFAMSHLFRCVGSVSKTLSAAMV 657

Query: 689  PASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFHGRNFPCAQYIPS 748
            PAS+LLL  +MY+GFAIPR ++LGWSKWI YINPL+YLFESLMINEFH R FPC+QYIPS
Sbjct: 658  PASMLLLGLSMYSGFAIPRTKILGWSKWIWYINPLAYLFESLMINEFHDRKFPCSQYIPS 717

Query: 749  GPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSVGIGLAXXXXXXXX 808
            G  Y N   D   CS++G+I GN+YV GDDF++ +Y Y HK+KWR  GIGLA        
Sbjct: 718  GSVYNNVPADSRICSSVGAIRGNDYVLGDDFLRESYSYLHKHKWRGFGIGLAYVIFFLVL 777

Query: 809  XXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQPTLSTSDAEKDVEMNNNS 868
                CEYNEGAKQ GE+LVFP +                  +  L    ++ DVE+ + S
Sbjct: 778  YLILCEYNEGAKQKGEILVFPQNIVRRMK-----------KERKLKNVSSDNDVEIGDVS 826

Query: 869  SATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXXXXXXXXDDIELSKSQAIFHWKNL 928
              +D + L DS      +D++                       +I LS+S+AIFHW+NL
Sbjct: 827  DISDKKILADS------SDES------------------EESGANIGLSQSEAIFHWRNL 862

Query: 929  CYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVD 988
            CYD+ IK   RRIL+NVDGWVKPGTLTAL+GASGAGKTTLLDCLAER TMG+ITG+V VD
Sbjct: 863  CYDVQIKKETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGEVSVD 922

Query: 989  GRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLE 1048
            G+ RD SF RSIGYCQQQDLHLKT+TVRESLRFSAYLRQ  DVSIEEK++YVE+VI++LE
Sbjct: 923  GKQRDDSFARSIGYCQQQDLHLKTSTVRESLRFSAYLRQPADVSIEEKNQYVEDVIKILE 982

Query: 1049 MKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMK 1108
            M+ YADA+VGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWS CQLMK
Sbjct: 983  MEQYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSICQLMK 1042

Query: 1109 KLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGAHK 1168
            KLA+ GQAILCTIHQPSA+LMQEFDRLLFLQ GG+TVYFG+LG GCKTMI+YFE+HG+HK
Sbjct: 1043 KLANHGQAILCTIHQPSAILMQEFDRLLFLQRGGKTVYFGDLGDGCKTMIDYFESHGSHK 1102

Query: 1169 CPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKELDWMERELPKRTEGSSN 1228
            CPPDANPAEWMLE+VGAAPG+HA+QDY  +WR+S+EY+++Q+EL+WM  ELPK+   +S 
Sbjct: 1103 CPPDANPAEWMLEVVGAAPGSHANQDYHEVWRNSDEYQKVQEELEWMSNELPKKNTNNSE 1162

Query: 1229 EEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQGL 1288
               KEFAT  LYQ KLVS RLF QYWR+P YLWSKFF TI + +FIGFTFFKA+ SLQGL
Sbjct: 1163 TVHKEFATGVLYQCKLVSLRLFQQYWRSPDYLWSKFFLTIFNNIFIGFTFFKADRSLQGL 1222

Query: 1289 QNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSRTFSWKAFIVSQILVEIPWNL 1348
            QNQMLA+FMFTV+FNP+LQQYLP FVQQR+LYEARERPSRTFSWKAFIVSQILVEIPWN+
Sbjct: 1223 QNQMLAVFMFTVIFNPLLQQYLPSFVQQRDLYEARERPSRTFSWKAFIVSQILVEIPWNI 1282

Query: 1349 LAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACAFYVYISSMGVLVISCIEIAEN 1408
            LAGT+AF +YYY +GFY NAS A+QLHERGALFWLF+CAFYVYI S+ +  IS  ++AE 
Sbjct: 1283 LAGTVAFVIYYYAIGFYSNASVAHQLHERGALFWLFSCAFYVYIGSLALFCISFNQVAEA 1342

Query: 1409 AANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDALLSVGLANASVVCSSN 1468
            AAN+ASL F +SLSFCGVL TPN +PRFWIFMYRVSPLTYLID +LS G+AN ++ CS+ 
Sbjct: 1343 AANMASLMFTLSLSFCGVLVTPNGMPRFWIFMYRVSPLTYLIDGMLSTGVANVAIKCSNY 1402

Query: 1469 ELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECHFCQFSSTNDYLATVSSSYSRR 1528
            ELL+  P + +TC EY+ PY+Q+  TGY++D S+   C  C +S TND+L++VSS YSRR
Sbjct: 1403 ELLRFSPAANLTCGEYLGPYLQTVKTGYIVDPSATDTCELCPYSHTNDFLSSVSSKYSRR 1462

Query: 1529 WMNYGIF 1535
            W N+GIF
Sbjct: 1463 WRNWGIF 1469

>Scas_586.3
          Length = 1531

 Score = 2033 bits (5268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 969/1513 (64%), Positives = 1159/1513 (76%), Gaps = 61/1513 (4%)

Query: 27   QPYEGLDAAAQEEIKELARXXXXXXXXXXXEKRITGTGDPNTLTXXXXXXXXXXXXXXDI 86
             PY G D  AQ++I++LAR           E  I    D  ++                +
Sbjct: 24   HPYMGFDKTAQDQIRDLARTLTQLSVAHPSESAIDQGSDVQSI------------YSTGL 71

Query: 87   KGVNPILLDVNDPDYDETLDPRSENFSSVRWVRNMAQICENDSDFYKPFSLGCAWKDLSA 146
             G+NP+  + + P YDE LDP S+NFSS  WV+NMA I ++D DFYKP+SLGC WK+LSA
Sbjct: 72   PGINPVYTNPDTPGYDEKLDPASDNFSSTAWVKNMANIAKSDPDFYKPYSLGCVWKNLSA 131

Query: 147  SGDSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILKPMDGCINPG 206
            SGDSAD++YQ T  NMP K +   +R ++          + + D+ FQILK MDG +NPG
Sbjct: 132  SGDSADVSYQATILNMPWKIITYVYRKVT---------PTREIDT-FQILKSMDGILNPG 181

Query: 207  ELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAESD 266
            ELLVVLGRPG+GCTTLLKSIS NTHGF IS D+II+YNG + K+I+ HYRGEVVYNAESD
Sbjct: 182  ELLVVLGRPGSGCTTLLKSISSNTHGFDISKDSIISYNGLTPKDIRRHYRGEVVYNAESD 241

Query: 267  IHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGNDFV 326
            IH+PHLTV+QTL TVARLKTP NRIK V R+ +A H+T+V MATYGL HT DTKVG+D V
Sbjct: 242  IHLPHLTVYQTLLTVARLKTPSNRIKDVTREDYANHLTQVTMATYGLLHTRDTKVGDDLV 301

Query: 327  RGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATVAI 386
            +GVSGGERKRVSIAEVSICGSK QCWDNATRGLDSATALEFI+ALKTQATI  + ATVAI
Sbjct: 302  KGVSGGERKRVSIAEVSICGSKVQCWDNATRGLDSATALEFIRALKTQATILNTTATVAI 361

Query: 387  YQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADYLTSITSPSE 446
            YQCS+D YDLFDKVCVL DGYQ+++GPS +AKKYFQ MGYVCP RQTTAD+LTS+TSP+E
Sbjct: 362  YQCSQDTYDLFDKVCVLDDGYQLYYGPSDRAKKYFQDMGYVCPPRQTTADFLTSVTSPTE 421

Query: 447  RIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHLDTDSSQQREQIKNAHIAK 506
            RI ++DM+K+G  IPQT  EM +YW++S +Y+QL  Q++  L ++  +QR+ I+ AHIAK
Sbjct: 422  RILNQDMLKNGKKIPQTPREMGEYWLESPDYQQLMQQIDAELSSNQDEQRDVIREAHIAK 481

Query: 507  QSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYEVML 566
            QSKRARPSSPY VS+ +QVKY+LIR+ WRIK   S+ +F V+ ++ +A ILGSMFY+V  
Sbjct: 482  QSKRARPSSPYVVSYMMQVKYLLIRNYWRIKQRASVTIFQVVGNSVIAFILGSMFYKVQK 541

Query: 567  STTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFASTFS 626
               ++TFY+RG                EIF+L+E RPITEKH+TYSLY PSADAFAS  S
Sbjct: 542  KADSSTFYFRGAAMFFAILFNAFSSLLEIFTLFEARPITEKHRTYSLYHPSADAFASVLS 601

Query: 627  DVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTLPQA 686
            +VP KL T+V FNI YYFL+N KRDAG FFFYFLI+I++ FA+SHLFRC GS+SKTLP A
Sbjct: 602  EVPAKLVTSVCFNIIYYFLVNFKRDAGIFFFYFLISIVSTFALSHLFRCNGSLSKTLPGA 661

Query: 687  MVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFHGRNFPCAQYI 746
            MVPAS+LLLA +MYTGFAIP  +MLGWSKWI YINPL+YLFESLMINEFH R FPCAQ+I
Sbjct: 662  MVPASMLLLAISMYTGFAIPETKMLGWSKWIWYINPLAYLFESLMINEFHDRRFPCAQFI 721

Query: 747  PSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSVGIGLAXXXXXX 806
            P+GP Y NATG E  C+A+GS+PG ++V+GD F+  +YGY+HK+KWR  G+G+A      
Sbjct: 722  PAGPPYQNATGTERVCAAVGSVPGQDFVNGDIFLLESYGYQHKHKWRGFGVGMAFVVFFF 781

Query: 807  XXXXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQPTLSTSDAEKDVEMNN 866
                  CEYNEGAKQ GEML+FP +                  Q  L      KD    +
Sbjct: 782  FGYLILCEYNEGAKQRGEMLIFPQN-----------IVRKMKKQGKLKGKHPNKD----D 826

Query: 867  NSSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXXXXXXXXDDIE----LSKSQAI 922
              +A  S     ++ +I+ +                         DD+E    LSKS+AI
Sbjct: 827  IEAAASSMECNTTEKSILNSSSI--------------------NYDDMESEVGLSKSEAI 866

Query: 923  FHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLIT 982
            FHW+NLCY+IPIK   R IL+N+DGWVKPGTLTAL+GASGAGKTTLLDCLA+R T+G IT
Sbjct: 867  FHWRNLCYEIPIKKEIRHILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAQRVTVGTIT 926

Query: 983  GDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEE 1042
            GDVFV+G  RD+SFPRSIGYCQQQDLHLKT+TVRESLRFSAYLRQ  DV +EEK+KYVEE
Sbjct: 927  GDVFVNGCLRDESFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPFDVPVEEKNKYVEE 986

Query: 1043 VIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWS 1102
            +I+ LEM+ YADA+VGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAW+
Sbjct: 987  IIKTLEMETYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWA 1046

Query: 1103 TCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFE 1162
            TCQLMKKLA  GQAILCTIHQPSA+LMQ FDRLLFLQ+GG+TVYFG+LG GC+TMI+YFE
Sbjct: 1047 TCQLMKKLAQNGQAILCTIHQPSAILMQNFDRLLFLQKGGETVYFGDLGSGCQTMIDYFE 1106

Query: 1163 AHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKELDWMERELPKR 1222
              GA KCPP+ANPAEWML+I+GAAPG+HA +D+   WR+SEEY+ +QKELDWME+ELP+R
Sbjct: 1107 KEGAEKCPPEANPAEWMLQIIGAAPGSHAIKDFHKAWRNSEEYKAVQKELDWMEQELPRR 1166

Query: 1223 TEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFKAN 1282
               ++ EE K FATS  YQ KLVS RLF QYWR+P YLWSK+  T+ +E FIGFTFFKA+
Sbjct: 1167 ASETTPEEHKRFATSVWYQFKLVSVRLFQQYWRSPEYLWSKYLLTVFNETFIGFTFFKAD 1226

Query: 1283 TSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSRTFSWKAFIVSQILV 1342
             ++QGLQNQMLA FMFTVVFNP+L+QYLP FV+QR LYEARERPSRTFSW AFI+SQI+V
Sbjct: 1227 RTMQGLQNQMLATFMFTVVFNPLLEQYLPGFVEQRGLYEARERPSRTFSWIAFILSQIVV 1286

Query: 1343 EIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACAFYVYISSMGVLVISC 1402
            EIPWN +AGTIA+F+YYY +GFY NAS A QLHERGAL+WL   AF+VYI SM V VIS 
Sbjct: 1287 EIPWNFVAGTIAYFIYYYAIGFYMNASAAGQLHERGALYWLLCTAFFVYIGSMAVAVISF 1346

Query: 1403 IEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDALLSVGLANAS 1462
            IEIA+ A  LASL F M+LSFCGV+ TP+ LPRFWIFMYR+SPLTYLIDA LSVG+AN  
Sbjct: 1347 IEIADTAGQLASLLFTMALSFCGVMVTPSALPRFWIFMYRISPLTYLIDAFLSVGIANVD 1406

Query: 1463 VVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECHFCQFSSTNDYLATVS 1522
            V C+S E ++  PP GM C  YM PY+Q TGTGYL D S+   CHFCQFS TND+L +V 
Sbjct: 1407 VECASFEFVQFSPPPGMDCGTYMAPYIQMTGTGYLSDSSATDTCHFCQFSHTNDFLKSVG 1466

Query: 1523 SSYSRRWMNYGIF 1535
            S YS+RW N+GIF
Sbjct: 1467 SDYSKRWRNWGIF 1479

>KLLA0F21692g complement(2014152..2018729)
            gi|14571818|gb|AAK67294.1|AF245358_1 Kluyveromyces lactis
            multidrug pump KlPDR5, start by similarity
          Length = 1525

 Score = 1837 bits (4757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 887/1509 (58%), Positives = 1087/1509 (72%), Gaps = 52/1509 (3%)

Query: 29   YEGLDAAAQEEIKELARXXXXXXXXXXXEKRITGTGDPNTLTXXXXXXXXXXXXXXDIKG 88
            Y+G D   QE+I++LAR            ++   TG  N L               +  G
Sbjct: 12   YQGFDHQVQEQIRDLARTLSRNSLKEQASQQ-ESTG--NVLASDDDGAKSIFSTRYE--G 66

Query: 89   VNPILLDVNDPDYDETLDPRSENFSSVRWVRNMAQICENDSDFYKPFSLGCAWKDLSASG 148
            VNP+  D +   YD  LDP S+ FSS  W++NM  +  ND ++YK +++GC WKDL A G
Sbjct: 67   VNPVFTDSDASGYDVRLDPNSDEFSSAAWIKNMVALANNDPEYYKHYTIGCCWKDLRAFG 126

Query: 149  DSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILKPMDGCINPGEL 208
            DS D+ YQ T  N+P K      R       H    K ED    F ILKPMDG + PG+L
Sbjct: 127  DSTDVAYQSTVLNLPGKIFSSVKR-------HFVKSKPEDV---FDILKPMDGLLKPGDL 176

Query: 209  LVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAESDIH 268
            LVVLGRPG+GCTTLLK+IS N  G+ +  +++I+YNG   + IK H+RGEVVYNAESD+H
Sbjct: 177  LVVLGRPGSGCTTLLKTISSNIDGYNVDENSVISYNGLDPRTIKKHFRGEVVYNAESDVH 236

Query: 269  IPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGNDFVRG 328
             PHL+V++TLY +A L TP NRIKG  R+ FA H+T+VAMATYGLSHT DTKVGN+ VRG
Sbjct: 237  FPHLSVYETLYNIALLVTPSNRIKGATREEFANHVTQVAMATYGLSHTRDTKVGNELVRG 296

Query: 329  VSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATVAIYQ 388
            VSGGERKRVSIAEV+ICGS+FQCWDNATRGLDSATALEFI+ALKT   I+ S   +AIYQ
Sbjct: 297  VSGGERKRVSIAEVTICGSRFQCWDNATRGLDSATALEFIRALKTSTDISGSTGVIAIYQ 356

Query: 389  CSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADYLTSITSPSERI 448
            CS+DAYDLFDKVCVL++GYQIF+G +K AK YF+RMGYV P RQTTAD+LT++T+P+ERI
Sbjct: 357  CSQDAYDLFDKVCVLHEGYQIFYGNAKAAKAYFERMGYVSPSRQTTADFLTAVTNPAERI 416

Query: 449  KDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHLDTDSSQQREQIKNAHIAKQS 508
             +++ VK G  IP TA +M +YW  S EYKQL+ ++ + L+ DS+Q R+++  AHIA+QS
Sbjct: 417  VNQEFVKEGRFIPSTAKQMEEYWRNSPEYKQLRGEIEEELNKDSTQTRQELIEAHIARQS 476

Query: 509  KRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYEVMLST 568
            KR R  SPY V++ +QVKY+ +R+  RIK    I + T++ + AM+L+LGS+FY+ M  T
Sbjct: 477  KRQRKESPYIVNYGMQVKYLTMRNFLRIKKSYGITVGTIVGNTAMSLVLGSIFYKSMKDT 536

Query: 569  TTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFASTFSDV 628
            TT TF+YRG                EIFSLYE RPI EKHK YSLY PSADA AS  S++
Sbjct: 537  TTNTFFYRGAAMFIAVLFNSFSSMLEIFSLYEARPIIEKHKRYSLYHPSADALASMLSEL 596

Query: 629  PTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTLPQAMV 688
            P K+ TA+ FN+  YF++N +R+AG FFFYFL+N +    MS +FRC+GS +KTL +AMV
Sbjct: 597  PAKIITAICFNLILYFMVNFRREAGPFFFYFLMNFLATLVMSAIFRCVGSATKTLSEAMV 656

Query: 689  PASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFHGRNFPCAQYIPS 748
            PAS LLLA ++Y GF+IP+  +LGWS+WI YINPLSY+FESLMINEF+GR+FPCA YIPS
Sbjct: 657  PASCLLLAISLYVGFSIPKKNLLGWSRWIWYINPLSYIFESLMINEFNGRDFPCAAYIPS 716

Query: 749  GPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSVGIGLAXXXXXXXX 808
            G  Y N    E  C+ + S PG +YVSG  FI+  YGY   ++WR++GI LA        
Sbjct: 717  GSGYENIGLYERVCNTVASQPGLSYVSGRAFIEEAYGYNPSHRWRALGIALAYFIFFTAF 776

Query: 809  XXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQPTLSTSDAEKDVEMNNNS 868
                CE+NE A Q GE+L+FP S                          A+ DVE   +S
Sbjct: 777  YLLFCEFNESAVQKGEILLFPKSVLKRAKKQKLI--------------KAKHDVEAVQDS 822

Query: 869  SA--TDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXXXXXXXXDDIELSKSQAIFHWK 926
                TD + L+DS      +  +                       ++ LSKS+AIFHW+
Sbjct: 823  EGALTDQKLLQDSLVESNISSSSDKSV-------------------NVGLSKSEAIFHWR 863

Query: 927  NLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVF 986
            N+CYD+ IK   RRIL NVDGWVKPGTLTAL+G+SGAGKTTLLDCLA R TMG+ITGD+F
Sbjct: 864  NVCYDVQIKKETRRILSNVDGWVKPGTLTALMGSSGAGKTTLLDCLASRVTMGVITGDMF 923

Query: 987  VDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEV 1046
            V+G  RD SFPRSIGYCQQQDLHL T+TVRESLRFSAYLRQ   VSIEEK+ YVE+VI +
Sbjct: 924  VNGHLRDNSFPRSIGYCQQQDLHLSTSTVRESLRFSAYLRQPSSVSIEEKNNYVEDVINI 983

Query: 1047 LEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQL 1106
            LEM+ YADA+VGV GEGLNVEQRKRLTIGVELAAKPKLL+FLDEPTSGLDSQTAWS CQL
Sbjct: 984  LEMQQYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLLFLDEPTSGLDSQTAWSVCQL 1043

Query: 1107 MKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGA 1166
            M+KLA  GQAILCTIHQPSALLMQEFD LLFLQ+GG+TVYFG LG+GC+ MINYFE HGA
Sbjct: 1044 MRKLADHGQAILCTIHQPSALLMQEFDILLFLQKGGKTVYFGNLGEGCQEMINYFEKHGA 1103

Query: 1167 HKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKELDWMERELPKRTEGS 1226
             KCP  ANPAEWML+++GAAPG+HA+QDY  +WR+S+EY+ +QKELDWME EL K+   +
Sbjct: 1104 SKCPEGANPAEWMLDVIGAAPGSHATQDYHEVWRNSDEYQAVQKELDWMESELRKKPLDT 1163

Query: 1227 SNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQ 1286
            S+ EQ EF TS  YQ K+V+ RLF QY+RTP Y+WSK F TI S+LFIGFTFFKAN S+Q
Sbjct: 1164 SS-EQSEFGTSLFYQYKVVTLRLFEQYYRTPSYIWSKLFLTIFSQLFIGFTFFKANLSIQ 1222

Query: 1287 GLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSRTFSWKAFIVSQILVEIPW 1346
            GLQNQ+ AIF FTV+FNP  QQYLPLFV QR+LYEARERPSRTFSW AFI SQI VEIP 
Sbjct: 1223 GLQNQLFAIFTFTVIFNPACQQYLPLFVSQRDLYEARERPSRTFSWLAFIFSQITVEIPL 1282

Query: 1347 NLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACAFYVYISSMGVLVISCIEIA 1406
            N+  GTIAFFV+YYP+GFY NASYA QL+ERG LFWLF+ +FYV+ISSMG L I+ ++ A
Sbjct: 1283 NICFGTIAFFVFYYPIGFYNNASYAGQLNERGVLFWLFSVSFYVFISSMGQLCIAGLQYA 1342

Query: 1407 ENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDALLSVGLANASVVCS 1466
            E A N+ASL F MSL+FCGV     +LP FWIFMYR+SPLTY ID +LS GLAN  V C+
Sbjct: 1343 EAAGNMASLMFTMSLNFCGVFGGSGVLPGFWIFMYRISPLTYFIDGVLSTGLANNPVTCA 1402

Query: 1467 SNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECHFCQFSSTNDYLATVSSSYS 1526
            + E +   P SG TC EYM  Y+   G GYLLD ++  +C+FC+ S TN +L +  SSY 
Sbjct: 1403 NYEYVSFNPRSGETCGEYMADYIDKNG-GYLLDSNATEDCNFCKISETNAFLTSFQSSYH 1461

Query: 1527 RRWMNYGIF 1535
            RRW N+GIF
Sbjct: 1462 RRWRNFGIF 1470

>Kwal_27.9666
          Length = 1474

 Score = 1790 bits (4636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 859/1452 (59%), Positives = 1058/1452 (72%), Gaps = 63/1452 (4%)

Query: 89   VNPILLDVNDPDYDETLDPRSENFSSVRWVRNMAQICENDSDFYKPFSLGCAWKDLSASG 148
            +NP    +    YD  LDP S++FSSV W+RN+ +I  +D +FYKP+SLGC+W +L A G
Sbjct: 44   LNPFSSSIGGAGYDPKLDPNSDSFSSVAWMRNLNKIVTSDPEFYKPYSLGCSWTNLRAYG 103

Query: 149  DSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILKPMDGCINPGEL 208
             S D+TYQ T  N+P+K  + ++RC           K+   D+ F ILKPMDG I PGEL
Sbjct: 104  SSMDVTYQSTVANLPLKIAEFAYRCAR---------KARPADT-FDILKPMDGLIKPGEL 153

Query: 209  LVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAESDIH 268
            LVVLGRPG+GC+TLLKSIS NTHGF I  ++ I+Y+G S  EI  HYRGEVVYNAE+D+H
Sbjct: 154  LVVLGRPGSGCSTLLKSISSNTHGFHIDKESHISYDGMSPMEIHKHYRGEVVYNAEADVH 213

Query: 269  IPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGNDFVRG 328
             PHLTVF+TL   A L TP NR+ GVDR+ FA H+TEV MATYGL H  DTKVGN+ VRG
Sbjct: 214  FPHLTVFETLNIAALLSTPANRVPGVDREAFANHVTEVTMATYGLLHARDTKVGNELVRG 273

Query: 329  VSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATVAIYQ 388
            VSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEF+KAL+T A +T S+A +A YQ
Sbjct: 274  VSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFVKALETNAKMTSSSAAIATYQ 333

Query: 389  CSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADYLTSITSPSERI 448
            CS+DAYDLFDKVCVL++GYQIFFGP+ + KKYF+ MGY+CP+RQTTAD+LT++T+P+ERI
Sbjct: 334  CSQDAYDLFDKVCVLHEGYQIFFGPANEGKKYFEDMGYICPDRQTTADFLTAVTNPAERI 393

Query: 449  KDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHLDTDSSQQREQIKNAHIAKQS 508
             +K        +P TA EM  +W  SE YK+L  ++  +      +++ Q++ AHI+KQS
Sbjct: 394  VNKSFS----YVPSTASEMEIHWKNSENYKRLCDEIESYRAQKLDEKKHQLREAHISKQS 449

Query: 509  KRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYEVMLST 568
            K AR +SPYTVS+ LQVKY+L R+  RI+N   + +FT++ H  +A +LGSMFY+V+   
Sbjct: 450  KHARSASPYTVSYGLQVKYLLRRNFMRIRNSMGLTVFTIVGHGGIAFVLGSMFYKVLKHN 509

Query: 569  TTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFASTFSDV 628
            TT + + R                 EI +LYE RPI+EKHK YSLY PSADA AS  S++
Sbjct: 510  TTDSLFSRAGALFFSVLFNAFSCMLEILALYEARPISEKHKRYSLYHPSADALASIISEI 569

Query: 629  PTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTLPQAMV 688
            PTK+A A TFNI  YFL N KRDAGAFFF+F++N++  F MSH+FRC+GS +KT  ++MV
Sbjct: 570  PTKIAVATTFNIAMYFLCNFKRDAGAFFFFFMMNLLATFVMSHIFRCLGSATKTYSESMV 629

Query: 689  PASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFHGRNFPCAQYIPS 748
             ASV+LLA ++YTGFAIP+ ++LGW+KWI YINPLSY+FESLM+NEFHGR F C+ ++P+
Sbjct: 630  TASVILLALSIYTGFAIPKTKILGWAKWIWYINPLSYIFESLMVNEFHGREFQCSNFVPA 689

Query: 749  GPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSVGIGLAXXXXXXXX 808
            GP YV ++G E  CSA+GS  G + V G+ +I  +YGY H +KWR  GIGLA        
Sbjct: 690  GPAYVGSSGTERVCSAVGSEAGLSVVHGERYINLSYGYYHAHKWRGFGIGLAYAIFFLGV 749

Query: 809  XXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQPTLSTSDAEKDVEMNNNS 868
                 E+NE AKQ GE+LVF  S                  +     +D E D       
Sbjct: 750  YLAFTEFNESAKQRGEVLVFTRSTMKRI------------KKGITVLNDVENDA---GAQ 794

Query: 869  SATDSRFLRD-----SDAAIMGNDKTVAKEHYXXXXXXXXXXXXXXXXDDIELSKSQAIF 923
            SAT+ R   D     S  +++GN                           ++LSKS+AIF
Sbjct: 795  SATEKRLFDDTTEVGSSISVLGN---------------------------VQLSKSEAIF 827

Query: 924  HWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITG 983
            HWK+LCYD+PIK G RRILD+VDGWVKPGTLTAL+GASGAGKTTLLDCLA R T G++TG
Sbjct: 828  HWKSLCYDVPIKGGTRRILDHVDGWVKPGTLTALMGASGAGKTTLLDCLASRVTTGVVTG 887

Query: 984  DVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEV 1043
            D+ ++G  RD SF RSIGYCQQQDLHL+TATVRESLRF+A+LRQ   V   EKDKYV+EV
Sbjct: 888  DILINGNKRDASFARSIGYCQQQDLHLQTATVRESLRFAAHLRQPQSVPSSEKDKYVDEV 947

Query: 1044 IEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWST 1103
            I++LEM+ YADA+VGV GEGLNVEQRKRLTIGVELAA+PKLL+FLDEPTSGLDSQTAWS 
Sbjct: 948  IKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAARPKLLLFLDEPTSGLDSQTAWSI 1007

Query: 1104 CQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEA 1163
            CQLM+KLA+ GQAILCTIHQPSALLMQEFDRLLFLQ GGQTVYFGELG GC+TMI+YFE 
Sbjct: 1008 CQLMRKLANHGQAILCTIHQPSALLMQEFDRLLFLQRGGQTVYFGELGDGCQTMIDYFEK 1067

Query: 1164 HGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKELDWMERELPKRT 1223
            HG+  CPP ANPAEWMLE++GAAPG+HA QDY  +W++SEE + + +ELD ME E     
Sbjct: 1068 HGSQPCPPGANPAEWMLEVIGAAPGSHAEQDYHVVWKNSEENKAVHRELDRMETEFENMP 1127

Query: 1224 EGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFKANT 1283
             G+ ++   EF+ S  YQ  LV+ RL  QYWRTP YLWSK   T  S+LFIGFTFFKA+ 
Sbjct: 1128 SGTVDD--SEFSASLTYQYALVTRRLLTQYWRTPSYLWSKLILTAFSQLFIGFTFFKADN 1185

Query: 1284 SLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSRTFSWKAFIVSQILVE 1343
            SLQGLQNQML++FMFT++FNP LQQYLP FV QR LYEARERPSRTFSW AFI+SQI VE
Sbjct: 1186 SLQGLQNQMLSVFMFTIIFNPSLQQYLPTFVAQRNLYEARERPSRTFSWLAFILSQITVE 1245

Query: 1344 IPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACAFYVYISSMGVLVISCI 1403
            IPWN   GT+ F  YYYPV FYRNAS+A QL ERGALFWLF  AFYV+  SM  L ++  
Sbjct: 1246 IPWNFAIGTLGFLCYYYPVSFYRNASFAGQLSERGALFWLFCTAFYVFTGSMAQLCVAAA 1305

Query: 1404 EIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDALLSVGLANASV 1463
            E+A++AA LA L F ++LSFCGV+  P  +P FWIFMYRVSPLTY +D +L+ G+ANA  
Sbjct: 1306 EVADSAAQLAVLLFTVALSFCGVMVAPGNMPGFWIFMYRVSPLTYFVDGVLATGIANAKA 1365

Query: 1464 VCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECHFCQFSSTNDYLATVSS 1523
             CS+ EL+   PPSG +C +YM PY+   GTGY+ + ++   C FC  S+TN YL+ VSS
Sbjct: 1366 HCSAYELVSFQPPSGQSCGDYMSPYITDAGTGYITNPNATENCSFCSISTTNAYLSAVSS 1425

Query: 1524 SYSRRWMNYGIF 1535
            +Y  RW NYGIF
Sbjct: 1426 NYKHRWRNYGIF 1437

>KLLA0D03476g 296287..300969 similar to sp|P33302 Saccharomyces
            cerevisiae YOR153w PDR5 pleiotropic drug resistance
            protein, start by similarity
          Length = 1560

 Score = 1509 bits (3908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 746/1455 (51%), Positives = 967/1455 (66%), Gaps = 65/1455 (4%)

Query: 89   VNP----ILLDVNDPDYDETLDPRSENFSSVRWVRNMAQICENDSDFYKPFSLGCAWKDL 144
            +NP    I  D +    D  LDP S NF S  WV+ M Q+  +D D+YKP SLG   K L
Sbjct: 108  INPDDVKIPFDEDARSADPRLDPYSANFDSKFWVQTMHQMFNSDPDYYKPVSLGVCLKGL 167

Query: 145  SASGDSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILKPMDGCIN 204
              SG S D  YQ T  N P+K L  +   +S+R          D    F IL+PMD    
Sbjct: 168  RVSGVSVDADYQATVANAPLKVLNAARHFVSKR----------DESRYFDILRPMDALFE 217

Query: 205  PGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAE 264
            PG L  VLGRPGAGC+TLLK++S  T+GF + P+++I+Y+G S  +I+ HYRG+V+Y+AE
Sbjct: 218  PGRLCTVLGRPGAGCSTLLKTVSARTYGFTVRPESVISYDGISQHDIEKHYRGDVIYSAE 277

Query: 265  SDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGND 324
             D H  +L V  TL   AR + P  R +GV R+ + KH   V MATYGLSHT  TKVG+D
Sbjct: 278  MDYHFANLNVGYTLEFAARCRCPSARPQGVSREEYYKHYAAVVMATYGLSHTYSTKVGDD 337

Query: 325  FVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATV 384
            +VRGVSGGERKRVSIAEV++ G+K QCWDNATRGLDSATALEF++ALKT ATI+++   +
Sbjct: 338  YVRGVSGGERKRVSIAEVTLAGAKVQCWDNATRGLDSATALEFVRALKTNATISRTTPLL 397

Query: 385  AIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADYLTSITSP 444
            AIYQCS+DAYDLFD V VLY+G QI+FGP+  AK+YF  MG+ CP+RQTTAD+LTS+T+ 
Sbjct: 398  AIYQCSQDAYDLFDDVLVLYEGRQIYFGPADSAKQYFLDMGWECPDRQTTADFLTSVTAA 457

Query: 445  SERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQV----NKHLDTDSSQQREQIK 500
            +ER   K    +   +P+T  E  ++W  S EY QL  ++    NKH + DS+++     
Sbjct: 458  NER---KCRPGYEKKVPKTPDEFYEHWKSSSEYAQLMNRIDAYLNKHNNEDSAKE---FF 511

Query: 501  NAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSM 560
            + H A+QSK ++ SSP+ +SF +QVK ++ R++ R+K DPS+  F +  + +MA I+ SM
Sbjct: 512  DHHTARQSKHSKSSSPFLLSFMMQVKAVMDRNVQRLKGDPSVYAFNIFGNCSMAFIISSM 571

Query: 561  FYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADA 620
            FY       T +FYYR                 EI SL+E R I EKHKTY+ YRPSADA
Sbjct: 572  FYNQ--KDNTGSFYYRTAALFTALLFNSFGSLLEILSLFEARKIVEKHKTYAFYRPSADA 629

Query: 621  FASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVS 680
             AS  +++P+K   A+ FN+ YYFL+N +R  G FFFYFLI I + F MSHLFR IG+  
Sbjct: 630  LASIITELPSKFIIAICFNLIYYFLVNFRRSPGHFFFYFLIAITSTFTMSHLFRSIGAAC 689

Query: 681  KTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFHGRNF 740
             TL QAM+PAS+LLL  ++Y GF IP+  +LGWSKW+ Y+NP++   E+++ NEF GR F
Sbjct: 690  TTLEQAMLPASILLLILSIYAGFVIPKGNILGWSKWLYYLNPIARSMEAMVANEFAGRTF 749

Query: 741  PCAQYIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSVGIGLA 800
             C+Q+IP+G  Y         CS +GS PG+ YVSG  +++ ++ Y+   +WR+ GI L 
Sbjct: 750  ECSQFIPAGGEYDELPLALKICSVVGSEPGSAYVSGTAYMEESFSYKDSYRWRNWGIVLC 809

Query: 801  XXXXXXXXXXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQPTLSTSDAEK 860
                         EYN+G  Q GEM VFP S                 +  +L       
Sbjct: 810  YAVFFLAVYLLLIEYNKGEMQKGEMTVFPRSVLMKLKKKNQNLKNDIESNDSLLK----- 864

Query: 861  DVEMNNNSSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXXXXXXXXDDIELSKSQ 920
              +M N + + D +    SD++   N+K   K                       +   Q
Sbjct: 865  --DMTNGNDSQDEK----SDSS---NEKMAEK-----------------------IGSDQ 892

Query: 921  AIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGL 980
             +F WKN+CYD+ IK   RRILDNVDGWVKPGTLTAL+G+SGAGKTTLLD LA+R + G+
Sbjct: 893  VVF-WKNICYDVQIKTETRRILDNVDGWVKPGTLTALMGSSGAGKTTLLDALADRISTGV 951

Query: 981  ITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYV 1040
            ITGDV V+GRP D SF RS GYCQQQDLH +T TVRE+L FSAYLRQ  +VS +EKD+YV
Sbjct: 952  ITGDVLVNGRPTDASFQRSTGYCQQQDLHGRTQTVREALTFSAYLRQPYNVSKKEKDEYV 1011

Query: 1041 EEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTA 1100
            E +I +LEM+ YADA+VGV GEGLNVEQRKRLTIGVEL AKPKLL+FLDEPTSGLDSQTA
Sbjct: 1012 ETIIRLLEMETYADALVGVTGEGLNVEQRKRLTIGVELVAKPKLLLFLDEPTSGLDSQTA 1071

Query: 1101 WSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINY 1160
            WS CQLM+KLA+ GQAILCTIHQPSA+LMQEFDRLL LQ+GGQTVYFGELG GC  MI Y
Sbjct: 1072 WSVCQLMRKLANHGQAILCTIHQPSAILMQEFDRLLLLQKGGQTVYFGELGHGCCKMIEY 1131

Query: 1161 FEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKELDWMERELP 1220
            FE+ G+ K P D NPAE+ML ++GAAPG+H + DY  +W +S+EY+ +QKE+D M RE+ 
Sbjct: 1132 FESKGSQKFPADCNPAEFMLHVIGAAPGSHVTTDYHKVWLESQEYQAVQKEIDRMSREMV 1191

Query: 1221 KRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFK 1280
               +  S + +KEFAT   YQ  +++ R+  Q+WR+P Y+++K F+T  S LFIGF+FF 
Sbjct: 1192 NIPQEDSEDLKKEFATPLWYQFLIMTRRVLEQHWRSPIYIYAKIFTTSFSALFIGFSFFN 1251

Query: 1281 ANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSRTFSWKAFIVSQI 1340
            AN S+QGLQNQM ++FM  V+F+P++ Q LP +  QR+LYE RERPS+T SW  F++SQI
Sbjct: 1252 ANNSMQGLQNQMFSLFMLLVMFSPLVHQMLPQYTDQRDLYEVRERPSKTCSWITFVLSQI 1311

Query: 1341 LVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACAFYVYISSMGVLVI 1400
              E+PW+ L GTI +F +YYPVG YRNA    Q+HERGALFWL   AF  +  + G   I
Sbjct: 1312 AAELPWSFLIGTITYFCFYYPVGLYRNAPNTEQVHERGALFWLICIAFINFTMTFGQACI 1371

Query: 1401 SCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDALLSVGLAN 1460
            + +E  ENAA LA+  F++ L+FCGVL T + LP FW FMY +SP TYLI  +L+  + N
Sbjct: 1372 AGVERRENAALLANNCFMICLAFCGVLVTRDKLPGFWKFMYYLSPFTYLISTMLATAVGN 1431

Query: 1461 ASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECHFCQFSSTNDYLAT 1520
            + V CS+ E L   P   MTC +YM PYM   G GYLLDG++   C FC  + TN YLAT
Sbjct: 1432 SDVRCSAKEYLHFSPAPNMTCQQYMSPYMSVAG-GYLLDGNATDSCGFCVMAETNVYLAT 1490

Query: 1521 VSSSYSRRWMNYGIF 1535
            V+  YS+ W N+GIF
Sbjct: 1491 VNIKYSQIWRNWGIF 1505

>AGL142C [4170] [Homologous to ScYPL058C (PDR12) - NSH]
            (434247..438740) [4494 bp, 1497 aa]
          Length = 1497

 Score = 1473 bits (3813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 719/1439 (49%), Positives = 959/1439 (66%), Gaps = 59/1439 (4%)

Query: 99   PDYDETLDPRSENFSSVRWVRNMAQICENDSDFYKPFSLGCAWKDLSASGDSADITYQGT 158
            PD D  LDP S+ F    WVR +  +  +D D YKP  L    ++L   G SAD  YQ T
Sbjct: 74   PDKDARLDPESDEFDPRYWVRTIRNLYASDPDHYKPAELCVVIQNLRVCGVSADTDYQAT 133

Query: 159  FGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILKPMDGCINPGELLVVLGRPGAG 218
             GN P+K L+M ++      F R   KSE     F ILKP+D    PG L VVLGRPGAG
Sbjct: 134  VGNSPLKALRMLYQMTP---FARGREKSE-----FDILKPLDVVFEPGRLCVVLGRPGAG 185

Query: 219  CTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAESDIHIPHLTVFQTL 278
            C+TLLK++   T+GF ++P++ I+Y+GFS KEIKNH RGEV+Y+AESD H   L V  TL
Sbjct: 186  CSTLLKTVGARTYGFTVAPESEISYSGFSQKEIKNHLRGEVIYSAESDTHFASLPVGYTL 245

Query: 279  YTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGNDFVRGVSGGERKRVS 338
               AR + P+ R  GV R+ F KH     MA YGLSHT  TKVGND++RGVSGGERKRVS
Sbjct: 246  EFAARCRCPQVRPGGVKREVFYKHYAAAVMAMYGLSHTRYTKVGNDYIRGVSGGERKRVS 305

Query: 339  IAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATVAIYQCSKDAYDLFD 398
            +AEV++ G+K QCWDN TRGLDSATALEF++AL+  A + ++   +AIYQCS+ AY LFD
Sbjct: 306  LAEVTLAGAKLQCWDNCTRGLDSATALEFVRALRDNAEVMRTTQLIAIYQCSEAAYSLFD 365

Query: 399  KVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADYLTSITSPSERIKDKDMVKHGI 458
             V VLY+GY I+FGP K AK YF RMG+ CP RQT+AD+LTS+TSP ER   K    +  
Sbjct: 366  DVLVLYEGYMIYFGPRKLAKGYFLRMGWECPPRQTSADFLTSVTSPFER---KSQPGYED 422

Query: 459  MIPQTAYEMNQYWIQSEEYKQLQVQVNKHL-DTDSSQQREQIKNAHIAKQSKRARPSSPY 517
             +P+TA E  +YW++S E+     Q+ + + +  +   REQ+++ HI +Q++  + SSPY
Sbjct: 423  KVPRTAREFYEYWLRSPEHAVAMKQIQRRIAEAKTDAAREQLRDHHIVRQARHVKSSSPY 482

Query: 518  TVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYEVMLSTTTTTFYYRG 577
             +SF++Q + I+ R+  R++ DPS+ LF++++++ M LIL S F  + L   T + + RG
Sbjct: 483  LISFYMQFRAIVDRNWQRLRGDPSVYLFSIVAYSIMGLILASCF--LNLKPDTNSLFNRG 540

Query: 578  XXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFASTFSDVPTKLATAVT 637
                            EI SL+E R I +KHK+Y+ YRPSADAFAS F+++P K    + 
Sbjct: 541  SALFTAVLLNSFFSFLEIMSLFEARAIVKKHKSYAFYRPSADAFASIFTELPAKFTVCIC 600

Query: 638  FNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTLPQAMVPASVLLLAF 697
            FN+P+YF++NL+R  GAFFFY L+++   FAMSHLFR +G+  KTL   M PAS+LLL  
Sbjct: 601  FNVPFYFMVNLRRSTGAFFFYMLVSLTATFAMSHLFRSVGAACKTLYVTMFPASLLLLGL 660

Query: 698  AMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFHGRNFPCAQYIPSGPNYVNATG 757
            A+Y GF IP+  +LGWS+W+ Y+NP++ + E+++ NEF GR F C++ +P G  Y     
Sbjct: 661  AVYVGFVIPQKNILGWSRWLFYLNPIARIMEAMVANEFDGRIFECSRMVPDGSFYEGFPI 720

Query: 758  DEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSVGIGLAXXXXXXXXXXXXCEYNE 817
                C ++G++PG ++V+G  +I+  YGY  KNKW + GI LA             EYN+
Sbjct: 721  SNKVCLSVGAVPGQSFVNGTRYIEFAYGYNTKNKWMNWGIVLAYAFFFLGVYLILIEYNK 780

Query: 818  GAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQPTLSTSDAEKDVEMNNNSSATDSRFLR 877
               Q GEM VF  S                      +      D+E  N           
Sbjct: 781  SGMQKGEMAVFLRSTLKKIK--------------KQNKKAINCDIEFGNAPG-------- 818

Query: 878  DSDAAIMGNDKTVAKEHYXXXXXXXXXXXXXXXXDDIELSKSQAIFHWKNLCYDIPIKNG 937
              +++ +G+D++                      + I+   S +IFHW+++CYDI IKN 
Sbjct: 819  -KESSTIGSDQS---------------------RELIQRIGSDSIFHWRDVCYDIQIKNE 856

Query: 938  KRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFP 997
             RRIL NVDGWVKPGTLTAL+G SGAGKTTLLD LA R  +G++TG++FVDG  RD SF 
Sbjct: 857  TRRILTNVDGWVKPGTLTALMGYSGAGKTTLLDVLANRVRVGVVTGNIFVDGHLRDTSFQ 916

Query: 998  RSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIV 1057
            R  GYCQQQDLH +T TVR++L+FSAYLRQ   +S  EK+ YVE++I++L M+ YADA+V
Sbjct: 917  RKTGYCQQQDLHGRTQTVRDALKFSAYLRQPQSISRAEKNAYVEDIIKLLGMEAYADAVV 976

Query: 1058 GVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQAI 1117
            GV GEGLNVEQRKRLTIGVEL AKP+LL+FLDEPTSGLDSQTAWS CQL+KKL + GQAI
Sbjct: 977  GVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSICQLIKKLVNHGQAI 1036

Query: 1118 LCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGAHKCPPDANPAE 1177
            LCTIHQPSA+LMQEFDRLL L  GG+TVYFG LG+GC TMI YFE HG+ K P   NPAE
Sbjct: 1037 LCTIHQPSAILMQEFDRLLLLSNGGRTVYFGPLGEGCSTMIQYFENHGSQKFPEACNPAE 1096

Query: 1178 WMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKELDWMERELPKRTEGSSNEEQKEFATS 1237
            +MLEI+GAAPG+HA QDY  IW++S+EY+ +Q+EL  ME EL  +    ++++ KEFA+S
Sbjct: 1097 FMLEIIGAAPGSHALQDYHEIWKNSDEYQSVQEELHRMEMELWHKPRFETSDQNKEFASS 1156

Query: 1238 TLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFM 1297
              YQ  +VS R+  QYWR+P YLWSK F +I + LFIGF+FFK+ TS+QGLQNQM A+F+
Sbjct: 1157 IWYQYIIVSRRVLQQYWRSPEYLWSKIFMSIFASLFIGFSFFKSKTSIQGLQNQMFAVFL 1216

Query: 1298 FTVVFNPILQQYLPLFVQQRELYEARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFV 1357
            F VV  P++QQ LP +V+QR+L+E RER S+TFSWK F++SQI  EIPW +L  TI+FF 
Sbjct: 1217 FLVVLTPLVQQMLPQYVEQRDLFEVRERHSKTFSWKVFLLSQITAEIPWAILGATISFFC 1276

Query: 1358 YYYPVGFYRNASYANQLHERGALFWLFACAFYVYISSMGVLVISCIEIAENAANLASLFF 1417
            +YYPVGFY +A+ A    ERG LFW    AFY++ ++ G   I+ +E AE AA LA+ +F
Sbjct: 1277 FYYPVGFYTHATDAANRAERGFLFWSLCVAFYIFSATFGQFCIAGLEKAEPAAILANFYF 1336

Query: 1418 IMSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPS 1477
             M L F GVL T + LPRFWI+MY +SP+TYL+ ALLS G  N +V C+  EL+K  PP 
Sbjct: 1337 TMCLIFSGVLVTKDNLPRFWIWMYYLSPVTYLVSALLSTGSGNMTVECAPEELIKFAPPK 1396

Query: 1478 GMTCSEYMEPYMQSTGTGYLLDGSSETECHFCQFSSTNDYLATVSSSYSRRWMNYGIFS 1536
            G+ C+ Y+EP+  +     LL+ ++   C  C   +++ YLA V+  Y+ RW ++GIF+
Sbjct: 1397 GLFCALYLEPF-ANNAESVLLNPAATDLCTVCPIKNSDYYLALVNIFYNHRWRDWGIFT 1454

>ABR126W [718] [Homologous to ScYOR153W (PDR5) - NSH; ScYDR406W
            (PDR15) - NSH] complement(628623..633161) [4539 bp, 1512
            aa]
          Length = 1512

 Score = 1449 bits (3751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 727/1513 (48%), Positives = 960/1513 (63%), Gaps = 91/1513 (6%)

Query: 27   QPYEGL--DAAAQEEIKELARXXXXXXXXXXXEKRITGTGDPNTLTXXXXXXXXXXXXXX 84
            +PY GL  D   QE I+ LAR           + + TGT D                   
Sbjct: 42   RPYVGLAEDREEQEVIRSLARTLSGSSGAAGRDYQ-TGTADE------------------ 82

Query: 85   DIKGVNPILLDVNDPDYDETLDPRSENFSSVRWVRNMAQICENDSDFYKPFSLGCAWKDL 144
                     L     + D  LDP S  F S  +VR + ++  +D D YKP  L    ++L
Sbjct: 83   ---------LAFFGANSDPRLDPESGEFDSQFFVRTLRKLYMSDPDHYKPAELSVVLRNL 133

Query: 145  SASGDSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILKPMDGCIN 204
               G++AD  YQ T GN P K    + R +    F R H K+E     F ILKP+D    
Sbjct: 134  RVCGEAADTDYQATVGNWPWK----TARSLYDMTFRRGHTKAE-----FDILKPLDAVFE 184

Query: 205  PGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAE 264
             G L VVLGRPGAGC+TLLK++   T+GF ++P++ ++Y+GF+ KEI  + RGEV+Y+AE
Sbjct: 185  AGRLCVVLGRPGAGCSTLLKTVGARTYGFNVAPESEVSYSGFTQKEISKNLRGEVIYSAE 244

Query: 265  SDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGND 324
             D H   L V  TL   AR + P+ R  GV R+T+ KH     MATYGLSHT +TKVGND
Sbjct: 245  MDTHFASLPVGYTLEFAARCRCPQVRPGGVSRETYYKHYASAVMATYGLSHTRNTKVGND 304

Query: 325  FVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATV 384
            ++RGVSGGERKRVS+AEV++ G+K QCWDN+TRGLDSATALEF++AL+  A +  +   +
Sbjct: 305  YIRGVSGGERKRVSLAEVTLAGAKVQCWDNSTRGLDSATALEFVRALRDNAHVMHTTQLI 364

Query: 385  AIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADYLTSITSP 444
            AIYQCS+DAYDLFD V VLY+GY I+FGP + AK YF RMG+ CP +QT+ADYLTS+TSP
Sbjct: 365  AIYQCSQDAYDLFDDVLVLYEGYMIYFGPREFAKDYFLRMGWACPPQQTSADYLTSVTSP 424

Query: 445  SERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHL-DTDSSQQREQIKNAH 503
            +ER   +    +   +P+TA E    W+ S E   +Q ++N H+ D ++   R+Q+K  H
Sbjct: 425  AER---QPRPGYEDKVPRTAKEFYDRWMASPERAAVQERINMHMADYETGVARQQLKEHH 481

Query: 504  IAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYE 563
             ++Q+K  RPSSPY +SF++Q + ++ R++ R+  DP + LF +LS+  M LIL S F+ 
Sbjct: 482  KSRQAKHMRPSSPYLISFYMQFRAVVDRNLKRLGGDPWVYLFNILSNTIMGLILASCFFN 541

Query: 564  VMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFAS 623
                  T +F+YRG                EI SL+E R I EKHK+Y+ YRPSADAFAS
Sbjct: 542  Q--KEDTASFFYRGSALFTAVLFNSFSSMLEIMSLFEARAIVEKHKSYAFYRPSADAFAS 599

Query: 624  TFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTL 683
             F+++P+K+ T V+FNIP+YF++NL+R AGAFFFY LI++ + FAMSHLFR +G+ + +L
Sbjct: 600  IFTELPSKVITCVSFNIPFYFMVNLRRSAGAFFFYLLISMTSTFAMSHLFRTLGAATTSL 659

Query: 684  PQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFHGRNFPCA 743
               M+P S+LLLA + Y GF IP+  ++GWSKWI Y+NP++   E+++ NEF GR F C+
Sbjct: 660  YVTMLPVSILLLAISTYVGFVIPQKNIVGWSKWIFYLNPIARSMEAMVANEFDGRTFECS 719

Query: 744  QYIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSVGIGLAXXX 803
            Q +PSGP Y N       C A+GS+PG   VSG  +++ +Y Y  K+KWR+  I LA   
Sbjct: 720  QMMPSGPAYENVPLANKVCVAVGSLPGETTVSGTRYMELSYDYLAKHKWRNWAIVLAYAI 779

Query: 804  XXXXXXXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQPTLSTSDAEKDVE 863
                      EYN+G  Q GEM VF  S                  Q      D E    
Sbjct: 780  FFLGLYLLLIEYNKGEMQKGEMAVFLRSTLKKIR-----------KQNKAVKGDVESGNA 828

Query: 864  MNNNSSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXXXXXXXXDDIELSKSQAIF 923
                SS  DS   R+    I G+DK                                 IF
Sbjct: 829  QGKESSTIDSDQSRELIKKI-GSDK---------------------------------IF 854

Query: 924  HWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITG 983
            HW+N+CYD+ IK   RRIL NVDGWVKPGTLTAL+G+SGAGKTTLLD LA R  +G++TG
Sbjct: 855  HWRNVCYDVQIKKETRRILTNVDGWVKPGTLTALMGSSGAGKTTLLDVLANRVRVGVVTG 914

Query: 984  DVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEV 1043
            D+FVDG PR  SF R+ GYCQQQDLH  T TVR++L+FSAYLRQ   VS  E D YVE++
Sbjct: 915  DMFVDGLPRGASFQRNTGYCQQQDLHGCTQTVRDALKFSAYLRQPQSVSEAEIDAYVEDI 974

Query: 1044 IEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWST 1103
            I +LEM+ YADAIVGV GEGLNVEQRKRLTIGVEL AKP+LL+FLDEPTSGLDSQTAWS 
Sbjct: 975  IRLLEMEAYADAIVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSV 1034

Query: 1104 CQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEA 1163
            CQLM+KLA+ GQA+LCTIHQPSA+LMQEFDRLL L  GG+TVYFG LGKGC TM+ YFE 
Sbjct: 1035 CQLMRKLANHGQAVLCTIHQPSAILMQEFDRLLLLASGGRTVYFGGLGKGCATMVEYFEK 1094

Query: 1164 HGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKELDWMERELPKRT 1223
            HG+ K P   NPAE+MLEI+GAAPG+HA QDY  +W++SEEYR +Q+EL  ME EL K+ 
Sbjct: 1095 HGSQKFPEGCNPAEFMLEIIGAAPGSHALQDYHEVWKNSEEYRSVQEELLRMETELSKKP 1154

Query: 1224 EGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFKANT 1283
               S E+ +EFA S  YQ K+VS R+F QYWR+P YLWSK F    S LFIGF+FFK+ +
Sbjct: 1155 RTESPEQNREFAASLWYQYKVVSKRVFQQYWRSPGYLWSKIFMGTFSALFIGFSFFKSKS 1214

Query: 1284 SLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQREL-YEARERPSRTFSWKAFIVSQILV 1342
            S+QG+QNQM A F+F ++ NP++QQ LP + +Q++  YE RE P      +   +  +  
Sbjct: 1215 SMQGMQNQMFATFLFLLIINPLIQQMLPQYEEQKKTWYEVREEPFEAIFLEGVHLISVNC 1274

Query: 1343 EIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACAFYVYISSMGVLVISC 1402
             +PW +  GT+AFF  YYPVGFY NA   +   ERG LFWL A  +Y++ ++ G   I+ 
Sbjct: 1275 RLPWAIFVGTLAFFSVYYPVGFYNNAVDTSDRSERGFLFWLLAVCYYIFSATFGYFCIAL 1334

Query: 1403 IEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDALLSVGLANAS 1462
            +   E+AA  A+  F++   FCGVL   + LPRFWI+ YR+SPLTYL+ +++S G+A A 
Sbjct: 1335 LGSRESAAMFANFVFMIWTVFCGVLVNGDNLPRFWIWAYRISPLTYLVSSIMSTGMAKAK 1394

Query: 1463 VVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECHFCQFSSTNDYLATVS 1522
            + C+  EL+K +PP+G TC +Y+ P+        LL+ ++   C  C   S++ +LA + 
Sbjct: 1395 IQCAPEELVKFIPPAGQTCEQYLRPFQSYAQGTALLNPTATDLCTMCPMQSSDTFLAGLG 1454

Query: 1523 SSYSRRWMNYGIF 1535
              Y  RW ++GIF
Sbjct: 1455 IYYKNRWRDWGIF 1467

>Kwal_27.12817
          Length = 919

 Score = 1089 bits (2816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/987 (53%), Positives = 672/987 (68%), Gaps = 74/987 (7%)

Query: 24   NETQPYEGLDAAAQEEIKELARXXXXXXXXXXXEKRITGTGDPNTLTXXXXXXXXXXXXX 83
            +E Q YEG D   Q +++ELAR             + T TG                   
Sbjct: 7    DEQQAYEGFDEPTQRQVRELARTLTNA-------SKATSTG----------------VSE 43

Query: 84   XDIKGVNPILLDVNDPDYDETLDPRSENFSSVRWVRNMAQICENDSDFYKPFSLGCAWKD 143
                 +NP+   +    Y+  LDP SE+FSS  W+RN++++ END D YKP+SL C+W +
Sbjct: 44   ASGPALNPVFSSIEGDGYNAKLDPNSESFSSYAWMRNLSKLVENDPDHYKPYSLSCSWSN 103

Query: 144  LSASGDSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILKPMDGCI 203
            L A G+S D+TYQ T  N+P+K  +M++RC  +        + ED    F ILKPMDG I
Sbjct: 104  LRAYGNSTDVTYQSTVANLPMKVAEMAYRCARK-------ARPEDT---FDILKPMDGLI 153

Query: 204  NPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNA 263
             PGELLVVLGRPG+GC+TLLKSIS NTHGF I   ++I+Y+G + KEI  H+RGEVVYNA
Sbjct: 154  EPGELLVVLGRPGSGCSTLLKSISSNTHGFHIDKGSVISYDGLTPKEINAHFRGEVVYNA 213

Query: 264  ESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGN 323
            E+D+H PHLTVF+TL T A L TP NR+ GVDR+ FAKH+TE  MATYGL HT +TKVGN
Sbjct: 214  EADVHFPHLTVFETLNTAALLSTPTNRVPGVDREAFAKHVTEACMATYGLLHTRNTKVGN 273

Query: 324  DFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAAT 383
            + VRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEF+KAL+T A +T S A 
Sbjct: 274  ELVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFVKALRTSAQMTSSCAA 333

Query: 384  VAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADYLTSITS 443
            +AIYQCS+DAYDLFDKVCVLY+GYQIF+GP+ + KKYF+ MGY+CP RQTTAD+LT++T+
Sbjct: 334  IAIYQCSQDAYDLFDKVCVLYEGYQIFYGPATEGKKYFEDMGYICPSRQTTADFLTAVTN 393

Query: 444  PSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHLDTDSSQQREQIKNAH 503
            P+ERI +KD+      +P TA EM +YW  SE Y++L  +++ + + D  ++R Q++ AH
Sbjct: 394  PAERIVNKDISN----VPSTAVEMERYWKNSENYRRLLAEIDAYTNQDQDEKRRQLREAH 449

Query: 504  IAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYE 563
             AKQSKRAR SSPYTVS+ +QVKY+L R+  RI+N   + +F V+ +  MA ILGSMFY+
Sbjct: 450  TAKQSKRARNSSPYTVSYGMQVKYLLRRNFMRIRNSMGLAIFQVVGNGGMAFILGSMFYK 509

Query: 564  VMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFAS 623
            +M   TT   Y R                 EI SLYE RPI+EKHK YSLY PSADA AS
Sbjct: 510  IMKKDTTDGLYSRAGALFFAVLFNAFSCMLEILSLYEARPISEKHKRYSLYNPSADALAS 569

Query: 624  TFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTL 683
              S++P K+ T++ FNI  YFL N KR+AGAFFFY ++N++  F MSH+FRC+GS +KT 
Sbjct: 570  IISEIPAKIITSIVFNIALYFLCNFKREAGAFFFYLMMNLLATFVMSHIFRCLGSATKTY 629

Query: 684  PQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFHGRNFPCA 743
             ++MVP+SV+LLA ++YTGFAIP+ ++LGW+KWI YINPLSY+FESLM+NEFH R F C+
Sbjct: 630  AESMVPSSVILLAMSIYTGFAIPKTKILGWAKWIWYINPLSYIFESLMVNEFHDRRFECS 689

Query: 744  QYIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSVGIGLAXXX 803
            +++P G  Y   TG +  CSA+G+  G+N+V G+ +I  +YGY H +KWR  GIG+    
Sbjct: 690  RFVPIGSAYDTVTGAQRVCSAVGAEAGSNFVDGERYINLSYGYYHAHKWRGFGIGMGFAI 749

Query: 804  XXXXXXXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQPTLSTSDAEKDVE 863
                      E NE AKQ+GE+LVF HS                 NQ   S +D E  V 
Sbjct: 750  FFLGVYLALTELNESAKQSGEVLVFNHS-----------TMKKLKNQKK-SLADIENTVG 797

Query: 864  MNNNSSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXXXXXXXXDDIELSKSQAIF 923
            +N   SA + + L DS + +  +D T+                      + +LSKS+AIF
Sbjct: 798  VN---SANEKKLLEDS-SEVGSSDSTLG---------------------NAQLSKSEAIF 832

Query: 924  HWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITG 983
            HW+N+CYD+PIK   RRILD+VDGWVKPGTLTAL+GASGAGKTTLLDCLA R T G ITG
Sbjct: 833  HWRNVCYDVPIKGDTRRILDHVDGWVKPGTLTALMGASGAGKTTLLDCLASRVTTGTITG 892

Query: 984  DVFVDGRPRDQSFPRSIGYCQQQDLHL 1010
            D+F++G  RD SF RSIGYCQQQDLHL
Sbjct: 893  DMFINGYLRDASFARSIGYCQQQDLHL 919

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 140/579 (24%), Positives = 250/579 (43%), Gaps = 87/579 (15%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERT-TMGLITGDVF-VDG---RPRDQS 995
            IL  +DG ++PG L  ++G  G+G +TLL  ++  T    +  G V   DG   +  +  
Sbjct: 145  ILKPMDGLIEPGELLVVLGRPGSGCSTLLKSISSNTHGFHIDKGSVISYDGLTPKEINAH 204

Query: 996  FPRSIGYCQQQDLHLKTATVRESLRFSAYL----RQADDVSIEEKDKYVEE-------VI 1044
            F   + Y  + D+H    TV E+L  +A L     +   V  E   K+V E       ++
Sbjct: 205  FRGEVVYNAEADVHFPHLTVFETLNTAALLSTPTNRVPGVDREAFAKHVTEACMATYGLL 264

Query: 1045 EVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTC 1104
                 K+  + + GV G      +RKR++I  E++         D  T GLDS TA    
Sbjct: 265  HTRNTKVGNELVRGVSGG-----ERKRVSIA-EVSICGSKFQCWDNATRGLDSATALEFV 318

Query: 1105 QLMK---KLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYF 1161
            + ++   ++ S   AI   I+Q S      FD++  L EG Q +++G   +G K    YF
Sbjct: 319  KALRTSAQMTSSCAAI--AIYQCSQDAYDLFDKVCVLYEGYQ-IFYGPATEGKK----YF 371

Query: 1162 EAHGAHKCPPD----------ANPAEWML-EIVGAAPGTHASQDYFAIWRDSEEYREMQK 1210
            E  G + CP             NPAE ++ + +   P T    + +  W++SE YR +  
Sbjct: 372  EDMG-YICPSRQTTADFLTAVTNPAERIVNKDISNVPSTAVEMERY--WKNSENYRRLLA 428

Query: 1211 ELDW---MERELPKRT--EGSSNEEQKEFATSTLYQIKL---VSYRLFHQYWRTPFYLWS 1262
            E+D     +++  +R   E  + ++ K    S+ Y +     V Y L   + R    +  
Sbjct: 429  EIDAYTNQDQDEKRRQLREAHTAKQSKRARNSSPYTVSYGMQVKYLLRRNFMRIRNSMGL 488

Query: 1263 KFFSTIVS---ELFIGFTFFK--ANTSLQGLQNQMLAIFMFTVVFNPI--LQQYLPLFVQ 1315
              F  + +      +G  F+K     +  GL ++  A+F F V+FN    + + L L+ +
Sbjct: 489  AIFQVVGNGGMAFILGSMFYKIMKKDTTDGLYSRAGALF-FAVLFNAFSCMLEILSLY-E 546

Query: 1316 QRELYEARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLH 1375
             R + E  +R S  ++  A  ++ I+ EIP  ++   +     Y+   F R         
Sbjct: 547  ARPISEKHKRYS-LYNPSADALASIISEIPAKIITSIVFNIALYFLCNFKR--------- 596

Query: 1376 ERGALFWLFACAFYVYISSMGVLVIS----CIEIAENA---ANLASLFFIMSLSFCGVLA 1428
            E GA F      FY+ ++ +   V+S    C+  A      + + S   ++++S     A
Sbjct: 597  EAGAFF------FYLMMNLLATFVMSHIFRCLGSATKTYAESMVPSSVILLAMSIYTGFA 650

Query: 1429 TPNILPRFWI-FMYRVSPLTYLIDALLSVGLANASVVCS 1466
             P      W  +++ ++PL+Y+ ++L+     +    CS
Sbjct: 651  IPKTKILGWAKWIWYINPLSYIFESLMVNEFHDRRFECS 689

>ABR125C [717] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W -
            NSH] (623887..628353) [4467 bp, 1488 aa]
          Length = 1488

 Score = 1000 bits (2585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/1345 (39%), Positives = 780/1345 (57%), Gaps = 69/1345 (5%)

Query: 195  ILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNH 254
            IL+ +     PGE+++VLGRPGAGCT+LLK+++  T  F  S +  I+Y+G   +E+   
Sbjct: 177  ILESVTLLARPGEMVLVLGRPGAGCTSLLKTVAGETDQFH-SVEGAISYDGIPQREMMRR 235

Query: 255  YRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLS 314
            YR EVVYN+E D+H PHLTV QTL      KTP  R+  V R  +   M E+    +GL 
Sbjct: 236  YRAEVVYNSEIDVHFPHLTVKQTLDFALACKTPHMRVNNVSRAEYITLMRELYATVFGLR 295

Query: 315  HTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQ 374
            HT DTKVGND++RGVSGGERKRVSIAE     +   CWDNATRGLD++TALE+ +A++  
Sbjct: 296  HTYDTKVGNDYIRGVSGGERKRVSIAEALAANASVYCWDNATRGLDASTALEYAQAMRIM 355

Query: 375  ATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTT 434
              + +S + V +YQ S++ Y+ FDKV VL++G QI+FG    AK YF+ MGY CP RQ+T
Sbjct: 356  TNLLQSTSLVTLYQASENIYETFDKVLVLFEGRQIYFGDVMSAKAYFEEMGYTCPPRQST 415

Query: 435  ADYLTSITSPSERIKDKDMVK--HGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHL-DTD 491
             ++LT++T  +       +VK  H   +P+   E  QYW+ S+EY+ L  ++  +  + D
Sbjct: 416  TEFLTALTDTN----GYHVVKPGHEATVPRLPEEFEQYWLNSKEYRSLLSEIEDYRREVD 471

Query: 492  SSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHA 551
            + + R+Q++   +  +SK     SP+ +SFF QVK   IR   RI  D S  +  V+S  
Sbjct: 472  AHETRDQLEKFKLKGKSKYTHKRSPFMISFFEQVKLCTIRGFQRIYGDKSFTVINVVSAV 531

Query: 552  AMALILGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTY 611
              ALI GS+++     + T+  + RG                 I   +  RPI +KHK Y
Sbjct: 532  VQALITGSLYFSS--PSNTSGAFSRGEFYIMPILYFSLMGLANIN--FSNRPILQKHKMY 587

Query: 612  SLYRPSADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSH 671
            +LY PSA+A AST S    ++     F I  YFL  L  +A  FF  +L  ++    ++ 
Sbjct: 588  TLYHPSAEALASTISACVFRMIALTLFLIVLYFLSGLTVEAWRFFSIYLFLVLASEGINA 647

Query: 672  LFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLM 731
            +F  I ++S +L QA   A +++   ++Y+ + I +  M  W  WISYI P+ Y FES++
Sbjct: 648  MFEVITALSTSLSQANAVAGLVMFGISIYSTYMIQKPSMHPWFAWISYILPIRYAFESML 707

Query: 732  INEFHGRNFPCAQ-YIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKN 790
              EFHGR+  CA  Y+P+GP Y   T +   C+ +GS P  ++V GDD++  NY Y ++N
Sbjct: 708  NAEFHGRHMDCADTYVPTGPGYEGVTPENRVCAFIGSKPSQSWVLGDDYLSVNYEYEYEN 767

Query: 791  KWRSVGIGLAXXXXXXXXXXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQ 850
            +WR++GI +A             EY    K  G+ LVF                     +
Sbjct: 768  QWRNLGILIAFWIGFLTLKCLATEYKRPMKGGGDSLVF--------------------KK 807

Query: 851  PTLSTSDAEKDVEMNNNSSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXXXXXXX 910
             TL+    + D E  N S A +S+ +    A+ +G D                       
Sbjct: 808  GTLAKRKVQDDSESRNVSGAAESKMV----ASTVGTD----------------------- 840

Query: 911  XDDIELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLD 970
             D  +  K+  +F W+++ + I     K+++LD + G+  PGTLTAL+G SGAGKTTLL+
Sbjct: 841  -DVFDGLKNDDVFIWRDISFSITHNGDKKKLLDQITGYCIPGTLTALMGESGAGKTTLLN 899

Query: 971  CLAERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADD 1030
             LA+R  +G+ITGD+ V+G P D SF R  GY QQQD+H+K  TVRESL+FSA LR+ + 
Sbjct: 900  TLAQRN-VGVITGDMLVNGLPIDASFERRTGYVQQQDVHVKEMTVRESLQFSARLRRPES 958

Query: 1031 VSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDE 1090
            VS  EK  YVE++IE+L M  +ADA+VG  G GLNVEQRK+L+IGVEL AKP LL+FLDE
Sbjct: 959  VSEAEKMNYVEKIIEILGMSDFADALVGDAGYGLNVEQRKKLSIGVELVAKPSLLLFLDE 1018

Query: 1091 PTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGEL 1150
            PTSGLDSQ++W+  QL+K+LA  GQAILCTIHQPSA L ++FDRLL LQ+GGQTVYFG++
Sbjct: 1019 PTSGLDSQSSWAIVQLLKRLAQSGQAILCTIHQPSATLFEQFDRLLLLQKGGQTVYFGDI 1078

Query: 1151 GKGCKTMINYFEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQK 1210
            G+  +T+++YF+ +GA  C P  NPAE++LE +GA      ++D+  +WR+S E     +
Sbjct: 1079 GEESRTLLDYFQRNGARPCTPSENPAEYILESIGAGATATTTEDWAELWRNSPECARENE 1138

Query: 1211 ELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVS 1270
             ++ +  EL ++   ++     ++ATS  YQ + V  R    ++R   YL SK F  + +
Sbjct: 1139 IVNKLVNELSEKYLSNAPAPISKYATSYFYQFRYVVSRTMLIFYRDLDYLLSKQFLFLSA 1198

Query: 1271 ELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSRTF 1330
             LFIGFTF+   TS  GL+N M A+FM  +   P + Q     ++ ++LY  RE  S  F
Sbjct: 1199 GLFIGFTFYDVGTSYTGLRNTMFAVFMSIITSAPAMNQIQARAIKMKDLYIVRESKSNLF 1258

Query: 1331 SWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACAFYV 1390
             W   +++Q L E+P+  L  TI F   ++P+    +A       E G  F  F   F  
Sbjct: 1259 HWSLLLITQYLAELPYQFLFSTIYFLCMFFPMKLGLSA------RENGIFFLNFCIVFQA 1312

Query: 1391 YISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLI 1450
            Y   +G+ V+      E+A  +  +F    +SFCGV+    ++P FW FMYR+SP TY  
Sbjct: 1313 YFVGLGLAVLYLAPNLESANVILGVFLSFLISFCGVVQPYYLMPGFWKFMYRLSPYTYFT 1372

Query: 1451 DALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECHFCQ 1510
               L + L +  V C+S E   + PP+G+TC EYM+P++ S  +GY+ +  + + C +C 
Sbjct: 1373 QNFLGIMLHDRPVRCNSREFSFLDPPNGVTCGEYMQPFVNSV-SGYVDNPDATSNCAYCI 1431

Query: 1511 FSSTNDYLATVSSSYSRRWMNYGIF 1535
            +   ++YLA++ + YS  W N+GI 
Sbjct: 1432 YRVGDEYLASIGAKYSYLWRNFGIL 1456

 Score =  113 bits (282), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 156/665 (23%), Positives = 281/665 (42%), Gaps = 132/665 (19%)

Query: 939  RRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLA-ERTTMGLITGDVFVDGRPRDQSFP 997
            R IL++V    +PG +  ++G  GAG T+LL  +A E      + G +  DG P+ +   
Sbjct: 175  RNILESVTLLARPGEMVLVLGRPGAGCTSLLKTVAGETDQFHSVEGAISYDGIPQREMMR 234

Query: 998  R---SIGYCQQQDLHLKTATVRESLRFSAYLR----QADDVSIEEKDKYVEEVIEVL--- 1047
            R    + Y  + D+H    TV+++L F+   +    + ++VS  E    + E+   +   
Sbjct: 235  RYRAEVVYNSEIDVHFPHLTVKQTLDFALACKTPHMRVNNVSRAEYITLMRELYATVFGL 294

Query: 1048 ----EMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWST 1103
                + K+  D I GV G      +RKR++I   LAA   +  + D  T GLD+ TA   
Sbjct: 295  RHTYDTKVGNDYIRGVSG-----GERKRVSIAEALAANASVYCW-DNATRGLDASTALEY 348

Query: 1104 CQLMKKLASRGQAI-LCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFE 1162
             Q M+ + +  Q+  L T++Q S  + + FD++L L EG Q +YFG++     +   YFE
Sbjct: 349  AQAMRIMTNLLQSTSLVTLYQASENIYETFDKVLVLFEGRQ-IYFGDV----MSAKAYFE 403

Query: 1163 AHGAHKCPPDANPAEWMLEIVG------AAPGTHAS-----QDYFAIWRDSEEYREMQKE 1211
              G + CPP  +  E++  +          PG  A+     +++   W +S+EYR +  E
Sbjct: 404  EMG-YTCPPRQSTTEFLTALTDTNGYHVVKPGHEATVPRLPEEFEQYWLNSKEYRSLLSE 462

Query: 1212 LDWMERELPK----------RTEGSSNEEQKE--FATSTLYQIKLVSYRLFHQYWRTPFY 1259
            ++   RE+            + +G S    K   F  S   Q+KL + R F + +    +
Sbjct: 463  IEDYRREVDAHETRDQLEKFKLKGKSKYTHKRSPFMISFFEQVKLCTIRGFQRIYGDKSF 522

Query: 1260 LWSKFFSTIVSELFIGFTFFKANTSLQGLQNQ----MLAIFMFTVVF--------NPILQ 1307
                  S +V  L  G  +F + ++  G  ++    ++ I  F+++          PILQ
Sbjct: 523  TVINVVSAVVQALITGSLYFSSPSNTSGAFSRGEFYIMPILYFSLMGLANINFSNRPILQ 582

Query: 1308 QYLPLFVQQRELYEARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRN 1367
            ++     +   LY     PS      A  ++  +    + ++A T+   V Y+  G    
Sbjct: 583  KH-----KMYTLYH----PS------AEALASTISACVFRMIALTLFLIVLYFLSGLTVE 627

Query: 1368 ASYANQLHERGALFW-LFACAFYVYISSMGV----LVISCIEIAENAANLAS--LFFIMS 1420
            A             W  F+   ++ ++S G+     VI+ +  + + AN  +  + F +S
Sbjct: 628  A-------------WRFFSIYLFLVLASEGINAMFEVITALSTSLSQANAVAGLVMFGIS 674

Query: 1421 LSFCGVLATPNILPRFWIFMYRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMT 1480
            +    ++  P++ P F    Y + P+ Y  +++L+                       M 
Sbjct: 675  IYSTYMIQKPSMHPWFAWISY-ILPIRYAFESMLNAEFHGRH----------------MD 717

Query: 1481 CSEYMEPYMQSTGTGYLLDGSSETECHFCQFSST---------NDYLAT-VSSSYSRRWM 1530
            C++   P    TG GY  +G +  E   C F  +         +DYL+      Y  +W 
Sbjct: 718  CADTYVP----TGPGY--EGVTP-ENRVCAFIGSKPSQSWVLGDDYLSVNYEYEYENQWR 770

Query: 1531 NYGIF 1535
            N GI 
Sbjct: 771  NLGIL 775

 Score =  107 bits (268), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 157/662 (23%), Positives = 263/662 (39%), Gaps = 95/662 (14%)

Query: 171  WRCISRRLFHRTHGKSEDNDSGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNT 230
            WR IS   F  TH     N    ++L  + G   PG L  ++G  GAG TTLL +++   
Sbjct: 854  WRDIS---FSITH-----NGDKKKLLDQITGYCIPGTLTALMGESGAGKTTLLNTLAQRN 905

Query: 231  HGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNR 290
             G  I+ D ++  NG     I   +     Y  + D+H+  +TV ++L   ARL+ P + 
Sbjct: 906  VGV-ITGDMLV--NGLP---IDASFERRTGYVQQQDVHVKEMTVRESLQFSARLRRPES- 958

Query: 291  IKGVDRDTFAKHMTEVAMATYGLSHTADTKVGNDFVRGVSGGERKRVSIA-EVSICGSKF 349
            +   ++  + + + E+     G+S  AD  VG D   G++  +RK++SI  E+    S  
Sbjct: 959  VSEAEKMNYVEKIIEI----LGMSDFADALVG-DAGYGLNVEQRKKLSIGVELVAKPSLL 1013

Query: 350  QCWDNATRGLDSATALEFIKALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQ- 408
               D  T GLDS ++   ++ LK  A  +  A    I+Q S   ++ FD++ +L  G Q 
Sbjct: 1014 LFLDEPTSGLDSQSSWAIVQLLKRLAQ-SGQAILCTIHQPSATLFEQFDRLLLLQKGGQT 1072

Query: 409  IFFG----PSKQAKKYFQRMG-YVCPERQTTADY-LTSITSPSERIKDKDMVKHGIMIPQ 462
            ++FG     S+    YFQR G   C   +  A+Y L SI + +     +D          
Sbjct: 1073 VYFGDIGEESRTLLDYFQRNGARPCTPSENPAEYILESIGAGATATTTEDWA-------- 1124

Query: 463  TAYEMNQYWIQSEEYKQLQVQVNKHLDTDSSQQREQIKNAHIAKQSKRARPSSPYTVSFF 522
                  + W  S E  +    VNK ++  S +    + NA          P S Y  S+F
Sbjct: 1125 ------ELWRNSPECARENEIVNKLVNELSEK---YLSNA--------PAPISKYATSYF 1167

Query: 523  LQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYEVMLSTTTTTFYYRGXXXXX 582
             Q +Y++ R +     D    L       +  L +G  FY+V  S       Y G     
Sbjct: 1168 YQFRYVVSRTMLIFYRDLDYLLSKQFLFLSAGLFIGFTFYDVGTS-------YTGLRNTM 1220

Query: 583  XXXXXXXXXXXEIFSLYETRPITEK------HKTYSLYRPSADAFASTFSDVPTKLATAV 636
                          +  + R I  K          +L+  S        +++P +   + 
Sbjct: 1221 FAVFMSIITSAPAMNQIQARAIKMKDLYIVRESKSNLFHWSLLLITQYLAELPYQFLFST 1280

Query: 637  TFNIPYYFLINL---KRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTLPQAMVPASVL 693
             + +  +F + L    R+ G FF  F I     F    L   +  ++  L  A V   V 
Sbjct: 1281 IYFLCMFFPMKLGLSARENGIFFLNFCIVFQAYFVGLGL--AVLYLAPNLESANVILGVF 1338

Query: 694  LLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFHGR--------------- 738
            L     + G   P   M G+ K++  ++P +Y  ++ +    H R               
Sbjct: 1339 LSFLISFCGVVQPYYLMPGFWKFMYRLSPYTYFTQNFLGIMLHDRPVRCNSREFSFLDPP 1398

Query: 739  -NFPCAQYIPSGPNYVNATGD--EVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSV 795
                C +Y+    N V+   D  + T +    I    Y  GD+++  + G ++   WR+ 
Sbjct: 1399 NGVTCGEYMQPFVNSVSGYVDNPDATSNCAYCI----YRVGDEYL-ASIGAKYSYLWRNF 1453

Query: 796  GI 797
            GI
Sbjct: 1454 GI 1455

>YNR070W (YNR070W) [4653] chr14 (765372..769373) Probable multidrug
            resistance protein of the ATP-binding cassette (ABC)
            family, has similarity to Snq2p, Pdr5p and Candida
            albicans Cdr1p [4002 bp, 1333 aa]
          Length = 1333

 Score =  999 bits (2584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/1343 (40%), Positives = 774/1343 (57%), Gaps = 60/1343 (4%)

Query: 195  ILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDT-IITYNGFSNKEIKN 253
            ILK +      GE+++VLGRPGAGCT+ LKS +  T  F     T  I+Y+G   KE+  
Sbjct: 45   ILKNVSLLAKSGEMVLVLGRPGAGCTSFLKSAAGETSQFAGGVTTGHISYDGIPQKEMMQ 104

Query: 254  HYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGL 313
            HY+ +V+YN E D+H PHLTV QTL      K P  R+  V ++ +     E     +GL
Sbjct: 105  HYKPDVIYNGEQDVHFPHLTVKQTLDFAISCKMPAKRVNNVTKEEYITANREFYAKIFGL 164

Query: 314  SHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKT 373
            +HT DTKVGNDF+ GVSGGERKRVSIAE         CWDNATRGLDS+TALEF +A++T
Sbjct: 165  THTFDTKVGNDFISGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDSSTALEFARAIRT 224

Query: 374  QATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQT 433
               +  + A V +YQ S++ Y+ FDKV VLY G QIF G + +AK YF+ MGY+CP RQ+
Sbjct: 225  MTNLLGTTALVTVYQASENIYETFDKVTVLYAGRQIFCGKTTEAKDYFENMGYLCPPRQS 284

Query: 434  TADYLTSITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHLDTDSS 493
            TA+YLT+IT P+   + K   ++   +P TA E  +YW+ S EY +L+ ++ K+    ++
Sbjct: 285  TAEYLTAITDPNGLHEIKPGFEY--QVPHTADEFEKYWLDSPEYARLKGEIQKYKHEVNT 342

Query: 494  QQREQIKNAHIAKQ-SKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAA 552
            +  ++  N  +A++ SK  R  S YTVS++ Q++   IR   RI  D S  +    +  A
Sbjct: 343  EWTKKTYNESMAQEKSKGTRKKSYYTVSYWEQIRLCTIRGFLRIYGDKSYTVINTCAAIA 402

Query: 553  MALILGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYS 612
             A I GS+FY+   S+T   F   G                  F   E RPI +KHK YS
Sbjct: 403  QAFITGSLFYQAP-SSTLGAFSRSGVLFFSLLYYSLMGLANISF---EHRPILQKHKVYS 458

Query: 613  LYRPSADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHL 672
            LY PSA+A AST S  P ++     F I  YFL  L R AGAFF  +L+  +   A++ L
Sbjct: 459  LYHPSAEALASTISSFPFRMIGLTFFIIILYFLAGLHRSAGAFFTMYLLLTMCSEAITSL 518

Query: 673  FRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMI 732
            F+ + S+  TL QA   A V++L+ AMY+ + I    M  W KWISYI P+ Y FES++ 
Sbjct: 519  FQMVSSLCDTLSQANSIAGVVMLSIAMYSTYMIQLPSMHPWFKWISYILPIRYAFESMLN 578

Query: 733  NEFHGRNFPCA-QYIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNK 791
             EFHGR+  C    +PSGP + N   +   C+ +GS PG ++V GDD+++  Y Y +KN 
Sbjct: 579  AEFHGRHMDCGGTLVPSGPGFENILPENQVCAFVGSRPGQSWVLGDDYLRAQYQYEYKNT 638

Query: 792  WRSVGIGLAXXXXXXXXXXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQP 851
            WR+ GI                EY    K  G+ LV                      + 
Sbjct: 639  WRNFGIMWCFLIGYIVLRAVFTEYKSPVKSGGDALVVKKG-----------------TKN 681

Query: 852  TLSTSDAEKDVEMNNNSSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXXXXXXXX 911
             +  S + K+ E N N+S       +D       ND + +                    
Sbjct: 682  AIQRSWSSKNDEENLNASIAT----QDMKEIASSNDDSTSA------------------- 718

Query: 912  DDIELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDC 971
             D E  +S  +F WKN+ + IP  +G+R++LD+V G+  PGTLTALIG SGAGKTTLL+ 
Sbjct: 719  -DFEGLESTGVFIWKNVSFTIPHSSGQRKLLDSVSGYCVPGTLTALIGESGAGKTTLLNT 777

Query: 972  LAERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDV 1031
            LA+R  +G ITGD+ VDG P D SF R  GY QQQDLH+   TV+ESL+FSA +R+   +
Sbjct: 778  LAQRN-VGTITGDMLVDGLPMDASFKRRTGYVQQQDLHVAELTVKESLQFSARMRRPQSI 836

Query: 1032 SIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEP 1091
               EK +YVE++I +LEM+ +++A+VG  G GLNVEQRK+L+IGVEL  KP LL+FLDEP
Sbjct: 837  PDAEKMEYVEKIISILEMQEFSEALVGEIGYGLNVEQRKKLSIGVELVGKPDLLLFLDEP 896

Query: 1092 TSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELG 1151
            TSGLDSQ+AW+  +++K+LA  GQ+ILCTIHQPSA L ++FDRLL L +GGQT+YFGE+G
Sbjct: 897  TSGLDSQSAWAVVKMLKRLALAGQSILCTIHQPSATLFEQFDRLLLLGKGGQTIYFGEIG 956

Query: 1152 KGCKTMINYFEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKE 1211
            K   ++I YFE +GA KC  + NPAE++LE +GA       Q++  IW+ S EY  + ++
Sbjct: 957  KNSSSVIKYFEKNGARKCQQNENPAEYILEAIGAGATASVQQNWPDIWQKSHEYANINEK 1016

Query: 1212 LDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSE 1271
            ++ M ++L   T   +     ++ATS  YQ   V  R    +WR   Y+ +K    ++S 
Sbjct: 1017 INDMIKDLSSTTLHKTATRASKYATSYSYQFHHVLKRSSLTFWRNLNYIMAKMMLLMISG 1076

Query: 1272 LFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSRTFS 1331
            LFIGFTFF    +  GLQN + A FM  V+  P   Q        +ELYE RE  S  F 
Sbjct: 1077 LFIGFTFFHVGVNAIGLQNSLFACFMAIVISAPATNQIQERATVAKELYEVRESKSNMFH 1136

Query: 1332 WKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWL-FACAFYV 1390
            W   +++  L E+P++LL  TI F   Y+P+G +  AS       R ++F+L +A  F +
Sbjct: 1137 WSLLLITHYLNELPYHLLFSTIFFVSSYFPLGVFTEAS-------RSSVFYLNYAILFQL 1189

Query: 1391 YISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLI 1450
            Y   + ++++      ++A  +        LSFCG +   +++P FW FM+++SP TY +
Sbjct: 1190 YYIGLALMILYMSPNLQSANVIVGFILSFLLSFCGAVQPASLMPGFWTFMWKLSPYTYFL 1249

Query: 1451 DALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECHFCQ 1510
              L+ + + +  V CS  EL    PP G TC E+ +P+ +  GTGY+ +  +  +C +CQ
Sbjct: 1250 QNLVGLLMHDKPVRCSKKELSLFNPPVGQTCGEFTKPFFE-FGTGYIANPDATADCAYCQ 1308

Query: 1511 FSSTNDYLATVSSSYSRRWMNYG 1533
            +   ++YLA +++S+S  W N+G
Sbjct: 1309 YKVGDEYLARINASFSYLWRNFG 1331

 Score =  116 bits (290), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 141/595 (23%), Positives = 264/595 (44%), Gaps = 88/595 (14%)

Query: 935  KNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTM---GLITGDVFVDGRP 991
            +N  + IL NV    K G +  ++G  GAG T+ L   A  T+    G+ TG +  DG P
Sbjct: 39   RNKMKIILKNVSLLAKSGEMVLVLGRPGAGCTSFLKSAAGETSQFAGGVTTGHISYDGIP 98

Query: 992  RD---QSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQ-ADDVSIEEKDKYVEE----- 1042
            +    Q +   + Y  +QD+H    TV+++L F+   +  A  V+   K++Y+       
Sbjct: 99   QKEMMQHYKPDVIYNGEQDVHFPHLTVKQTLDFAISCKMPAKRVNNVTKEEYITANREFY 158

Query: 1043 -----VIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDS 1097
                 +    + K+  D I GV G      +RKR++I   LAAK  +  + D  T GLDS
Sbjct: 159  AKIFGLTHTFDTKVGNDFISGVSGG-----ERKRVSIAEALAAKGSIYCW-DNATRGLDS 212

Query: 1098 QTAWSTCQLMKKLASR-GQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKT 1156
             TA    + ++ + +  G   L T++Q S  + + FD++  L  G Q ++ G+  +    
Sbjct: 213  STALEFARAIRTMTNLLGTTALVTVYQASENIYETFDKVTVLYAGRQ-IFCGKTTEAK-- 269

Query: 1157 MINYFEAHGAHKCPPDANPAEWMLEIVGA------APG-----THASQDYFAIWRDSEEY 1205
              +YFE  G + CPP  + AE++  I          PG      H + ++   W DS EY
Sbjct: 270  --DYFENMG-YLCPPRQSTAEYLTAITDPNGLHEIKPGFEYQVPHTADEFEKYWLDSPEY 326

Query: 1206 REMQKELDWMEREL----PKRT-------EGSSNEEQKEFATSTLY-QIKLVSYRLFHQY 1253
              ++ E+   + E+     K+T       E S    +K + T + + QI+L + R F + 
Sbjct: 327  ARLKGEIQKYKHEVNTEWTKKTYNESMAQEKSKGTRKKSYYTVSYWEQIRLCTIRGFLRI 386

Query: 1254 WRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQ------ 1307
            +    Y      + I      G  F++A +S  G  ++   +F F++++  ++       
Sbjct: 387  YGDKSYTVINTCAAIAQAFITGSLFYQAPSSTLGAFSRSGVLF-FSLLYYSLMGLANISF 445

Query: 1308 QYLPLFVQQRELYEARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRN 1367
            ++ P+ +Q+ ++Y +   PS      A  ++  +   P+ ++  T    + Y+  G +R+
Sbjct: 446  EHRPI-LQKHKVY-SLYHPS------AEALASTISSFPFRMIGLTFFIIILYFLAGLHRS 497

Query: 1368 ASYANQLHERGALF--WLFACAFYVYISSMGVLVISCIEIAENAANLASLFFI-MSLSFC 1424
            A         GA F  +L        I+S+  +V S  +    A ++A +  + +++   
Sbjct: 498  A---------GAFFTMYLLLTMCSEAITSLFQMVSSLCDTLSQANSIAGVVMLSIAMYST 548

Query: 1425 GVLATPNILPRF-WIFMYRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSG 1478
             ++  P++ P F WI    + P+ Y  +++L+       + C        + PSG
Sbjct: 549  YMIQLPSMHPWFKWI--SYILPIRYAFESMLNAEFHGRHMDCGGT-----LVPSG 596

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 125/578 (21%), Positives = 230/578 (39%), Gaps = 84/578 (14%)

Query: 194  QILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKN 253
            ++L  + G   PG L  ++G  GAG TTLL +++    G  I+ D ++         +  
Sbjct: 746  KLLDSVSGYCVPGTLTALIGESGAGKTTLLNTLAQRNVG-TITGDMLV-----DGLPMDA 799

Query: 254  HYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGL 313
             ++    Y  + D+H+  LTV ++L   AR++ P++       +   K ++ + M  +  
Sbjct: 800  SFKRRTGYVQQQDLHVAELTVKESLQFSARMRRPQSIPDAEKMEYVEKIISILEMQEF-- 857

Query: 314  SHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSK--FQCWDNATRGLDSATALEFIKAL 371
               ++  VG +   G++  +RK++SI  V + G        D  T GLDS +A   +K L
Sbjct: 858  ---SEALVG-EIGYGLNVEQRKKLSIG-VELVGKPDLLLFLDEPTSGLDSQSAWAVVKML 912

Query: 372  KTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQ-IFFGP----SKQAKKYFQRMG- 425
            K  A +   +    I+Q S   ++ FD++ +L  G Q I+FG     S    KYF++ G 
Sbjct: 913  KRLA-LAGQSILCTIHQPSATLFEQFDRLLLLGKGGQTIYFGEIGKNSSSVIKYFEKNGA 971

Query: 426  YVCPERQTTADYLTSITSPSERIKDKDMVKHGIMIPQTAYEMNQY---WIQSEEYKQLQV 482
              C + +  A+Y                +   I    TA     +   W +S EY  +  
Sbjct: 972  RKCQQNENPAEY----------------ILEAIGAGATASVQQNWPDIWQKSHEYANINE 1015

Query: 483  QVNKHLDTDSSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRD---IWRIKND 539
            ++N           + IK+       K A  +S Y  S+  Q  ++L R     WR  N 
Sbjct: 1016 KIN-----------DMIKDLSSTTLHKTATRASKYATSYSYQFHHVLKRSSLTFWRNLN- 1063

Query: 540  PSIQLFTVLSHAAMALILGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLY 599
                    +    M L++  +F          TF++ G                 + S  
Sbjct: 1064 -------YIMAKMMLLMISGLFIGF-------TFFHVGVNAIGLQNSLFACFMAIVISAP 1109

Query: 600  ETRPITEK----HKTYSLYRPSADAF-------ASTFSDVPTKLATAVTFNIPYYFLINL 648
             T  I E+     + Y +    ++ F           +++P  L  +  F +  YF + +
Sbjct: 1110 ATNQIQERATVAKELYEVRESKSNMFHWSLLLITHYLNELPYHLLFSTIFFVSSYFPLGV 1169

Query: 649  KRDAGAFFFYFLINIITVFAMSH--LFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIP 706
              +A     ++L N   +F + +  L   I  +S  L  A V    +L     + G   P
Sbjct: 1170 FTEASRSSVFYL-NYAILFQLYYIGLALMILYMSPNLQSANVIVGFILSFLLSFCGAVQP 1228

Query: 707  RVQMLGWSKWISYINPLSYLFESLMINEFHGRNFPCAQ 744
               M G+  ++  ++P +Y  ++L+    H +   C++
Sbjct: 1229 ASLMPGFWTFMWKLSPYTYFLQNLVGLLMHDKPVRCSK 1266

>CAGL0I04862g complement(438338..442861) highly similar to sp|P32568
            Saccharomyces cerevisiae YDR011w SNQ2 multidrug
            resistance protein, hypothetical start
          Length = 1507

 Score =  998 bits (2580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/1402 (38%), Positives = 798/1402 (56%), Gaps = 74/1402 (5%)

Query: 138  GCAWKDLSASGDSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILK 197
            G   + +SA G  +      TFGN+          C+   ++     KS        IL 
Sbjct: 131  GVTLEHVSARGADSTAMEGATFGNV---------LCLPYTIYKAIRDKSGSKMR--TILN 179

Query: 198  PMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRG 257
             + G    GE+++VLGRPGAGC+++LK  +     F    +  I Y+G   KE+   Y+ 
Sbjct: 180  DVSGLARAGEMVLVLGRPGAGCSSMLKVTAGEIDQFAGGVEGEIMYDGIPQKEMMKRYKP 239

Query: 258  EVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTA 317
            +V+YN E D+H PHLTV QTL      KTP  R+  V R+ +     ++    +GL HT 
Sbjct: 240  DVIYNGEQDVHFPHLTVQQTLDFAIACKTPSKRVNDVSREEYIASTRDLHATIFGLRHTY 299

Query: 318  DTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATI 377
             TKVGNDFVRGVSGGERKRVSIAE  +      CWDNATRGLD++TALE+ KA++    +
Sbjct: 300  HTKVGNDFVRGVSGGERKRVSIAEALVTKGSIYCWDNATRGLDASTALEYAKAIRITTNL 359

Query: 378  TKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADY 437
              S A V IYQ S++ Y+ FDKV VLY G QI+FGP  +AK YF RMGY CP RQ TA++
Sbjct: 360  LGSTAFVTIYQASENIYETFDKVTVLYTGRQIYFGPIDEAKDYFYRMGYECPPRQVTAEF 419

Query: 438  LTSITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHL-DTDSSQQR 496
            LT++T  +   K +   ++   +P+TA E  +YW +S EY+QL + ++++  + D+ + +
Sbjct: 420  LTALTDVNGYHKIRPGYEN--KVPRTAEEFERYWQESPEYRQLLIDIDQYKKEIDTEKTK 477

Query: 497  EQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALI 556
            E    +   ++SK AR  S YTVSF+ Q++    R   RI  D +  + T+ S    +L+
Sbjct: 478  EIYDQSMQQEKSKHARKKSYYTVSFWEQIRLCTKRGFQRIYGDKAYTVITICSAIIQSLV 537

Query: 557  LGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRP 616
             GS++Y     ++T+  + RG                 +   +E RPI +KHK YSLY P
Sbjct: 538  SGSLYYNT--PSSTSGAFSRGGVLYFCLLYYSLMGLANL--SFEHRPILQKHKIYSLYHP 593

Query: 617  SADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCI 676
            +A+A  ST ++ P ++     F I  YFL  L R A +FF  +L   +   +++ LF  I
Sbjct: 594  AAEALGSTIANFPFRMIGMTCFLIIIYFLSGLNRTASSFFRVYLFLTMCSESINALFELI 653

Query: 677  GSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFH 736
             +    + QA   + +++++ ++Y+ + I    M  W KWISYI P+ Y FES+++ EFH
Sbjct: 654  AAGCDNISQANSISGIVMMSISLYSTYMIQLPSMRPWFKWISYILPIRYAFESMLLAEFH 713

Query: 737  GRNFPCA-QYIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSV 795
            GR+  C    +PSGP Y N   +   C+ +GS PG ++V GDD+++  + Y +K++WR+ 
Sbjct: 714  GRHMGCGGTLVPSGPGYENIASENQVCAFVGSKPGQSWVLGDDYLRLQFEYEYKHEWRNF 773

Query: 796  GIGLAXXXXXXXXXXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQPTLST 855
            GI                E     K  G+ L+F                           
Sbjct: 774  GIMWCFLLGYIALKALITEIKRPVKGGGDALIFKKGTRKYHMKLD--------------- 818

Query: 856  SDAEKDVEMNNNSSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXXXXXXXXDDIE 915
               E+D E++     T  +F   S ++    D+                          E
Sbjct: 819  ---EEDGELHEID--TKEKFSSRSGSSTTSEDEI------------------------FE 849

Query: 916  LSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAER 975
              +S+ IF W+N+CY IP   G R++LDNV G+ KPGTLTAL+G SGAGKTTLL+ LA+R
Sbjct: 850  ELESKGIFIWRNVCYTIPYDGGMRQLLDNVSGFCKPGTLTALMGESGAGKTTLLNTLAQR 909

Query: 976  TTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEE 1035
              +G+ITGD+ V+G+P D SF R  GY QQQD+H+   TVRESL+FSA +R+A +V  EE
Sbjct: 910  N-VGIITGDMLVNGKPIDISFERRTGYVQQQDIHISELTVRESLQFSARMRRAQNVPEEE 968

Query: 1036 KDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGL 1095
            K ++VE +I+VL+M+ YADA+VG  G GLNVEQRK+L+IGVEL AKP LL+FLDEPTSGL
Sbjct: 969  KMEHVERIIKVLDMEEYADALVGDVGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGL 1028

Query: 1096 DSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCK 1155
            DSQ++W+  QL+KKLA  GQ+ILCTIHQPSA L +EFDRLL L++GGQTVYFG++G   K
Sbjct: 1029 DSQSSWAIVQLLKKLAKAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFGDIGDNSK 1088

Query: 1156 TMINYFEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKELDWM 1215
            T+++YFE +GA KC P  NPAE++LE +GA      ++D+  IW++S+E+   +KE+D +
Sbjct: 1089 TLLSYFERNGARKCSPSENPAEYILEAIGAGATASVTEDWHQIWKNSDEFISTEKEVDHL 1148

Query: 1216 ERELP-KRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFI 1274
              +L  ++TE    +   ++ATS  YQ K V  R     WR   Y+ SK     V  L+I
Sbjct: 1149 IDQLSNQKTESEFGDAPTKYATSYAYQFKWVLIRTSMSLWRNLDYIMSKMMLMTVGGLYI 1208

Query: 1275 GFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSRTFSWKA 1334
            GFTF+    S  GLQN + A F+  ++  P + Q     +  REL+E RE  S  F W  
Sbjct: 1209 GFTFYDPGDSYTGLQNTLFAAFISIILSAPAMNQIQARAIAARELFEVRESKSNMFHWSL 1268

Query: 1335 FIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWL-FACAFYVYIS 1393
             +++Q L EIP++ L   I F   Y+P+  +  AS +       A+++L ++  F +Y  
Sbjct: 1269 LLITQYLSEIPYHFLFSAIFFVSSYFPLRTHFQASAS-------AVYYLNYSIMFQLYYI 1321

Query: 1394 SMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDAL 1453
              G+ V+      ++A  +  L     ++FCGV+   +++P FW FM++ SP TY +  +
Sbjct: 1322 GFGLCVLYMAPNLQSANVILGLCLSFLIAFCGVVQPVSLMPGFWTFMWKTSPYTYFVQNM 1381

Query: 1454 LSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECHFCQFSS 1513
            + + L N  V+C   EL    PP+G TC E+ + ++   G GY+ + ++ T C +C +  
Sbjct: 1382 VGILLHNKPVICRKKELSIFDPPAGQTCQEFTQAFLDKRG-GYIANPNATTACEYCIYEV 1440

Query: 1514 TNDYLATVSSSYSRRWMNYGIF 1535
             +DYL  +S+SYS  W N+G++
Sbjct: 1441 GDDYLKHISASYSYLWRNFGLY 1462

>YDR011W (SNQ2) [865] chr4 (465916..470421) Drug-efflux pump involved
            in resistance to multiple drugs, member of the
            ATP-binding cassette (ABC) superfamily [4506 bp, 1501 aa]
          Length = 1501

 Score =  997 bits (2577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/1404 (38%), Positives = 799/1404 (56%), Gaps = 80/1404 (5%)

Query: 138  GCAWKDLSASGDSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILK 197
            G   +D+SA G  A      TFGN+          C+   +F     K++ +    QI+ 
Sbjct: 129  GVTIEDVSAKGVDASALEGATFGNI---------LCLPLTIFKGI--KAKRHQKMRQIIS 177

Query: 198  PMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRG 257
             ++     GE+++VLGRPGAGC++ LK  +     F       + Y+G   +E+   Y+ 
Sbjct: 178  NVNALAEAGEMILVLGRPGAGCSSFLKVTAGEIDQFAGGVSGEVAYDGIPQEEMMKRYKA 237

Query: 258  EVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTA 317
            +V+YN E D+H P+LTV QTL      KTP  R+  V +  +     ++    +GL HT 
Sbjct: 238  DVIYNGELDVHFPYLTVKQTLDFAIACKTPALRVNNVSKKEYIASRRDLYATIFGLRHTY 297

Query: 318  DTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATI 377
            +TKVGNDFVRGVSGGERKRVSIAE         CWDNATRGLD++TALE+ KA++    +
Sbjct: 298  NTKVGNDFVRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDASTALEYAKAIRIMTNL 357

Query: 378  TKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADY 437
             KS A V IYQ S++ Y+ FDKV VLY G QI+FG   +AK YF +MGY+CP RQ TA++
Sbjct: 358  LKSTAFVTIYQASENIYETFDKVTVLYSGKQIYFGLIHEAKPYFAKMGYLCPPRQATAEF 417

Query: 438  LTSITSPSERIKDKDMVKHGI--MIPQTAYEMNQYWIQSEEYKQLQVQVNKHLDTDSSQQ 495
            LT++T P+       ++K G    +P+TA E   YW+ S E+ Q++  +  + +  ++++
Sbjct: 418  LTALTDPN----GFHLIKPGYENKVPRTAEEFETYWLNSPEFAQMKKDIAAYKEKVNTEK 473

Query: 496  REQIKNAHIAKQ-SKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMA 554
             +++ +  +A++ SK  R  S YTVS++ QVK    R   RI  + S  +  V S    +
Sbjct: 474  TKEVYDESMAQEKSKYTRKKSYYTVSYWEQVKLCTQRGFQRIYGNKSYTVINVCSAIIQS 533

Query: 555  LILGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLY 614
             I GS+FY     ++T+  + RG                 I   +E RPI +KHK YSLY
Sbjct: 534  FITGSLFYNT--PSSTSGAFSRGGVLYFALLYYSLMGLANI--SFEHRPILQKHKGYSLY 589

Query: 615  RPSADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFR 674
             PSA+A  ST +  P ++     F I  +FL  L R AG+FF  +L   +   A++ LF 
Sbjct: 590  HPSAEAIGSTLASFPFRMIGLTCFFIILFFLSGLHRTAGSFFTIYLFLTMCSEAINGLFE 649

Query: 675  CIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINE 734
             + SV  TL QA   + +L+++ +MY+ + I    M  W KWISY+ P+ Y FES++  E
Sbjct: 650  MVSSVCDTLSQANSISGILMMSISMYSTYMIQLPSMHPWFKWISYVLPIRYAFESMLNAE 709

Query: 735  FHGRNFPCAQ-YIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWR 793
            FHGR+  CA   +PSG +Y N + D   C+ +GS PG +YV GDD+++  + Y +K+ WR
Sbjct: 710  FHGRHMDCANTLVPSGGDYDNLSDDYKVCAFVGSKPGQSYVLGDDYLKNQFQYVYKHTWR 769

Query: 794  SVGIGLAXXXXXXXXXXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQPTL 853
            + GI                EY    K  G+ L+F                         
Sbjct: 770  NFGILWCFLLGYVVLKVIFTEYKRPVKGGGDALIFKKGSKRF------------------ 811

Query: 854  STSDAEKDVEMNNNSSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXXXXXXXXDD 913
              + A+++   N N      +F  +S  A   ND+                       DD
Sbjct: 812  -IAHADEESPDNVNDIDAKEQFSSESSGA---NDEVF---------------------DD 846

Query: 914  IELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLA 973
            +E   ++ +F WK++C+ IP + GKR +LDNV G+  PGT+TAL+G SGAGKTTLL+ LA
Sbjct: 847  LE---AKGVFIWKDVCFTIPYEGGKRMLLDNVSGYCIPGTMTALMGESGAGKTTLLNTLA 903

Query: 974  ERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSI 1033
            +R  +G+ITGD+ V+GRP D SF R  GY QQQD+H+   TVRESL+FSA +R+   +  
Sbjct: 904  QRN-VGIITGDMLVNGRPIDASFERRTGYVQQQDIHIAELTVRESLQFSARMRRPQHLPD 962

Query: 1034 EEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTS 1093
             EK  YVE++I VL M+ YA+A+VG  G GLNVEQRK+L+IGVEL AKP LL+FLDEPTS
Sbjct: 963  SEKMDYVEKIIRVLGMEEYAEALVGEVGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPTS 1022

Query: 1094 GLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKG 1153
            GLDSQ++W+  QL++KL+  GQ+ILCTIHQPSA L +EFDRLL L++GGQTVYFG++GK 
Sbjct: 1023 GLDSQSSWAIIQLLRKLSKAGQSILCTIHQPSATLFEEFDRLLLLRKGGQTVYFGDIGKN 1082

Query: 1154 CKTMINYFEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKELD 1213
              T++NYFE +GA KC    NPAE++LE +GA       +D+   W +S E+ + ++++ 
Sbjct: 1083 SATILNYFERNGARKCDSSENPAEYILEAIGAGATASVKEDWHEKWLNSVEFEQTKEKVQ 1142

Query: 1214 WMERELPKR-TEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSEL 1272
             +  +L K+ T+    ++  ++ATS  YQ + V  R    +WR+  Y+ SK    +V  L
Sbjct: 1143 DLINDLSKQETKSEVGDKPSKYATSYAYQFRYVLIRTSTSFWRSLNYIMSKMMLMLVGGL 1202

Query: 1273 FIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSRTFSW 1332
            +IGFTFF    S  GLQN M A F+  ++  P + Q     +  REL+E RE  S  F W
Sbjct: 1203 YIGFTFFNVGKSYVGLQNAMFAAFISIILSAPAMNQIQGRAIASRELFEVRESQSNMFHW 1262

Query: 1333 KAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFAC-AFYVY 1391
               +++Q L E+P++L   TI F   Y+P+  +  AS       R A+++L  C  F +Y
Sbjct: 1263 SLVLITQYLSELPYHLFFSTIFFVSSYFPLRIFFEAS-------RSAVYFLNYCIMFQLY 1315

Query: 1392 ISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLID 1451
               +G++++       +A  +  L     LSFCGV    +++P FW FM++ SP TY + 
Sbjct: 1316 YVGLGLMILYMSPNLPSANVILGLCLSFMLSFCGVTQPVSLMPGFWTFMWKASPYTYFVQ 1375

Query: 1452 ALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECHFCQF 1511
             L+ + L    VVC   EL    PP+G TC EYM+P+++   TGY+ +  + ++C +C +
Sbjct: 1376 NLVGIMLHKKPVVCKKKELNYFNPPNGSTCGEYMKPFLEK-ATGYIENPDATSDCAYCIY 1434

Query: 1512 SSTNDYLATVSSSYSRRWMNYGIF 1535
               ++YL  +SS YS  W N+GIF
Sbjct: 1435 EVGDNYLTHISSKYSYLWRNFGIF 1458

>Scas_716.81
          Length = 1565

 Score =  996 bits (2574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/1401 (39%), Positives = 786/1401 (56%), Gaps = 72/1401 (5%)

Query: 138  GCAWKDLSASGDSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILK 197
            G   +D++A G  A      TFGN+          C+   ++     ++  N    +I++
Sbjct: 187  GVTMEDVTAEGVDASALEGATFGNV---------LCLPYTIYKGI--RARRNRKWRKIIQ 235

Query: 198  PMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRG 257
                   PGE+++VLGRPGAGC++ LK I+     F       ITY+G   KE+  HY+ 
Sbjct: 236  NSYALAKPGEMILVLGRPGAGCSSFLKVIAGEIDQFPGGVKGEITYDGIPQKEMMKHYKS 295

Query: 258  EVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTA 317
            +V+YN E D+H PHLTV QTL      KTP  R+  + RD + K   E+    +GL HT 
Sbjct: 296  DVIYNGELDVHFPHLTVQQTLDFALACKTPAKRVNNISRDEYIKSSRELYATIFGLRHTY 355

Query: 318  DTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATI 377
            +TKVGNDFVRGVSGGERKRVSIAE         CWDNATRGLD++TALE+ KA++    +
Sbjct: 356  NTKVGNDFVRGVSGGERKRVSIAEALAANGSIYCWDNATRGLDASTALEYAKAIRIMTNL 415

Query: 378  TKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADY 437
              S A V IYQ S++ Y+ FDKV VL  G QI+FG  + AK YF+ MGY+CP RQ  A++
Sbjct: 416  LGSTAFVTIYQASENIYETFDKVTVLAKGRQIYFGKIEDAKAYFENMGYICPPRQVMAEF 475

Query: 438  LTSITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKH-LDTDSSQQR 496
            LT+IT P+   K K   ++   +P T  E+ +YW  S E+ +L+  +  +  + D+   R
Sbjct: 476  LTAITDPNGYHKIKSGFEN--KVPVTPVELEEYWHNSPEFAKLKEDITTYKTNVDTENTR 533

Query: 497  EQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALI 556
            E  K +   ++SK +   S YTVSF+ QV+   IR   RI  + +  +  + S    A I
Sbjct: 534  EMYKKSMKEEKSKHSSKKSFYTVSFWEQVRLCTIRGTQRIYGNKTYTVINICSAIIQAFI 593

Query: 557  LGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRP 616
             GS+FY +   + T   + RG                 +   ++ RPI +KHK YSLY P
Sbjct: 594  TGSLFYNI--PSDTNGAFSRGGVLYFTLLYYSLMGLANM--SFDHRPILQKHKGYSLYHP 649

Query: 617  SADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCI 676
             A+A AS  +  P ++     F I  +FL NL R  G FF  +L   +   A++ LF  I
Sbjct: 650  GAEAIASALAAFPFRMIGLTCFFIIIFFLTNLHRAPGPFFMMYLFLTMCSEAINGLFEMI 709

Query: 677  GSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFH 736
             +   TL QA   A +L+L  ++Y+ + I    M  W KWISYI P+ Y FES++  EFH
Sbjct: 710  AAGCDTLAQANSIAGILMLCISLYSSYMIQLPSMHPWFKWISYIIPIRYAFESMLNAEFH 769

Query: 737  GRNFPCA-QYIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSV 795
            GR+  C    +P+GP Y N + +   C+ +GS PG ++V GDD+++  + Y +K++WR+ 
Sbjct: 770  GRHMDCGGTLVPTGPGYENVSSENRVCAFVGSEPGQSWVLGDDYLKKQFTYEYKHQWRNF 829

Query: 796  GIGLAXXXXXXXXXXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQPTLST 855
            GI                E+    K  G+ L+F                    +   L +
Sbjct: 830  GIMWCFLIGYMFIKAFITEHKRPVKGGGDALLFKKGSIRYN------------DVNDLES 877

Query: 856  SDAEKDVEMNNNSSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXXXXXXXXDDIE 915
            SD   D E+ +  ++T            +  D+  A E                      
Sbjct: 878  SDNSNDTEIKDKFTSTT-----------ISTDEEGAFEEL-------------------- 906

Query: 916  LSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAER 975
              +S+ +F WK +CY IP + GKR +LD+V G+  PGTLTAL+G SGAGKTTLL+ LA+R
Sbjct: 907  --ESKGVFLWKEVCYTIPYERGKRMLLDHVSGYCVPGTLTALMGESGAGKTTLLNTLAKR 964

Query: 976  TTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEE 1035
              +G++TGD+ V+GRP D SF R  GY QQQD+H+   TVRESL+FSA +R+++ VS EE
Sbjct: 965  NEIGVVTGDMLVNGRPVDASFERRTGYVQQQDIHIAELTVRESLQFSARMRRSEHVSDEE 1024

Query: 1036 KDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGL 1095
            K  YVE++I VLEM+ +ADA+VG  G GLNVEQRK+L+IGVEL AKP LL+FLDEPTSGL
Sbjct: 1025 KLAYVEKIIRVLEMEEFADALVGAIGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGL 1084

Query: 1096 DSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCK 1155
            DSQ++W+  QL++KLA  GQ+ILCTIHQPSA L ++FDRLL L++GGQTVYFG++G+  +
Sbjct: 1085 DSQSSWAIVQLLRKLAQAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDIGENSE 1144

Query: 1156 TMINYFEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKELDWM 1215
             ++ YFE  GA KC    NPAE++LE +GA       +D+  IW DS E+   ++++  M
Sbjct: 1145 ILLKYFEKSGARKCDRKENPAEYILEAIGAGATASVKEDWHQIWLDSAEHHAAEEKVSQM 1204

Query: 1216 ERELP-KRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFI 1274
              EL  KR E    ++  ++ATS  YQ   V  R    +WR   Y+ SK     V+ LFI
Sbjct: 1205 ISELSQKRDESDIGDKATKYATSYRYQFGFVLRRTGITFWRNLNYIMSKMMLMTVAGLFI 1264

Query: 1275 GFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSRTFSWKA 1334
            GFTFF   +S  GLQN M   F+  +V  P + Q     +  R+LYE RE  S  F W  
Sbjct: 1265 GFTFFGVGSSFTGLQNAMFTAFISIIVSAPAMNQMQARAIAARDLYEVRESKSNMFHWSL 1324

Query: 1335 FIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACAFYVYISS 1394
             +++Q L E+P++L   TI F   Y+P+  +  AS        G  F  +   F +Y   
Sbjct: 1325 LLITQYLNELPYHLFFSTIFFVSSYFPLRIFFEAS------RSGVYFLNYCIMFQLYYVG 1378

Query: 1395 MGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDALL 1454
            +G+L++       +A  L  L     ++FCGV    +++P FW FM++ SP TY +  L+
Sbjct: 1379 LGLLILYMSPNLPSANVLLGLAMSFLIAFCGVTQPASLMPGFWTFMWKTSPYTYFVQNLV 1438

Query: 1455 SVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECHFCQFSST 1514
             + L    V+C+  EL    PP+G TC +YM P++ S  TGY+ D  + + C +C +S  
Sbjct: 1439 GIMLHEKPVICTKKELNFFDPPAGQTCGQYMAPFL-SRATGYIADPDATSNCAYCLYSVG 1497

Query: 1515 NDYLATVSSSYSRRWMNYGIF 1535
            ++YL  +S+SYS  W N+GI+
Sbjct: 1498 DEYLTRISASYSYLWRNFGIY 1518

>Kwal_23.5161
          Length = 1489

 Score =  994 bits (2571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/1337 (39%), Positives = 777/1337 (58%), Gaps = 70/1337 (5%)

Query: 205  PGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAE 264
            PG++++VLGRPGAGC++ LK+I+  T  F+    +I +Y+G   +E+   Y+ +V+YN E
Sbjct: 176  PGDMVLVLGRPGAGCSSFLKTIAGETRNFEEVRGSI-SYDGIPQEEMMKKYKTDVIYNGE 234

Query: 265  SDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGND 324
             D+H PHLTV QTL       TPR R+ G  R  +   M E+    +GL HT +TKVGND
Sbjct: 235  MDVHFPHLTVQQTLDFALSCTTPRVRLDGASRSEYITAMRELYGTIFGLRHTYNTKVGND 294

Query: 325  FVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATV 384
            FVRGVSGGERKRVSIAE         CWDNATRGLD++TALEF +A++T   + KS A V
Sbjct: 295  FVRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEFAQAIRTMTNLQKSIALV 354

Query: 385  AIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADYLTSITSP 444
             IYQ S++ Y+ FDKV VLYDG QIFFG  +QAK YF+++GY CP RQ +A++LT++T P
Sbjct: 355  TIYQASENIYECFDKVTVLYDGRQIFFGAIEQAKAYFEKLGYRCPARQASAEFLTALTDP 414

Query: 445  S---ERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHLDTDSSQQREQIKN 501
                E +   D       +P+TA E  + W++S EY++L   +  +     +++ + + +
Sbjct: 415  QGLHEYVPGFD-----DRVPRTADEFEKCWLESAEYQRLLADIEDYKQETEAEKTKAMYD 469

Query: 502  AHIAKQ-SKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSM 560
              +A++ SK     S YT+SF  QV+   IR   RI  D +  +   ++     L+ GS+
Sbjct: 470  KSLAQEKSKLNSKRSKYTLSFVEQVRLCTIRGFQRIYGDKAYTITNTIAATIQGLVSGSL 529

Query: 561  FYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADA 620
            +Y   L +  +  + RG                +I    + RP+  KH++YSLY P+ADA
Sbjct: 530  YYN--LPSGVSGAFSRGGVFYFAILYASLMGLAKI--NLDGRPVMLKHRSYSLYHPAADA 585

Query: 621  FASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVS 680
             A + S+ P +  +   F I  YFL  L R+A  FF  FL  ++   +++ LF  I + S
Sbjct: 586  LAGSISEFPFRFISQTLFFIIIYFLAGLTREANRFFIAFLFLVMCSESVNALFDLITAFS 645

Query: 681  KTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFHGRNF 740
             ++ QA   A  +L+A  +Y+ + I    M  W KWISY+ PL Y FES++  EFH R  
Sbjct: 646  SSVAQANSIAGTVLMALILYSTYMIQLGSMHPWFKWISYVQPLRYSFESMLNAEFHAREM 705

Query: 741  PC-AQYIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSVGIGL 799
             C    IP GP+Y N + +   C+ +GS PG  +V+GDD+I TNYGY++ + WR++G   
Sbjct: 706  DCKGNVIPYGPSYANVSTENQVCAFVGSRPGQPFVTGDDYINTNYGYKYSHTWRNLGFMF 765

Query: 800  AXXXXXXXXXXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQPTLSTSDAE 859
            A             E+   +   G+ LVF                     +  +S SD E
Sbjct: 766  AFFLFYLSLKCIITEFKHSSVGTGDTLVFKKGA-----------------KRVVSPSDEE 808

Query: 860  KDVEMNNNSSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXXXXXXXXDDIELSKS 919
                 + + S T S   R++D++   +  + A                      ++  KS
Sbjct: 809  -----SRDKSITMSEAKRNADSSASCSSNSDA----------------------LQAMKS 841

Query: 920  QAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMG 979
              +F WK + + IP K   R++LDNV G+  PG+LTAL+G SGAGKTTLL+ LA+R  +G
Sbjct: 842  TGVFVWKEVNFTIPYKGSTRKLLDNVSGYCAPGSLTALMGESGAGKTTLLNTLAQRN-VG 900

Query: 980  LITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKY 1039
            +ITGD+ V+G+P D SF R  GY QQQD+H+K  TVRES +F+A +R+   +   EK  Y
Sbjct: 901  IITGDMLVNGKPIDASFERRTGYVQQQDVHVKEMTVRESFQFAARMRRPQSIPESEKLAY 960

Query: 1040 VEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQT 1099
            VE++IE+L+M+ YA+A++G  G GLNVEQRK+++IGVELAAKP LL+FLDEPTSGLDSQ+
Sbjct: 961  VEKIIEILDMEDYAEALIGDVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTSGLDSQS 1020

Query: 1100 AWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMIN 1159
            +W+  QLM++LA  GQ+ILCTIHQPSA L +EFDRLL L++GGQTVYFG +GK  + +++
Sbjct: 1021 SWAIVQLMRRLAEAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFGPIGKNSRMLLD 1080

Query: 1160 YFEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKELDWMEREL 1219
            YFE +GA KC    NPAE++LE +GA       +D+  IW+ S +++   +E+D   R+ 
Sbjct: 1081 YFEENGARKCEKTENPAEYILEAIGAGATASVKEDWHDIWKKSSQFKIANEEIDNYVRD- 1139

Query: 1220 PKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFF 1279
               + G+  +   ++ATS  YQ + V  R    +WR   YL +K    I + LFIGFTF+
Sbjct: 1140 SSGSSGTEGDRVSKYATSYSYQFRYVLQRTATIFWRDVNYLMAKMMLYISTGLFIGFTFY 1199

Query: 1280 KANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSRTFSWKAFIVSQ 1339
               TS  GLQN M A FM  +V  P + Q     +  REL+E RE  S TF W   +V+Q
Sbjct: 1200 NVGTSYHGLQNAMFAAFMALIVSAPAMNQIQARAISSRELFEVRESKSNTFHWAFLLVTQ 1259

Query: 1340 ILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFAC-AFYVYISSMGVL 1398
             L EIP++ +  T+ F  +Y+P+  +  ASY+       A+F+L  C  F +YI  +G++
Sbjct: 1260 YLCEIPYHFVFSTMFFVAFYFPLRVHFEASYS-------AVFFLNYCIMFQLYIVGLGLM 1312

Query: 1399 VISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDALLSVGL 1458
            +I       +A  L SL     +SFCGV+   +++P FW FM++ SP TY +   +S+ L
Sbjct: 1313 LIYAAPDLPSAGVLLSLCLSFLISFCGVIQPASLMPGFWTFMWKASPYTYFVQNAVSIVL 1372

Query: 1459 ANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECHFCQFSSTNDYL 1518
             N  V C   E+  + PP G TC EYM  +++S   GY+ +  +   C +C F   +DYL
Sbjct: 1373 NNKPVRCRKKEMSYLNPPEGQTCGEYMADFLKS-APGYINNPDATENCGYCVFKVGDDYL 1431

Query: 1519 ATVSSSYSRRWMNYGIF 1535
              + +S+   W N+G F
Sbjct: 1432 KQIDTSFGNIWRNFGFF 1448

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 130/647 (20%), Positives = 268/647 (41%), Gaps = 89/647 (13%)

Query: 934  IKN-GKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLA-ERTTMGLITGDVFVDGRP 991
            +KN G R I+ N     +PG +  ++G  GAG ++ L  +A E      + G +  DG P
Sbjct: 158  VKNRGNRDIVRNASLLARPGDMVLVLGRPGAGCSSFLKTIAGETRNFEEVRGSISYDGIP 217

Query: 992  RDQ---SFPRSIGYCQQQDLHLKTATVRESLRFSAYLR----QADDVSIEEKDKYVEEVI 1044
            +++    +   + Y  + D+H    TV+++L F+        + D  S  E    + E+ 
Sbjct: 218  QEEMMKKYKTDVIYNGEMDVHFPHLTVQQTLDFALSCTTPRVRLDGASRSEYITAMRELY 277

Query: 1045 EVL-------EMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDS 1097
              +         K+  D + GV G      +RKR++I   LAA+  +  + D  T GLD+
Sbjct: 278  GTIFGLRHTYNTKVGNDFVRGVSG-----GERKRVSIAEALAARGSIYCW-DNATRGLDA 331

Query: 1098 QTAWSTCQLMKKLASRGQAI-LCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKT 1156
             TA    Q ++ + +  ++I L TI+Q S  + + FD++  L +G Q ++FG + +    
Sbjct: 332  STALEFAQAIRTMTNLQKSIALVTIYQASENIYECFDKVTVLYDGRQ-IFFGAIEQAKA- 389

Query: 1157 MINYFEAHGAHKCPPDANPAEWMLEIVGA------APG-----THASQDYFAIWRDSEEY 1205
               YFE  G ++CP     AE++  +          PG        + ++   W +S EY
Sbjct: 390  ---YFEKLG-YRCPARQASAEFLTALTDPQGLHEYVPGFDDRVPRTADEFEKCWLESAEY 445

Query: 1206 REMQKEL-DWMERELPKRTEG-----------SSNEEQKEFATSTLYQIKLVSYRLFHQY 1253
            + +  ++ D+ +    ++T+              N ++ ++  S + Q++L + R F + 
Sbjct: 446  QRLLADIEDYKQETEAEKTKAMYDKSLAQEKSKLNSKRSKYTLSFVEQVRLCTIRGFQRI 505

Query: 1254 WRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLF 1313
            +    Y  +   +  +  L  G  ++   + + G  ++   +F F +++  ++     + 
Sbjct: 506  YGDKAYTITNTIAATIQGLVSGSLYYNLPSGVSGAFSRG-GVFYFAILYASLM-GLAKIN 563

Query: 1314 VQQRELYEARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQ 1373
            +  R +   + R    +   A  ++  + E P+  ++ T+ F + Y+  G  R A+    
Sbjct: 564  LDGRPVM-LKHRSYSLYHPAADALAGSISEFPFRFISQTLFFIIIYFLAGLTREAN---- 618

Query: 1374 LHERGALFWLFACAFYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNIL 1433
               R  + +LF       ++++  L+ +       A ++A    +  + +   +     +
Sbjct: 619  ---RFFIAFLFLVMCSESVNALFDLITAFSSSVAQANSIAGTVLMALILYSTYMIQLGSM 675

Query: 1434 PRFWIFMYRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTG 1493
              ++ ++  V PL Y  +++L+       + C  N +                PY    G
Sbjct: 676  HPWFKWISYVQPLRYSFESMLNAEFHAREMDCKGNVI----------------PY----G 715

Query: 1494 TGYLLDGSSETECHFCQ------FSSTNDYLAT-VSSSYSRRWMNYG 1533
              Y    +    C F        F + +DY+ T     YS  W N G
Sbjct: 716  PSYANVSTENQVCAFVGSRPGQPFVTGDDYINTNYGYKYSHTWRNLG 762

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 135/640 (21%), Positives = 260/640 (40%), Gaps = 92/640 (14%)

Query: 194  QILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKN 253
            ++L  + G   PG L  ++G  GAG TTLL +++    G  I+ D ++  NG   K I  
Sbjct: 862  KLLDNVSGYCAPGSLTALMGESGAGKTTLLNTLAQRNVGI-ITGDMLV--NG---KPIDA 915

Query: 254  HYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGL 313
             +     Y  + D+H+  +TV ++    AR++ P++ I   ++  + + + E+      +
Sbjct: 916  SFERRTGYVQQQDVHVKEMTVRESFQFAARMRRPQS-IPESEKLAYVEKIIEI----LDM 970

Query: 314  SHTADTKVGNDFVRGVSGGERKRVSIA-EVSICGSKFQCWDNATRGLDSATALEFIKALK 372
               A+  +G D   G++  +RK+VSI  E++         D  T GLDS ++   ++ ++
Sbjct: 971  EDYAEALIG-DVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTSGLDSQSSWAIVQLMR 1029

Query: 373  TQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQ-IFFGP----SKQAKKYFQRMG-Y 426
              A   +S     I+Q S   ++ FD++ +L  G Q ++FGP    S+    YF+  G  
Sbjct: 1030 RLAEAGQS-ILCTIHQPSATLFEEFDRLLLLKKGGQTVYFGPIGKNSRMLLDYFEENGAR 1088

Query: 427  VCPERQTTADYLTSITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNK 486
             C + +  A+Y+            K+             + +  W +S ++K    +++ 
Sbjct: 1089 KCEKTENPAEYILEAIGAGATASVKE-------------DWHDIWKKSSQFKIANEEIDN 1135

Query: 487  HL-DTDSSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLF 545
            ++ D+  S   E  +              S Y  S+  Q +Y+L R       D +  + 
Sbjct: 1136 YVRDSSGSSGTEGDR-------------VSKYATSYSYQFRYVLQRTATIFWRDVNYLMA 1182

Query: 546  TVLSHAAMALILGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPIT 605
             ++ + +  L +G  FY V  S       Y G                   +  + R I+
Sbjct: 1183 KMMLYISTGLFIGFTFYNVGTS-------YHGLQNAMFAAFMALIVSAPAMNQIQARAIS 1235

Query: 606  EKHKTYSLYRPSADAFASTF-------SDVPTKLATAVTFNIPYYFLINLKRDAGAFFFY 658
             + + + +    ++ F   F        ++P     +  F + +YF + +  +A ++   
Sbjct: 1236 SR-ELFEVRESKSNTFHWAFLLVTQYLCEIPYHFVFSTMFFVAFYFPLRVHFEA-SYSAV 1293

Query: 659  FLINIITVFAM--SHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKW 716
            F +N   +F +    L   +   +  LP A V  S+ L     + G   P   M G+  +
Sbjct: 1294 FFLNYCIMFQLYIVGLGLMLIYAAPDLPSAGVLLSLCLSFLISFCGVIQPASLMPGFWTF 1353

Query: 717  ISYINPLSYLFE---SLMIN---------EFHGRNFP----CAQY----IPSGPNYVNAT 756
            +   +P +Y  +   S+++N         E    N P    C +Y    + S P Y+N  
Sbjct: 1354 MWKASPYTYFVQNAVSIVLNNKPVRCRKKEMSYLNPPEGQTCGEYMADFLKSAPGYINNP 1413

Query: 757  GDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSVG 796
                 C       G++Y+     I T++G    N WR+ G
Sbjct: 1414 DATENCGYCVFKVGDDYLKQ---IDTSFG----NIWRNFG 1446

>KLLA0D03432g 287805..292256 similar to sp|P32568 Saccharomyces
            cerevisiae YDR011w SNQ2 multidrug resistance protein,
            start by similarity
          Length = 1483

 Score =  989 bits (2556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/1439 (38%), Positives = 817/1439 (56%), Gaps = 88/1439 (6%)

Query: 106  DPRSENFSSVRWVRNMAQICENDSDFYKPFSLGCAWKDLSASGDSADITYQGTFGNMPIK 165
            D   ENF   R ++ + +   ND   +     G   ++++  G  A      T+G+M + 
Sbjct: 84   DEVDENFDMYREIQGILK-ASNDGGIHLR-KAGITARNVAVKGVDAQFLEGATYGDMLM- 140

Query: 166  YLKMSWRCISRRLFHRTHGKSEDNDSGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKS 225
                    +   +F     K     +   I+  ++  + PGE+L+VLGRPG+GC+T LK+
Sbjct: 141  --------LPATIFKGI--KKARQTTLRDIISNVNLLVRPGEMLLVLGRPGSGCSTFLKT 190

Query: 226  ISVNTHGFK-ISPDTIITYNGFSNKEIKNHYRGEVVYNAESDIHIPHLTVFQTLYTVARL 284
            ++     FK +S D  I+Y+G S K++  +++ +V+YN E D+H PHLTV QTL      
Sbjct: 191  MAGELSHFKGVSGD--ISYDGVSQKDMLKYFKSDVIYNGEMDVHFPHLTVQQTLDFAVAC 248

Query: 285  KTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSI 344
            KTP  RI    R  + + + ++    +GL HT +TKVG+DFVRGVSGGERKRVSIAE   
Sbjct: 249  KTPSKRINDFTRQQYIEFIRDLYATIFGLKHTYNTKVGDDFVRGVSGGERKRVSIAEALA 308

Query: 345  CGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLY 404
                  CWDNATRGLD++TALE+ +A++    + KS A + +YQ S++ Y+ FDKV +LY
Sbjct: 309  ARGSIYCWDNATRGLDASTALEYTEAIRCMTNLLKSTALITVYQASENIYETFDKVTILY 368

Query: 405  DGYQIFFGPSKQAKKYFQRMGYVCPERQTTADYLTSITSPSERIKDKDMVKHGI--MIPQ 462
            +G QI+FG  ++AKKYF+ +G++CP RQ TA++LTS+T      K    V+ G    +P+
Sbjct: 369  EGKQIYFGRIEEAKKYFENLGFICPARQATAEFLTSLTDS----KGLRRVRPGFENKVPR 424

Query: 463  TAYEMNQYWIQSEEYKQLQVQVNKHLDT---DSSQQREQIKNAHIAKQSKRARPSSPYTV 519
            T  +  + W +S+EY  L +Q  +H +T   D ++  +  K + + ++ K +R  S +T+
Sbjct: 425  TRDDFVRVWEESKEYHDL-IQSIEHYETKEVDGAKTIQFFKESMVEEKDKASRKKSKFTI 483

Query: 520  SFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYEVMLSTTTTTFYYRGXX 579
            S++ Q++    R   RI  D S  +   ++    AL+ GS+FY     ++T   + RG  
Sbjct: 484  SYWAQIRLCTRRGFQRIYGDKSFTITNTVAAIIQALVTGSLFYNT--PSSTQGAFSRGGV 541

Query: 580  XXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFASTFSDVPTKLATAVTFN 639
                           I SL   RPI +KH  YSLY PSA+A AST S+   ++ +   F 
Sbjct: 542  LYFAILYFSLMGLANI-SL-ANRPILQKHIAYSLYHPSAEALASTISNAFFRMISLTAFL 599

Query: 640  IPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTLPQAMVPASVLLLAFAM 699
            I  YFL  L R+AG FF  +L   +   +++ LF  I +   ++ QA   A ++++A ++
Sbjct: 600  IILYFLSGLTRNAGRFFMVYLFVALASESINALFEFITAACDSISQANAIAGLVMMALSL 659

Query: 700  YTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFHGRNFPCA-QYIPSGPNYVNATGD 758
            Y+ + I    M  W +WISYI PL Y FE+++  EFH R   C    +P+GP Y N + +
Sbjct: 660  YSTYMIQTPSMHPWFEWISYILPLRYAFENMLNAEFHARRMDCGGTLVPTGPVYENVSSE 719

Query: 759  EVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSVGIGLAXXXXXXXXXXXXCEYNEG 818
               C+ +GS PG +YV GD++++  Y Y + ++WR+ GI +A             E+   
Sbjct: 720  YKVCAFIGSQPGESYVLGDNYLKLQYDYSYSHQWRNFGILIAFLVGFLVFKSVITEFKTP 779

Query: 819  AKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQPTLSTSDAEKDVEMNNNSSATDSRFLRD 878
             K +G+ L+F                         S +   KD E N NS  TDS   + 
Sbjct: 780  IKSSGDALLFKKGT---------------------SLNTIPKDEESNVNS--TDS-ITKT 815

Query: 879  SDAAIMGNDKTVAKEHYXXXXXXXXXXXXXXXXDDIELSKSQAIFHWKNLCYDIPIKNGK 938
            +D++   +D  +  +                        +S+ IF WK++CY IP K G+
Sbjct: 816  TDSSSRSDDPALFADM-----------------------RSEGIFLWKDICYTIPYKGGE 852

Query: 939  RRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPR 998
            R +LDNV G+VKPGTLTAL+G SGAGKTTLL+ LA+RT +G++TGD+ V+G+P D SF R
Sbjct: 853  RLLLDNVSGYVKPGTLTALMGESGAGKTTLLNTLAQRTDIGVVTGDMLVNGKPIDASFER 912

Query: 999  SIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVG 1058
              GY QQQD+H+K  TVRESL+FSA +R+   V  EEK  YVE+VIE+L+M  Y +A+VG
Sbjct: 913  RTGYVQQQDVHIKEMTVRESLQFSARMRRPLTVPDEEKLDYVEKVIEILDMSAYGEALVG 972

Query: 1059 VPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQAIL 1118
              G GLNVEQRK+L+I VEL AKP LL+FLDEPTSGLDSQ+AW+  QL+KKLA  GQ+IL
Sbjct: 973  NIGYGLNVEQRKKLSIAVELVAKPNLLLFLDEPTSGLDSQSAWAIVQLLKKLAGAGQSIL 1032

Query: 1119 CTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGAHKCPPDANPAEW 1178
            CTIHQPSA L +EFDRLL L++GGQTVYFG++G+   T+++YFE +GA +C    NPAE+
Sbjct: 1033 CTIHQPSATLFEEFDRLLLLRKGGQTVYFGDIGEHSSTLLSYFERNGARRCEEKENPAEY 1092

Query: 1179 MLEIVGAAPGTHASQDYFAIWRDSEEYREMQKEL-DWMERELPKRTEGSSNEEQKEFATS 1237
            +LE +GA       +D+   W  S E+  + +E+ D +E+   +  + SS E   ++AT 
Sbjct: 1093 ILEAIGAGATASVKEDWHEKWIKSSEFVSVNQEINDLIEKLAHQPNDDSSTELITKYATP 1152

Query: 1238 TLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFM 1297
              YQ   V  R    +WR   YL +K    I S LFIGFTF+   TS  GLQN M A FM
Sbjct: 1153 YWYQFVYVLRRTMVMFWRDVDYLMAKTMLYISSGLFIGFTFYNVGTSFVGLQNAMFAAFM 1212

Query: 1298 FTVVFNPILQQYLPLFVQQRELYEARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFV 1357
              +V  P + Q     +Q RELYE RE  S  F W   + SQ + E+P+ L   T+ F  
Sbjct: 1213 ACIVSAPAMNQIQARALQSRELYEVRESRSNMFHWSCMLFSQYITELPYQLWCSTLFFVS 1272

Query: 1358 YYYPVGFYRNASYANQLHERGALFWLFACA-FYVYISSMGVLVISCIEIAENAANLASLF 1416
            +Y+P+     A Y +    +  LF+L  C  F +Y   +G+ V+       ++  +  L 
Sbjct: 1273 FYFPL----KAEYTSL---KAGLFYLNYCVIFQLYCVGLGLAVLYMSPDLPSSNVIMGLL 1325

Query: 1417 FIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPP 1476
                ++FCGV+   N++P FW FM++VSP TYLI   +S+ L + +V+C+  EL    PP
Sbjct: 1326 LSFMITFCGVVQPVNLMPGFWTFMWKVSPYTYLIQNFVSLMLHDKTVICTDKELSYFNPP 1385

Query: 1477 SGMTCSEYMEPYMQSTGTGYLLDGSSETECHFCQFSSTNDYLATVSSSYSRRWMNYGIF 1535
             G TC  YM  Y  + G GY+ +  + + C +C++   + YL+ +S+ Y+  W N+G  
Sbjct: 1386 PGSTCGSYMTDYF-TEGFGYIKNPEATSNCAYCRYKIGDQYLSYISAKYADLWRNFGFL 1443

>KLLA0B09702g complement(842245..846801) highly similar to sp|Q02785
            Saccharomyces cerevisiae YPL058c PDR12 multidrug
            resistance transporter, start by similarity
          Length = 1518

 Score =  942 bits (2434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/1407 (37%), Positives = 777/1407 (55%), Gaps = 79/1407 (5%)

Query: 138  GCAWKDLSASGDSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILK 197
            G A+ DL+A G  A       FG   ++ L  SW  +   L+ +  GK +D      I++
Sbjct: 113  GVAFNDLTAVGVDAS----AAFGP-SVEELIRSWGHLPVHLWKKMTGKKDDVPLR-NIIQ 166

Query: 198  PMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGF-KISPDTIITYNGFSNKEIKNHYR 256
               G +  GE+L V+GRPGAGC+TLLK +S  T    +++ D   +Y+G S  E+   ++
Sbjct: 167  HCVGVVESGEMLFVVGRPGAGCSTLLKCVSGETSELVEVTGD--FSYDGLSQAEMMEKFK 224

Query: 257  GEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHT 316
            G V+Y  E D H P +TV +T+    + KTPR RI  + R+ +  +M ++    +GL HT
Sbjct: 225  GYVIYCPELDFHFPKITVKETIDFALKCKTPRVRIDHLSRNQYVDNMRDLWCTVFGLRHT 284

Query: 317  ADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQAT 376
              T VGND VRGVSGGERKRVS+ E     +    WDNATRGLD++TALEF +A++T   
Sbjct: 285  YATNVGNDVVRGVSGGERKRVSLVEALAMSASIYSWDNATRGLDASTALEFAQAIRTATN 344

Query: 377  ITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTAD 436
            +  ++A VAIYQ  ++ Y+LFDK  VLY+G Q++FGP+ +A  YF+RMGY+ P R T+A+
Sbjct: 345  LMNNSAIVAIYQAGENIYELFDKTTVLYNGKQVYFGPATEAVGYFERMGYIKPNRMTSAE 404

Query: 437  YLTSIT----SPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHLDTDS 492
            +LTS+T    + +  IKD    K    +P+++ EM  YW  SEEY++     +++     
Sbjct: 405  FLTSVTVDFANRTLAIKDGYEEK----MPKSSTEMEAYWHNSEEYQRAVEYYHQYCAAHP 460

Query: 493  SQQ-REQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHA 551
             ++ R++++ A   +  K  R  S Y V+F+ QV Y ++R   R K D +     + S  
Sbjct: 461  EEETRQRLELAKHQRLQKGQRAKSQYVVTFWSQVWYCMMRGFQRTKGDFTYTKVYLSSFL 520

Query: 552  AMALILGSMFYEVMLSTTTTT--FYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHK 609
               LI+GSMF+++   + +TT   Y RG                EI + +  R I  KHK
Sbjct: 521  TKGLIVGSMFHKIDPKSQSTTDGAYSRGGLIFYVLLFAAVTSLAEISNSFHNRAIVVKHK 580

Query: 610  TYSLYRPSADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAM 669
            TYS+Y  SA++    F+++PTK    +T ++  Y++  LK DAG+FF + L    T    
Sbjct: 581  TYSMYHTSAESLQEIFTEMPTKFVAVLTLSLVSYWIPVLKYDAGSFFQFLLYLFTTQQCT 640

Query: 670  SHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFES 729
            S +F+ + +++K    A     + +L   +YTGF +P  +M  W +W  Y+NPL+Y +ES
Sbjct: 641  SFIFKLVATLTKDGGTAHAIGGLWVLMLTVYTGFVLPIGEMHHWIRWFHYLNPLTYAYES 700

Query: 730  LMINEFHGRNFPCAQYIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHK 789
            LM  EFHGR   C+Q IPSGP Y   +     C+A G+I GN YVSGD ++   Y + + 
Sbjct: 701  LMSTEFHGRQMLCSQLIPSGPGYEGVSISNQICNAAGAIAGNLYVSGDTYVLKKYHFSYN 760

Query: 790  NKWRSVGIGLAXXXXXXXXXXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXN 849
            + WR  GI +              E+ +  +  G++L++                    +
Sbjct: 761  HAWRDWGINIVWTFGYIVMNVVMSEFLKPLEGGGDLLLYKRG-----------------H 803

Query: 850  QPTLSTSDAEKDVEMNNNSSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXXXXXX 909
             P L +   +  V          SR   +  A++ G D  +AK                 
Sbjct: 804  MPELGSESVDTKVA---------SR--EEMMASLNGPDVDLAK----------------- 835

Query: 910  XXDDIELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLL 969
                  + +S+ +F W +L Y IP     R++L +V G+VKPG +TAL+G SGAGKTTLL
Sbjct: 836  ------IIESKDVFTWNHLNYTIPYDGATRQLLSDVFGYVKPGKMTALMGESGAGKTTLL 889

Query: 970  DCLAERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQAD 1029
            + LA+R ++G+ITGD+ V+ +    SF RS GY  Q D H+   +VRESLRF+A LRQ  
Sbjct: 890  NVLAQRISVGVITGDMLVNAKDLPLSFNRSCGYVAQSDNHMGELSVRESLRFAAELRQPK 949

Query: 1030 DVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLD 1089
             V ++EK  YVE++I +L M+ YA+AI+G  G GLNVEQRK+L+IGVEL AKP LL+FLD
Sbjct: 950  SVPLQEKYDYVEKIISLLGMEKYAEAIIGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLD 1009

Query: 1090 EPTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGE 1149
            EPTSGLDSQ+AWS  Q M+ LA  GQ+ILCTIHQPSA L ++FDRLL L++GG+ VYFG+
Sbjct: 1010 EPTSGLDSQSAWSIVQFMRALADSGQSILCTIHQPSATLFEQFDRLLLLKKGGKMVYFGD 1069

Query: 1150 LGKGCKTMINYFEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQ 1209
            +G+   T++NYFE     KC    NPAE+ML  +GA     AS+D+  +W  S E    +
Sbjct: 1070 IGENSGTLLNYFERQSGVKCGISENPAEYMLNCIGAGATASASEDWHDLWLKSPECAAAR 1129

Query: 1210 KELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIV 1269
            +E++ + R+L  R      E   ++A + L Q+K V  R + Q+WR+P Y+ +KF   ++
Sbjct: 1130 EEVEELHRKLASRPVTDDKELSGKYAANYLTQLKCVFGRTWLQFWRSPVYIRAKFLECVL 1189

Query: 1270 SELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSRT 1329
              LF+G ++   N S+ G      +IFM  ++   ++ Q     +  RELYE RE  S T
Sbjct: 1190 CALFVGLSYVGVNHSIAGANQSFASIFMMLLIALAMVNQLHVFALDSRELYEVREAASNT 1249

Query: 1330 FSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACAFY 1389
            F W A ++    VEI W+     I +  YY+P  +   AS+A      G  F ++   F 
Sbjct: 1250 FHWSALLLCHCTVEIIWSTACEFICWICYYWPAQYTGRASHA------GYFFLIYVIMFP 1303

Query: 1390 VYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWI-FMYRVSPLTY 1448
             Y  S G  V        +A+ + S  F   L FCG+L     +P FW  FMY VSP TY
Sbjct: 1304 AYFISYGCWVFYMSPDVPSASMINSNLFAAMLLFCGILQPREKMPGFWKRFMYNVSPFTY 1363

Query: 1449 LIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECHF 1508
            ++ +L++  +    VVC  NE   + PP G TC EY+  Y++   TGYL + +    C +
Sbjct: 1364 VVQSLVAPIVQGKKVVCGRNEFAVMDPPEGQTCGEYLSTYIEDN-TGYLTNPNDTQSCQY 1422

Query: 1509 CQFSSTNDYLATVSSSYSRRWMNYGIF 1535
            C +S   + +A  +  +  RW N+G  
Sbjct: 1423 CPYSYQQEVVARFNVKWVYRWRNFGFL 1449

>CAGL0M07293g complement(733072..737619) similar to sp|Q02785
            Saccharomyces cerevisiae YPL058c PDR12 or sp|P32568
            Saccharomyces cerevisiae YDR011w, hypothetical start
          Length = 1515

 Score =  931 bits (2407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1408 (36%), Positives = 775/1408 (55%), Gaps = 75/1408 (5%)

Query: 133  KPFSLGCAWKDLSASGDSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSG 192
            +P   G A+K+L+A G  A   Y  +   M     K+    I++        + +D+   
Sbjct: 110  EPGDSGVAFKNLTAVGIDASAAYGPSVEEMLRDTGKLPLTLINKLR------RKKDSVPL 163

Query: 193  FQILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIK 252
              I++   G +  GE+L V+GRPGAGC+TLLK IS  T    +S D   +Y+G   +E+ 
Sbjct: 164  RNIIQNCTGVVESGEMLFVVGRPGAGCSTLLKCISGETSEL-VSVDGEFSYDGLDQEEMM 222

Query: 253  NHYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYG 312
             +Y+G V+Y  E D H P +TV +T+    + KTPR RI  + R  +  ++ ++    +G
Sbjct: 223  KNYKGYVIYCPELDFHFPKITVKETIDFALKCKTPRVRIDRMTRKQYVDNIRDMWCTVFG 282

Query: 313  LSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALK 372
            L HT  TKVGNDFVRGVSGGERKRVS+ E     +    WDNATRGLD++TALEF +A++
Sbjct: 283  LRHTYATKVGNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAIR 342

Query: 373  TQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQ 432
            T   +  ++A VAIYQ  ++ Y+LFDK  VLY+G QI+FGP+K+A +YF+ MG++ P R 
Sbjct: 343  TATNMMNNSAIVAIYQAGENIYELFDKTTVLYNGKQIYFGPAKKAVQYFENMGWIKPPRM 402

Query: 433  TTADYLTSITSPSE-RIKDKDMVKHGI--MIPQTAYEMNQYWIQSEEYKQLQVQVNK-HL 488
            T+A++LTS+T   E R  D   +K G    IP++ +E  +YW+ S EY++L    +  H 
Sbjct: 403  TSAEFLTSVTVDFENRTLD---IKPGYEDTIPKSGFEFEEYWLNSPEYQELLRHYDDYHA 459

Query: 489  DTDSSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVL 548
               + + RE+   A         R SS Y V+++ QV Y +IR   R+K D +     + 
Sbjct: 460  RHPAEETRERFDTAKKQMLQSGQRESSRYVVNYWSQVWYCMIRGFQRVKGDSTYTKVYLS 519

Query: 549  SHAAMALILGSMFYEV--MLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITE 606
            S     LI+GSMF+++     +TT   Y RG                EI + + TRPI  
Sbjct: 520  SFLIKGLIVGSMFHKIDNKSQSTTAGAYSRGGLLFYVLLFASVTSLAEIANSFSTRPIIV 579

Query: 607  KHKTYSLYRPSADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITV 666
            KHK+YS+Y  SA++     +++PTK    +  ++  Y++  LK +AGAFF Y L      
Sbjct: 580  KHKSYSMYHISAESLQEIITELPTKFVAIIVLSLVTYWIPYLKFEAGAFFQYILYLFTVQ 639

Query: 667  FAMSHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYL 726
               S +F+ + +++K    A     + +L   +Y GF +P  +M  W KW+ ++NPL+Y 
Sbjct: 640  QCTSFIFKFVATITKDGVTAHAIGGLWVLMLCVYAGFVLPLGEMHHWIKWLHFLNPLTYA 699

Query: 727  FESLMINEFHGRNFPCAQYIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGY 786
            FESL+  EFH R   C+Q IPSGP Y N +     C+A G+I G+ +V+GD +I   Y +
Sbjct: 700  FESLVSTEFHHREMLCSQLIPSGPGYENVSVANQICNAAGAIKGHMFVNGDTYIDRQYHF 759

Query: 787  RHKNKWRSVGIGLAXXXXXXXXXXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXX 846
             +++ WRS G+ +              E+ +     G++L++                  
Sbjct: 760  AYRHAWRSWGVNIVWTFGYIVFNVILSEFIKPVSGGGDLLLYKRG--------------- 804

Query: 847  XXNQPTLSTSDAEKDVEMNNNSSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXXX 906
              + P   T +A+  V       A+    +   +   +   K +A               
Sbjct: 805  --HMPEFGTENADARV-------ASREEMMETLNGPDVDLPKVIA--------------- 840

Query: 907  XXXXXDDIELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKT 966
                        ++ +F W +L Y IP     R++L +V G+VKPG +TAL+G SGAGKT
Sbjct: 841  ------------AKDVFTWNHLNYTIPYDGATRQLLSDVFGYVKPGKMTALMGESGAGKT 888

Query: 967  TLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLR 1026
            TLL+ LA+R  MG+ITGD+ V+ +    SF RS GY  Q D H+   +VRESLRF+A LR
Sbjct: 889  TLLNVLAQRINMGVITGDMLVNSQSLPASFNRSCGYVAQADNHMAELSVRESLRFAAELR 948

Query: 1027 QADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLV 1086
            Q   V +EEK +YVE++I +L M+ YA+A+VG  G GLNVEQRK+L+IGVEL AKP LL+
Sbjct: 949  QPRSVPLEEKYEYVEKIIALLGMQNYAEALVGKTGRGLNVEQRKKLSIGVELVAKPSLLL 1008

Query: 1087 FLDEPTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVY 1146
            FLDEPTSGLDSQ+AWS  Q M+ LA  GQ+ILCTIHQPSA L ++FDRLL L++GG+ VY
Sbjct: 1009 FLDEPTSGLDSQSAWSIVQFMRALADSGQSILCTIHQPSATLFEQFDRLLLLKKGGKMVY 1068

Query: 1147 FGELGKGCKTMINYFEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYR 1206
            FG++G+   T++NYFE     KC    NPAE++L  +GA     AS D+  +W+ S E  
Sbjct: 1069 FGDIGENSSTLLNYFERQSGVKCGISENPAEYILNCIGAGATASASADWHDLWQQSPECA 1128

Query: 1207 EMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFS 1266
              + ELD + + L  R      E   +FA S   Q+K V  R   Q+WR+P Y+ +KF  
Sbjct: 1129 AARAELDELHKNLLSRPVTEDPELVTKFAASYTTQMKCVLRRTMIQFWRSPVYIRAKFLE 1188

Query: 1267 TIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERP 1326
             +   LF+G ++   N S+ G      +IFM  ++   ++ Q        RELYE RE  
Sbjct: 1189 CVSCALFVGLSYIAVNHSVGGATEAFSSIFMLLLIALAMINQLHVFAYDSRELYEVREAA 1248

Query: 1327 SRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFAC 1386
            S TF W   ++   +VE  W+ L   + F  YY+P G+   AS+A      G  F+ +  
Sbjct: 1249 SNTFHWSVLLLCHYVVETGWSTLCQFMCFICYYWPAGYSGRASHA------GFFFFFYVL 1302

Query: 1387 AFYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWI-FMYRVSP 1445
             F +Y  S G+ ++       +A+ + S  F   L FCG+L     +P FW   MY VSP
Sbjct: 1303 IFPMYFVSYGLWILYMSPDVPSASMINSNLFAAMLLFCGILQPKEKMPGFWRGLMYNVSP 1362

Query: 1446 LTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETE 1505
             TY++ AL+   + +  VVC+ NE   + PP+G TC EY+  Y+    +GYL++  + + 
Sbjct: 1363 FTYVVQALVGPLVHDKKVVCNKNEFAIMDPPAGQTCGEYLRTYI-GNNSGYLVNPQATSN 1421

Query: 1506 CHFCQFSSTNDYLATVSSSYSRRWMNYG 1533
            C++C +S  ++ +A  +  +S RW N+G
Sbjct: 1422 CNYCPYSVQDEVVARFNVKWSYRWRNFG 1449

>Kwal_26.6710
          Length = 740

 Score =  902 bits (2332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/781 (54%), Positives = 549/781 (70%), Gaps = 45/781 (5%)

Query: 20  DGPPNETQPYEGLDAAAQEEIKELARXXXXXXXXXXXEKRITGTGDPNTLTXXXXXXXXX 79
           D   +  + Y GLD  A E ++ELAR               T   +  T           
Sbjct: 3   DSVASSQEAYTGLDGNALEHVRELART-------------FTNVSEQTT----------- 38

Query: 80  XXXXXDIKGVNPILLDVNDPDYDETLDPRSENFSSVRWVRNMAQICENDSDFYKPFSLGC 139
                   G+NP+  +     YD  LDP SE+FSS  WVRN++++ ++D D YKP+SLGC
Sbjct: 39  -------PGLNPVFTNTQSASYDPELDPNSESFSSAAWVRNLSKVVDSDPDHYKPYSLGC 91

Query: 140 AWKDLSASGDSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILKPM 199
           AW +L A GDS D+ YQ T  N+P+K+ +           +R   K+   DS F ILKPM
Sbjct: 92  AWTNLRAYGDSTDVAYQSTVANLPLKFAE---------FVYRKARKARPADS-FDILKPM 141

Query: 200 DGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEV 259
           DG +NPGELLVVLGRPG+GC+TLLKSIS NTHGF I  ++ ++Y+G + KEI  H+RGEV
Sbjct: 142 DGLVNPGELLVVLGRPGSGCSTLLKSISSNTHGFHIGEESTVSYDGLTPKEISKHFRGEV 201

Query: 260 VYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADT 319
           VYNAE+DIH PHLTVFQTL T+A L TP NRI GVDR+TFAKH+TEV MATYGL HT +T
Sbjct: 202 VYNAEADIHFPHLTVFQTLNTIALLSTPANRIPGVDRETFAKHVTEVNMATYGLLHTRNT 261

Query: 320 KVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITK 379
           KVGN+ VRGVSGGERKRVSIAEV+ICGSKFQCWDNATRGLDSATALEF++AL+T   +T 
Sbjct: 262 KVGNELVRGVSGGERKRVSIAEVAICGSKFQCWDNATRGLDSATALEFVRALRTNNKMTD 321

Query: 380 SAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADYLT 439
           S+  VAIYQCS+DAY+LFDKVCVL++GYQI+FGP  +AK+YF++MGYVCP RQTTAD+LT
Sbjct: 322 SSGAVAIYQCSQDAYELFDKVCVLHEGYQIYFGPVDEAKEYFEQMGYVCPSRQTTADFLT 381

Query: 440 SITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHLDTDSSQQREQI 499
           ++TSPSERI +++       +P TA EM +YW  SE YK+L+ ++  +   D +++R Q+
Sbjct: 382 AVTSPSERIVNENFTN----VPSTAVEMEKYWKNSENYKRLRAEIEAYNAQDFNEKRNQL 437

Query: 500 KNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGS 559
           + AH AKQS  AR SSPYTVS+ +QVKY+L R+  RI+N+     F ++ + A+A ILGS
Sbjct: 438 EEAHTAKQSNGARASSPYTVSYGMQVKYLLQRNFMRIRNNIGFTAFQIIGNGAIAFILGS 497

Query: 560 MFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSAD 619
           MFY+V+   TT+ FY R                 EI +LYE RPI+EKHK YSLY PSAD
Sbjct: 498 MFYKVLKHDTTSGFYSRAGALFFAVLFNAFSCMLEILALYEARPISEKHKRYSLYHPSAD 557

Query: 620 AFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSV 679
           A AS  S++P K+ T++ FNI  YFL N KR+AGAFFFY L+ +I    MSH+FRC+GS 
Sbjct: 558 ALASIISEIPAKIITSIVFNIALYFLCNFKREAGAFFFYLLMTMIATLFMSHIFRCLGSA 617

Query: 680 SKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFHGRN 739
           +KT  +AMVPASV+LLA ++YTGFAIP+ ++LGW+KWI YINPLSY+FESLM+NEFHGR 
Sbjct: 618 TKTFAEAMVPASVILLAMSIYTGFAIPKTKILGWAKWIWYINPLSYVFESLMVNEFHGRR 677

Query: 740 FPCAQYIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSVGIGL 799
           F C+ ++P+GP Y   +G E  CSA+G+  G ++V+G+ +I   YGY H +KWR  GIGL
Sbjct: 678 FACSNFVPNGPGYNGISGVERVCSAVGAEAGADFVNGEKYINVAYGYYHAHKWRGFGIGL 737

Query: 800 A 800
            
Sbjct: 738 G 738

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 134/581 (23%), Positives = 245/581 (42%), Gaps = 89/581 (15%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGD---VFVDG-RPRDQS- 995
            IL  +DG V PG L  ++G  G+G +TLL  ++   T G   G+   V  DG  P++ S 
Sbjct: 137  ILKPMDGLVNPGELLVVLGRPGSGCSTLLKSISS-NTHGFHIGEESTVSYDGLTPKEISK 195

Query: 996  -FPRSIGYCQQQDLHLKTATVRESLRFSAYLRQ-ADDVSIEEKDKYVEEVIEV------- 1046
             F   + Y  + D+H    TV ++L   A L   A+ +   +++ + + V EV       
Sbjct: 196  HFRGEVVYNAEADIHFPHLTVFQTLNTIALLSTPANRIPGVDRETFAKHVTEVNMATYGL 255

Query: 1047 ---LEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWST 1103
                  K+  + + GV G      +RKR++I  E+A         D  T GLDS TA   
Sbjct: 256  LHTRNTKVGNELVRGVSG-----GERKRVSIA-EVAICGSKFQCWDNATRGLDSATALEF 309

Query: 1104 CQLMK---KLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINY 1160
             + ++   K+     A+   I+Q S    + FD++  L EG Q +YFG + +  +    Y
Sbjct: 310  VRALRTNNKMTDSSGAV--AIYQCSQDAYELFDKVCVLHEGYQ-IYFGPVDEAKE----Y 362

Query: 1161 FEAHGAHKCPPDANPAEWMLEIVGAA-----------PGTHASQDYFAIWRDSEEYREMQ 1209
            FE  G + CP     A+++  +   +           P T    + +  W++SE Y+ ++
Sbjct: 363  FEQMG-YVCPSRQTTADFLTAVTSPSERIVNENFTNVPSTAVEMEKY--WKNSENYKRLR 419

Query: 1210 KEL------DWMER-----ELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPF 1258
             E+      D+ E+     E     + +       +  S   Q+K +  R F +      
Sbjct: 420  AEIEAYNAQDFNEKRNQLEEAHTAKQSNGARASSPYTVSYGMQVKYLLQRNFMRIRNNIG 479

Query: 1259 YLWSKFFSTIVSELFIGFTFFKA--NTSLQGLQNQMLAIFMFTVVFNPI--LQQYLPLFV 1314
            +   +          +G  F+K   + +  G  ++  A+F F V+FN    + + L L+ 
Sbjct: 480  FTAFQIIGNGAIAFILGSMFYKVLKHDTTSGFYSRAGALF-FAVLFNAFSCMLEILALY- 537

Query: 1315 QQRELYEARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQL 1374
            + R + E  +R S  +   A  ++ I+ EIP  ++   +     Y+   F R        
Sbjct: 538  EARPISEKHKRYS-LYHPSADALASIISEIPAKIITSIVFNIALYFLCNFKR-------- 588

Query: 1375 HERGALFWLFACAFYVYISSMGVLVIS----CIEIAENA---ANLASLFFIMSLSFCGVL 1427
             E GA F      FY+ ++ +  L +S    C+  A      A + +   ++++S     
Sbjct: 589  -EAGAFF------FYLLMTMIATLFMSHIFRCLGSATKTFAEAMVPASVILLAMSIYTGF 641

Query: 1428 ATPNILPRFWI-FMYRVSPLTYLIDALLSVGLANASVVCSS 1467
            A P      W  +++ ++PL+Y+ ++L+          CS+
Sbjct: 642  AIPKTKILGWAKWIWYINPLSYVFESLMVNEFHGRRFACSN 682

>YPL058C (PDR12) [5383] chr16 complement(445837..450372) Protein
            required for weak organic acid resistance, member of the
            ATP-binding cassette (ABC) superfamily of membrane
            transporters [4536 bp, 1511 aa]
          Length = 1511

 Score =  927 bits (2395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/1409 (36%), Positives = 773/1409 (54%), Gaps = 78/1409 (5%)

Query: 133  KPFSLGCAWKDLSASGDSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSG 192
            +P   G A+K+L+A G  A   Y  +   M        +R I+    H     ++ +D  
Sbjct: 108  EPGDSGIAFKNLTAVGVDASAAYGPSVEEM--------FRNIASIPAHLISKFTKKSDVP 159

Query: 193  FQ-ILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEI 251
             + I++   G +  GE+L V+GRPGAGC+T LK +S  T    +      +Y+G    E+
Sbjct: 160  LRNIIQNCTGVVESGEMLFVVGRPGAGCSTFLKCLSGETSEL-VDVQGEFSYDGLDQSEM 218

Query: 252  KNHYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATY 311
             + Y+G V+Y  E D H P +TV +T+    + KTPR RI  + R  +  ++ ++    +
Sbjct: 219  MSKYKGYVIYCPELDFHFPKITVKETIDFALKCKTPRVRIDKMTRKQYVDNIRDMWCTVF 278

Query: 312  GLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKAL 371
            GL HT  TKVGNDFVRGVSGGERKRVS+ E     +    WDNATRGLD++TALEF +A+
Sbjct: 279  GLRHTYATKVGNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAI 338

Query: 372  KTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPER 431
            +T   +  ++A VAIYQ  ++ Y+LFDK  VLY+G QI+FGP+ +A  YFQRMG+V P R
Sbjct: 339  RTATNMVNNSAIVAIYQAGENIYELFDKTTVLYNGRQIYFGPADKAVGYFQRMGWVKPNR 398

Query: 432  QTTADYLTSITSPSE-RIKDKDMVKHGI--MIPQTAYEMNQYWIQSEEYKQLQVQVNKHL 488
             T+A++LTS+T   E R  D   +K G    +P+++ E  +YW+ SE+Y++L    + + 
Sbjct: 399  MTSAEFLTSVTVDFENRTLD---IKPGYEDKVPKSSSEFEEYWLNSEDYQELLRTYDDYQ 455

Query: 489  DTDS-SQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTV 547
                 ++ R+++  A   +  +  R +S Y V+++ QV Y +IR   R+K D +     +
Sbjct: 456  SRHPVNETRDRLDVAKKQRLQQGQRENSQYVVNYWTQVYYCMIRGFQRVKGDSTYTKVYL 515

Query: 548  LSHAAMALILGSMFYEV--MLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPIT 605
             S    ALI+GSMF+++     +TT   Y RG                EI + + +RP+ 
Sbjct: 516  SSFLIKALIIGSMFHKIDDKSQSTTAGAYSRGGMLFYVLLFASVTSLAEIGNSFSSRPVI 575

Query: 606  EKHKTYSLYRPSADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIIT 665
             KHK+YS+Y  SA++     ++ PTK    V   +  Y++  +K +AGAFF Y L  +  
Sbjct: 576  VKHKSYSMYHLSAESLQEIITEFPTKFVAIVILCLITYWIPFMKYEAGAFFQYILYLLTV 635

Query: 666  VFAMSHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSY 725
                S +F+ + ++SK+   A     + +L   +Y GF +P  +M  W +W+ +INPL+Y
Sbjct: 636  QQCTSFIFKFVATMSKSGVDAHAVGGLWVLMLCVYAGFVLPIGEMHHWIRWLHFINPLTY 695

Query: 726  LFESLMINEFHGRNFPCAQYIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYG 785
             FESL+  EFH R   C+  +PSGP Y   +     C A G++ GN YVSGD +I   Y 
Sbjct: 696  AFESLVSTEFHHREMLCSALVPSGPGYEGISIANQVCDAAGAVKGNLYVSGDSYILHQYH 755

Query: 786  YRHKNKWRSVGIGLAXXXXXXXXXXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXX 845
            + +K+ WR+ G+ +              EY +  +  G++L++                 
Sbjct: 756  FAYKHAWRNWGVNIVWTFGYIVFNVILSEYLKPVEGGGDLLLYKRG-------------- 801

Query: 846  XXXNQPTLSTSDAEKDVEMNNNSSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXX 905
               + P L T +A+         +A+    +   +   +  +K +A++            
Sbjct: 802  ---HMPELGTENADA-------RTASREEMMEALNGPNVDLEKVIAEKD----------- 840

Query: 906  XXXXXXDDIELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGK 965
                            +F W +L Y IP     R++L +V G+VKPG +TAL+G SGAGK
Sbjct: 841  ----------------VFTWNHLDYTIPYDGATRKLLSDVFGYVKPGKMTALMGESGAGK 884

Query: 966  TTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYL 1025
            TTLL+ LA+R  MG+ITGD+ V+ +P   SF RS GY  Q D H+   +VRESLRF+A L
Sbjct: 885  TTLLNVLAQRINMGVITGDMLVNAKPLPASFNRSCGYVAQADNHMAELSVRESLRFAAEL 944

Query: 1026 RQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLL 1085
            RQ   V +EEK +YVE++I +L M+ YA+A+VG  G GLNVEQRK+L+IGVEL AKP LL
Sbjct: 945  RQQSSVPLEEKYEYVEKIITLLGMQNYAEALVGKTGRGLNVEQRKKLSIGVELVAKPSLL 1004

Query: 1086 VFLDEPTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTV 1145
            +FLDEPTSGLDSQ+AWS  Q M+ LA  GQ+ILCTIHQPSA L ++FDRLL L++GG+ V
Sbjct: 1005 LFLDEPTSGLDSQSAWSIVQFMRALADSGQSILCTIHQPSATLFEQFDRLLLLKKGGKMV 1064

Query: 1146 YFGELGKGCKTMINYFEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEY 1205
            YFG++G   +T++ YFE     KC    NPAE++L  +GA      + D+  +W  S E 
Sbjct: 1065 YFGDIGPNSETLLKYFERQSGMKCGVSENPAEYILNCIGAGATASVNSDWHDLWLASPEC 1124

Query: 1206 REMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFF 1265
               + E++ + R LP R      E    FA S + QIK V  R   Q+WR+P Y+ +KFF
Sbjct: 1125 AAARAEVEELHRTLPGRAVNDDPELATRFAASYMTQIKCVLRRTALQFWRSPVYIRAKFF 1184

Query: 1266 STIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARER 1325
              +   LF+G ++   N S+ G      +IFM  ++   ++ Q        RELYE RE 
Sbjct: 1185 ECVACALFVGLSYVGVNHSVGGAIEAFSSIFMLLLIALAMINQLHVFAYDSRELYEVREA 1244

Query: 1326 PSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFA 1385
             S TF W   ++    VE  W+ L   + F  YY+P  F   AS+A      G  F+ + 
Sbjct: 1245 ASNTFHWSVLLLCHAAVENFWSTLCQFMCFICYYWPAQFSGRASHA------GFFFFFYV 1298

Query: 1386 CAFYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFW-IFMYRVS 1444
              F +Y  + G+ ++       +A+ + S  F   L FCG+L     +P FW   MY VS
Sbjct: 1299 LIFPLYFVTYGLWILYMSPDVPSASMINSNLFAAMLLFCGILQPREKMPAFWRRLMYNVS 1358

Query: 1445 PLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSET 1504
            P TY++ AL++  + N  VVC+ +E   + PPSG TC E++  YM +  TGYL++ ++  
Sbjct: 1359 PFTYVVQALVTPLVHNKKVVCNPHEYNIMDPPSGKTCGEFLSTYMDNN-TGYLVNPTATE 1417

Query: 1505 ECHFCQFSSTNDYLATVSSSYSRRWMNYG 1533
             C +C ++  +  +A  +  +  RW N+G
Sbjct: 1418 NCQYCPYTVQDQVVAKYNVKWDHRWRNFG 1446

>Kwal_26.6702
          Length = 617

 Score =  888 bits (2295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/578 (71%), Positives = 478/578 (82%), Gaps = 1/578 (0%)

Query: 958  IGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRE 1017
            + ASGAGKTTLLDCLA R TMG ITGD+F++G  RD SF RSIGYCQQQDLHL+TATVRE
Sbjct: 1    MSASGAGKTTLLDCLASRVTMGTITGDMFINGFLRDDSFARSIGYCQQQDLHLETATVRE 60

Query: 1018 SLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVE 1077
            SLRFSAYLRQ   VSI EK+KYV+EVI++LEM+ YADA+VGV GEGLNVEQRKRLTIGVE
Sbjct: 61   SLRFSAYLRQPASVSIAEKNKYVDEVIKILEMQKYADAVVGVAGEGLNVEQRKRLTIGVE 120

Query: 1078 LAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLF 1137
            LAAKPKLL+FLDEPTSGLDSQTAWS CQLM++LA+ GQAILCTIHQPSALLMQEFDRLLF
Sbjct: 121  LAAKPKLLLFLDEPTSGLDSQTAWSICQLMRRLANHGQAILCTIHQPSALLMQEFDRLLF 180

Query: 1138 LQEGGQTVYFGELGKGCKTMINYFEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFA 1197
            LQ GG+T YFGELG+GC+ MI+YFE HGAH CP  ANPAEWMLE++GAAPG+HA+QDY  
Sbjct: 181  LQRGGRTAYFGELGEGCQKMIDYFEKHGAHPCPQGANPAEWMLEVIGAAPGSHANQDYNE 240

Query: 1198 IWRDSEEYREMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTP 1257
            +WR+SEEY+ +Q+EL+WMERELPK+   +S EE  EF+TS  YQ  LV+ RL  QYWRTP
Sbjct: 241  VWRNSEEYKAVQEELEWMERELPKKPIDTS-EEHSEFSTSLPYQYMLVTKRLMQQYWRTP 299

Query: 1258 FYLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQR 1317
             YLWSK   T++S++FIGFTFFKA++SLQGLQNQML++FMFT+VFNP LQQYLP F+ QR
Sbjct: 300  SYLWSKLILTVISQIFIGFTFFKADSSLQGLQNQMLSVFMFTIVFNPSLQQYLPTFISQR 359

Query: 1318 ELYEARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHER 1377
            +LYEARERPSRTFSW AFI+SQI VEIPWN L GTI FF+YYYPV FYRNAS+A QL ER
Sbjct: 360  DLYEARERPSRTFSWVAFILSQITVEIPWNFLVGTIGFFLYYYPVSFYRNASFAGQLSER 419

Query: 1378 GALFWLFACAFYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFW 1437
            GALFWL   AFYV+  SM  L ++  E+A+ A NLASL F MSLSFCGV+ TP  +P FW
Sbjct: 420  GALFWLLCTAFYVFTGSMAQLCVAGFELADTAGNLASLLFTMSLSFCGVMVTPKNMPGFW 479

Query: 1438 IFMYRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYL 1497
            IFMYRVSPLTY ID  +S GLANA   CS  E++   PPSG TC +YM PY++S GTGYL
Sbjct: 480  IFMYRVSPLTYFIDGAMSTGLANAEARCSGYEMVSFQPPSGQTCGQYMSPYIKSVGTGYL 539

Query: 1498 LDGSSETECHFCQFSSTNDYLATVSSSYSRRWMNYGIF 1535
             +  +   C FC  SSTND+L +VSSSYS RW NYGIF
Sbjct: 540  SNPGATENCSFCTVSSTNDFLKSVSSSYSTRWRNYGIF 577

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 139/633 (21%), Positives = 244/633 (38%), Gaps = 108/633 (17%)

Query: 216 GAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAESDIHIPHLTVF 275
           GAG TTLL  ++       I+ D  I  NGF   +    +   + Y  + D+H+   TV 
Sbjct: 5   GAGKTTLLDCLASRVTMGTITGDMFI--NGFLRDD---SFARSIGYCQQQDLHLETATVR 59

Query: 276 QTLYTVARLKTPRNRIKGVDRDTFAKHMTEV-AMATYGLSHTADTKVGNDFVRGVSGGER 334
           ++L   A L+ P + +   +++ +   + ++  M  Y     AD  VG     G++  +R
Sbjct: 60  ESLRFSAYLRQPAS-VSIAEKNKYVDEVIKILEMQKY-----ADAVVGVA-GEGLNVEQR 112

Query: 335 KRVSIA-EVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATVAIYQCSKDA 393
           KR++I  E++         D  T GLDS TA    + ++  A   + A    I+Q S   
Sbjct: 113 KRLTIGVELAAKPKLLLFLDEPTSGLDSQTAWSICQLMRRLANHGQ-AILCTIHQPSALL 171

Query: 394 YDLFDKVCVLYDGYQI-FFGP----SKQAKKYFQRMG-YVCPERQTTADYLTSI--TSPS 445
              FD++  L  G +  +FG      ++   YF++ G + CP+    A+++  +   +P 
Sbjct: 172 MQEFDRLLFLQRGGRTAYFGELGEGCQKMIDYFEKHGAHPCPQGANPAEWMLEVIGAAPG 231

Query: 446 ERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHLDTDSSQQREQIKNA-HI 504
                               + N+ W  SEEYK +Q ++          +RE  K     
Sbjct: 232 SHANQ---------------DYNEVWRNSEEYKAVQEELEW-------MERELPKKPIDT 269

Query: 505 AKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDP-SIQLFTVLSHAAMALILGSMFYE 563
           +++      S PY    ++ V   L++  WR  +   S  + TV+S     + +G  F++
Sbjct: 270 SEEHSEFSTSLPYQ---YMLVTKRLMQQYWRTPSYLWSKLILTVISQ----IFIGFTFFK 322

Query: 564 VMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFAS 623
              S        +G                     Y    I+++    +  RPS      
Sbjct: 323 ADSSL-------QGLQNQMLSVFMFTIVFNPSLQQYLPTFISQRDLYEARERPS-----R 370

Query: 624 TFSDVPTKLATAVTFNIP------------YYFLINLKRDA---------GAFFFYFLIN 662
           TFS V   L + +T  IP            YY+ ++  R+A         GA  F+ L  
Sbjct: 371 TFSWVAFIL-SQITVEIPWNFLVGTIGFFLYYYPVSFYRNASFAGQLSERGA-LFWLLCT 428

Query: 663 IITVFAMSHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINP 722
              VF  S    C+    +    A   AS+L      + G  +    M G+  ++  ++P
Sbjct: 429 AFYVFTGSMAQLCVAGF-ELADTAGNLASLLFTMSLSFCGVMVTPKNMPGFWIFMYRVSP 487

Query: 723 LSYLFESLMINEFHGRNFPCAQY------IPSGPN-------YVNATGDEVTCSALGSIP 769
           L+Y  +  M          C+ Y       PSG         Y+ + G     S  G+  
Sbjct: 488 LTYFIDGAMSTGLANAEARCSGYEMVSFQPPSGQTCGQYMSPYIKSVGTGYL-SNPGATE 546

Query: 770 GNNYV---SGDDFIQTNYGYRHKNKWRSVGIGL 799
             ++    S +DF+++     +  +WR+ GI L
Sbjct: 547 NCSFCTVSSTNDFLKS-VSSSYSTRWRNYGIFL 578

>Scas_632.29
          Length = 861

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/550 (60%), Positives = 409/550 (74%), Gaps = 17/550 (3%)

Query: 27  QPYEGLDAAAQEEIKELARXXXXXXXXXXXEKRITGTGDPNTLTXXXXXXXXXXXXXXDI 86
            PY G D   Q+++++LAR           E  +        ++               +
Sbjct: 319 HPYMGFDDTVQDQVRDLARSLTQLSSIHQSESNVD-------VSSSHLGSDSQSIYSTGL 371

Query: 87  KGVNPILLDVNDPDYDETLDPRSENFSSVRWVRNMAQICENDSDFYKPFSLGCAWKDLSA 146
            G+NP+    + P Y+E LDP S+NFSS  WV+NMA I ++D DFYKP+SLGC WK+LSA
Sbjct: 372 PGINPVYTSPDTPGYNEKLDPTSDNFSSTAWVKNMANIAKSDPDFYKPYSLGCVWKNLSA 431

Query: 147 SGDSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILKPMDGCINPG 206
           SGDSAD++YQ    NMP       W+ I+   F+R      + D+ FQILKPMDG +N G
Sbjct: 432 SGDSADVSYQSDVINMP-------WKIIT--FFYRMVAPRREGDT-FQILKPMDGILNAG 481

Query: 207 ELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAESD 266
           ELLVVLGRPG+GCTTLLKSIS NTHGF++S D+ I+Y+G S K+I+ HYRGEVVYNAESD
Sbjct: 482 ELLVVLGRPGSGCTTLLKSISSNTHGFEVSKDSTISYSGLSPKDIRKHYRGEVVYNAESD 541

Query: 267 IHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGNDFV 326
           IH+PHLTV+QTL TVARLKTP NRIK V R+ +A H+TEV MATYGLSHT +TKVGND V
Sbjct: 542 IHLPHLTVYQTLLTVARLKTPSNRIKDVTREDYANHVTEVTMATYGLSHTRNTKVGNDLV 601

Query: 327 RGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATVAI 386
           RGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFI+ALKTQATI  S ATVAI
Sbjct: 602 RGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIRALKTQATIADSTATVAI 661

Query: 387 YQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADYLTSITSPSE 446
           YQCS+DAYDLFDKVCVL DGYQI++GP+ + +KYF+ MGYVCP RQTTAD+LTS+TSP+E
Sbjct: 662 YQCSQDAYDLFDKVCVLDDGYQIYYGPTTEGRKYFEDMGYVCPPRQTTADFLTSVTSPAE 721

Query: 447 RIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHLDTDSSQQREQIKNAHIAK 506
           RI ++DM+K G  IPQT  EM +YW+ S +Y++L  Q++  L+ +  +QR  I+ AHIAK
Sbjct: 722 RILNEDMLKAGKKIPQTPKEMGEYWLHSPDYQRLMQQIDAELNLNQDEQRNVIREAHIAK 781

Query: 507 QSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYEVML 566
           QSKRARPSSPY VS+ +QVKY+LIR+ WRIK   S+ LF V  ++ MA ILGSMFY+V  
Sbjct: 782 QSKRARPSSPYVVSYMMQVKYLLIRNYWRIKQSASVTLFQVFGNSIMAFILGSMFYKVQK 841

Query: 567 STTTTTFYYR 576
              ++TFY+R
Sbjct: 842 KGDSSTFYFR 851

 Score =  360 bits (925), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 161/235 (68%), Positives = 193/235 (82%)

Query: 1301 VFNPILQQYLPLFVQQRELYEARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYY 1360
            +FNP+LQQYLP FV+QR+LYEARERPSRTFSW AFI+SQI+VEIPWN +AGTIA+ +YYY
Sbjct: 1    LFNPLLQQYLPSFVEQRDLYEARERPSRTFSWIAFILSQIVVEIPWNFVAGTIAYCIYYY 60

Query: 1361 PVGFYRNASYANQLHERGALFWLFACAFYVYISSMGVLVISCIEIAENAANLASLFFIMS 1420
             +GFY NAS A QLHERGAL+WL + AF+VY+ SMG+  IS IE+AE AA++ASL F ++
Sbjct: 61   AIGFYMNASAAGQLHERGALYWLLSTAFFVYVGSMGIAAISFIEVAETAAHMASLMFTLA 120

Query: 1421 LSFCGVLATPNILPRFWIFMYRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMT 1480
            LSFCGV+ATP+ +PRFWIFMYRVSPLTYLIDA LSVG+AN  V CSS E ++  PP GM 
Sbjct: 121  LSFCGVMATPSAMPRFWIFMYRVSPLTYLIDAFLSVGVANVDVQCSSYEFVEFTPPPGMN 180

Query: 1481 CSEYMEPYMQSTGTGYLLDGSSETECHFCQFSSTNDYLATVSSSYSRRWMNYGIF 1535
            C  YM PY++  GTGYL D S+   CHFCQ+S TND+L TVSS YSRRW N+GIF
Sbjct: 181  CGTYMAPYIKMAGTGYLSDPSATDACHFCQYSYTNDFLKTVSSEYSRRWRNWGIF 235

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 93/386 (24%), Positives = 160/386 (41%), Gaps = 61/386 (15%)

Query: 940  RILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDG---RPRD--Q 994
            +IL  +DG +  G L  ++G  G+G TTLL  ++  T    ++ D  +      P+D  +
Sbjct: 469  QILKPMDGILNAGELLVVLGRPGSGCTTLLKSISSNTHGFEVSKDSTISYSGLSPKDIRK 528

Query: 995  SFPRSIGYCQQQDLHLKTATVRESLRFSAYLR----QADDVSIEEKDKYVEEVI------ 1044
             +   + Y  + D+HL   TV ++L   A L+    +  DV+ E+   +V EV       
Sbjct: 529  HYRGEVVYNAESDIHLPHLTVYQTLLTVARLKTPSNRIKDVTREDYANHVTEVTMATYGL 588

Query: 1045 -EVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWST 1103
                  K+  D + GV G      +RKR++I  E++         D  T GLDS TA   
Sbjct: 589  SHTRNTKVGNDLVRGVSG-----GERKRVSIA-EVSICGSKFQCWDNATRGLDSATALEF 642

Query: 1104 CQLMKKLASRGQAI-LCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFE 1162
             + +K  A+   +     I+Q S      FD++  L +G Q +Y+G   +G K    YFE
Sbjct: 643  IRALKTQATIADSTATVAIYQCSQDAYDLFDKVCVLDDGYQ-IYYGPTTEGRK----YFE 697

Query: 1163 AHGAHKCPPDANPAEWMLEIVGAAPGT-------------HASQDYFAIWRDSEEYREMQ 1209
              G + CPP    A+++  +   A                   ++    W  S +Y+ + 
Sbjct: 698  DMG-YVCPPRQTTADFLTSVTSPAERILNEDMLKAGKKIPQTPKEMGEYWLHSPDYQRLM 756

Query: 1210 KELDW-----------MERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWR--- 1255
            +++D            + RE     +         +  S + Q+K   Y L   YWR   
Sbjct: 757  QQIDAELNLNQDEQRNVIREAHIAKQSKRARPSSPYVVSYMMQVK---YLLIRNYWRIKQ 813

Query: 1256 -TPFYLWSKFFSTIVSELFIGFTFFK 1280
                 L+  F ++I++   +G  F+K
Sbjct: 814  SASVTLFQVFGNSIMA-FILGSMFYK 838

>Kwal_27.12821
          Length = 466

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/429 (67%), Positives = 343/429 (79%)

Query: 1107 MKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGA 1166
            M++LA+ GQAILCTIHQPSALLMQEFDRLLFLQ GG+TVYFG LG+GC+TMI+YFE HG+
Sbjct: 1    MRRLANHGQAILCTIHQPSALLMQEFDRLLFLQRGGRTVYFGGLGEGCQTMIDYFEKHGS 60

Query: 1167 HKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKELDWMERELPKRTEGS 1226
            H CPP ANPAEWMLE++GAAPG+HA QDY  +WR S EY+ +Q+ELDWME+EL K+   +
Sbjct: 61   HPCPPGANPAEWMLEVIGAAPGSHAEQDYHEVWRSSAEYKAVQEELDWMEKELSKKPVDN 120

Query: 1227 SNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQ 1286
            S+ E +EF+TS LYQ KLV+ RL  QYWRTP YLWSKF  T++S+LFIGFTFFKA++S+Q
Sbjct: 121  SDVEHREFSTSILYQYKLVTMRLLQQYWRTPSYLWSKFILTVISQLFIGFTFFKADSSMQ 180

Query: 1287 GLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSRTFSWKAFIVSQILVEIPW 1346
            GLQNQML+IFMFTVVFNP LQQYLP FV QR+LYEARERPSRTFSW AFI+SQI VEIPW
Sbjct: 181  GLQNQMLSIFMFTVVFNPSLQQYLPTFVAQRDLYEARERPSRTFSWVAFILSQITVEIPW 240

Query: 1347 NLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACAFYVYISSMGVLVISCIEIA 1406
            N+  GT+ FF+YYYPV FYRNAS+A QL ERGALFWLF  AFYV+  SM    ++  E+A
Sbjct: 241  NIFIGTVGFFLYYYPVSFYRNASFAGQLAERGALFWLFCTAFYVFTGSMAQFCVAGAEVA 300

Query: 1407 ENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDALLSVGLANASVVCS 1466
            ++A   ASL F MSLSFCGV+ TP  +P+FW+FMYRVSPLTY ID  L+ GLANA   CS
Sbjct: 301  DSAGQTASLLFTMSLSFCGVMVTPQNMPKFWMFMYRVSPLTYFIDGALATGLANAEARCS 360

Query: 1467 SNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECHFCQFSSTNDYLATVSSSYS 1526
              E++   P SG TC EYM  Y++STGTGYL D  +   C FC  S+TN YLA VSS YS
Sbjct: 361  GYEMVSFKPASGKTCGEYMSSYIKSTGTGYLSDPGATDNCSFCPVSTTNAYLAAVSSKYS 420

Query: 1527 RRWMNYGIF 1535
             RW NYGIF
Sbjct: 421  LRWRNYGIF 429

>Scas_717.6*
          Length = 1400

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/1359 (31%), Positives = 657/1359 (48%), Gaps = 116/1359 (8%)

Query: 207  ELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAESD 266
            E+++VLG P    + L +++       K  P+  I +     K        E++YN E D
Sbjct: 66   EVVLVLGAP---TSELFQALFHGHKSLKYKPEGSIRFKDNEFKAFFFKCPQEIIYNNEQD 122

Query: 267  IHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGNDFV 326
            IH P LTV QT+      K     I   +R+     M +  +  +GLSH  DT VGND+V
Sbjct: 123  IHFPFLTVRQTIDFALSCKF---HIPLEERN----QMRDELLNGFGLSHVVDTFVGNDYV 175

Query: 327  RGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATVAI 386
            RGVSGGERKR+SI E  I       WDN+T+GLDS+TALEF+  L+T A  T+S   V I
Sbjct: 176  RGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALEFLSILQTMARTTRSVNFVKI 235

Query: 387  YQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQ-RMGYVCPERQTTADYLTSI---- 441
             Q S    + FDK+ +L + YQ+F+G   +   YF+  +G          +YLTSI    
Sbjct: 236  SQASDKIVEKFDKILMLTESYQVFYGTVDECLVYFRDTLGIQKDPNDCIIEYLTSILNFQ 295

Query: 442  ------TSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEY---KQLQVQVNKHLDTDS 492
                   +P   ++ +  V+  I       ++  YWI+S  Y   K++     K + T  
Sbjct: 296  FINKDINNPLSPVQSQKSVRSSI--ANNEIDLYNYWIKSPYYANWKKITSDSIKDMPTRD 353

Query: 493  SQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAA 552
            S   + IK                +++   LQ+K   IR   RI  D +  +   +S   
Sbjct: 354  SVNPDDIKPI--------------FSIPLKLQLKACTIRAFERIIGDKNYIISQFVSVIV 399

Query: 553  MALILGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYS 612
             +L++GS+FYE+    TT   + RG                ++ S ++   +  KH    
Sbjct: 400  QSLVIGSLFYEI--PRTTIGSFSRGSLVFFSILFFTFLALADMPSNFQRNAVVTKHVQLH 457

Query: 613  LYRPSADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHL 672
             Y    +A AST  D   K    V F I  YFL +L+ +   FF + L      F M  L
Sbjct: 458  FYYGWVEALASTIYDYIFKFILVVIFTIILYFLAHLQYNGARFFIFLLFLSFYNFCMVSL 517

Query: 673  FRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMI 732
            F     +S T+  A + A ++LLA AMY  + I    M  W  WI+Y+NP  +  E+++ 
Sbjct: 518  FNWTALLSPTISFANLLAGIVLLAIAMYASYVIHLPDMHPWFVWIAYLNPAMFAMEAMLT 577

Query: 733  NEFHGRNFPCAQ-YIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNK 791
            NE    N  C +  IP GP+Y N T     C+  G+  GNNYV G D++++   YR+ + 
Sbjct: 578  NELFDINLDCTESIIPRGPSYDNITFAHKACAWQGATLGNNYVRGQDYLKSGLKYRYSHV 637

Query: 792  WRSVGIGLAXXXXXXXXXXXXCEYNEGAKQNGEMLVFPHSXXXXXXXXXXXXXXXXXNQP 851
            WR+ GI +              EY         +L++                       
Sbjct: 638  WRNFGIIIGFCCFNLVCSLLTAEYITPLYTRKNILLW---------------SSYIARYN 682

Query: 852  TLSTSDAEKDVEMN-----NNSSATDSRFLRDSDAAIMGNDKTVAKEHYXXXXXXXXXXX 906
             LS    E++ EM+     NN     S     S  A + +D ++                
Sbjct: 683  PLSRKKKEQEYEMDEYEKGNNKRPISSSSSSLSLGAGIADDDSIKAP------------I 730

Query: 907  XXXXXDDIELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKT 966
                     +   + +  W+N+ Y +    G ++++++  G++  G LTAL+G SGAGKT
Sbjct: 731  TSQYDKSATVQTQKHVISWRNINYTV---EGDKQLINDCSGFISSG-LTALMGESGAGKT 786

Query: 967  TLLDCLAERTTMGLITGDVFVDGRPRDQ--SFPRSIGYCQQQDLHLKTATVRESLRFSAY 1024
            TLL+ L++R T G +TG++ +DG+P     +F RSIG+ QQQD+HL   TV+ESL  S  
Sbjct: 787  TLLNVLSQRVTSGEVTGELLIDGQPLTNIAAFRRSIGFVQQQDVHLDLLTVKESLEISCI 846

Query: 1025 LRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKL 1084
            LR   D        Y+  V ++L  KL A+ +V      L   ++K L+IGVEL  KP L
Sbjct: 847  LRGDGD------RDYLGTVAKLL--KLPANTLVA----DLTPTEKKLLSIGVELVTKPSL 894

Query: 1085 LVFLDEPTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQT 1144
            L+FLDEPTSGLD++ A +  Q +KKL+ +GQAILCTIHQPS  +++ FD +  L+ GG+ 
Sbjct: 895  LLFLDEPTSGLDAEAALTIVQFLKKLSLQGQAILCTIHQPSKSVIKYFDNIYLLKRGGEC 954

Query: 1145 VYFGELGKGCKTMINYFEAHGAHKC--PPDANPAEWMLEIVGA----APGTHASQ---DY 1195
            VYFG +  GC    +YF  H  H        NPA++++++VG       G    +   ++
Sbjct: 955  VYFGHIDDGC----DYFLTHDEHLTYNKETENPADFVIDVVGGKQKDGDGVLIEKPKINW 1010

Query: 1196 FAIWRDSEEYREMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWR 1255
              +W +S E  ++ + LD +E E   R  G    +      S   Q+ ++  R +    R
Sbjct: 1011 TQLWDESPEREQIHQNLDTLEEE--ARHSGVDFVQFAWSQPSYWQQLIVILRRQYICTKR 1068

Query: 1256 TPFYLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQ 1315
               Y+ SKF     + LFIGF+F+K   ++ GLQN +   FM   + +P++ Q     + 
Sbjct: 1069 DTNYVLSKFLLNAGAGLFIGFSFWKTKKNISGLQNAIFLSFMNMCLSSPLINQIQDKALH 1128

Query: 1316 QRELYEARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLH 1375
             +++Y ARE  S T+ W   +++Q LVE+P  + + T+ F   Y+  GF       N  H
Sbjct: 1129 SKDVYVAREASSNTYHWTVLLLAQTLVELPLAISSSTLFFLCCYFCCGF------DNSPH 1182

Query: 1376 ERGALFWLFACAFYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPR 1435
              G +F+     F  Y  + G+ ++      + AA   +  +  + SFCGV+   ++   
Sbjct: 1183 IAG-VFYFNYILFSAYYLTFGLWLLYTAPDLQTAAVFVAFLYSFTASFCGVMQPYSLFVG 1241

Query: 1436 FWIFMYRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTG 1495
            FW FMYRVSP TY ID  +S+ L +  V CS  E++   P  G TC ++M P++   G G
Sbjct: 1242 FWKFMYRVSPYTYFIDTFVSLLLHDRPVQCSVGEMVPGQPLPGQTCGQFMAPFIADQG-G 1300

Query: 1496 YLLDGSSETECHFCQFSSTNDYLATVSSSYSRRWMNYGI 1534
            YL +  + T C +C ++  +D+LA  + SYS RW N+GI
Sbjct: 1301 YLHNPKTFTVCGYCTYTVGDDFLAVENMSYSNRWRNFGI 1339

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 140/637 (21%), Positives = 251/637 (39%), Gaps = 85/637 (13%)

Query: 194  QILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKN 253
            Q++    G I+ G L  ++G  GAG TTLL  +S      +++ + +I     +N     
Sbjct: 761  QLINDCSGFISSG-LTALMGESGAGKTTLLNVLSQRVTSGEVTGELLIDGQPLTNIA--- 816

Query: 254  HYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRD---TFAKHMTEVAMAT 310
             +R  + +  + D+H+  LTV ++L     L+         DRD   T AK +   A   
Sbjct: 817  AFRRSIGFVQQQDVHLDLLTVKESLEISCILRGDG------DRDYLGTVAKLLKLPA--- 867

Query: 311  YGLSHTADTKVGNDFVRGVSGGERKRVSIA-EVSICGSKFQCWDNATRGLDSATALEFIK 369
                        N  V  ++  E+K +SI  E+    S     D  T GLD+  AL  ++
Sbjct: 868  ------------NTLVADLTPTEKKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQ 915

Query: 370  ALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQ-IFFGPSKQAKKYF----QRM 424
             LK + ++   A    I+Q SK     FD + +L  G + ++FG       YF    + +
Sbjct: 916  FLK-KLSLQGQAILCTIHQPSKSVIKYFDNIYLLKRGGECVYFGHIDDGCDYFLTHDEHL 974

Query: 425  GYVCPERQTTADYLTSITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQV 484
             Y   E +  AD++  +    +  KD D    G++I +      Q W +S E +    Q+
Sbjct: 975  TY-NKETENPADFVIDVVGGKQ--KDGD----GVLIEKPKINWTQLWDESPERE----QI 1023

Query: 485  NKHLDTDSSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQL 544
            +++LDT   + R      H      +   S P   S++ Q+  IL R     K D +  L
Sbjct: 1024 HQNLDTLEEEAR------HSGVDFVQFAWSQP---SYWQQLIVILRRQYICTKRDTNYVL 1074

Query: 545  FTVLSHAAMALILGSMFYEVM--LSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETR 602
               L +A   L +G  F++    +S      +                      +L+   
Sbjct: 1075 SKFLLNAGAGLFIGFSFWKTKKNISGLQNAIFLSFMNMCLSSPLINQIQDK---ALHSKD 1131

Query: 603  PITEKHKTYSLYRPSADAFASTFSDVPTKLATAVTFNIPYYFLI---NLKRDAGAFFFYF 659
                +  + + Y  +    A T  ++P  ++++  F +  YF     N    AG F+F +
Sbjct: 1132 VYVAREASSNTYHWTVLLLAQTLVELPLAISSSTLFFLCCYFCCGFDNSPHIAGVFYFNY 1191

Query: 660  LI--NIITVFAMSHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWI 717
            ++       F +  L+      +  L  A V  + L    A + G   P    +G+ K++
Sbjct: 1192 ILFSAYYLTFGLWLLY-----TAPDLQTAAVFVAFLYSFTASFCGVMQPYSLFVGFWKFM 1246

Query: 718  SYINPLSYLFESLMINEFHGRNFPCA--QYIPSGP-----------NYVNATGDEVTCSA 764
              ++P +Y  ++ +    H R   C+  + +P  P            ++   G  +    
Sbjct: 1247 YRVSPYTYFIDTFVSLLLHDRPVQCSVGEMVPGQPLPGQTCGQFMAPFIADQGGYLHNPK 1306

Query: 765  LGSIPGN-NYVSGDDFIQTNYGYRHKNKWRSVGIGLA 800
              ++ G   Y  GDDF+       + N+WR+ GI  A
Sbjct: 1307 TFTVCGYCTYTVGDDFLAVE-NMSYSNRWRNFGIECA 1342

>Scas_716.82
          Length = 675

 Score =  553 bits (1424), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 279/627 (44%), Positives = 395/627 (62%), Gaps = 13/627 (2%)

Query: 912  DDIELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDC 971
            D  E  +S+ +  W+++CY IP   G+R +LD+V G+  PGT+TA++G SGAGKTTLL+ 
Sbjct: 17   DAFEKLESKGVXIWRDVCYTIPYDAGQRMLLDHVSGYCIPGTMTAVMGESGAGKTTLLNT 76

Query: 972  LAERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDV 1031
            LA+R  +G+ITGD+ ++GRP D SF R  GY QQQD+H+   TVRESL+FSA +R+A  +
Sbjct: 77   LAQRN-VGIITGDMLINGRPIDASFERRTGYVQQQDVHIAELTVRESLQFSARMRRAQAI 135

Query: 1032 SIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEP 1091
              EEK  YVE++I VL+M+ YA+A+VG  G GLNVEQRK+L+IGVEL AKP LL+FLDEP
Sbjct: 136  PDEEKMAYVEKIIHVLDMQEYAEALVGEIGRGLNVEQRKKLSIGVELVAKPDLLLFLDEP 195

Query: 1092 TSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELG 1151
            TSGLDSQ++W+  QL++KLA  GQ+ILCTIHQPSA L ++FDRLL L++GGQTVYFG++G
Sbjct: 196  TSGLDSQSSWAIIQLLRKLAQAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDVG 255

Query: 1152 KGCKTMINYFEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKE 1211
            K  +T+++YFE +GA KC    NPAE++LE +GA       +D+  IW++S+EY    ++
Sbjct: 256  KNSRTLLDYFEGNGARKCDRKENPAEYILEAIGAGATASVKEDWHEIWKNSKEYMRTAEK 315

Query: 1212 LDWMEREL---PKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTI 1268
            +D + +EL   P    G SN    ++ATS  YQ   V  R    +WR   Y+ SK     
Sbjct: 316  VDELIKELSSKPDDANGDSNS--GKYATSYGYQFSYVLRRTGITFWRNLNYIMSKMMLMT 373

Query: 1269 VSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSR 1328
            V  L+IGFTF+    S  GLQN M A F+  VV  P + Q     +  R+LYE RE  S 
Sbjct: 374  VGGLYIGFTFYDVGKSYTGLQNAMFAAFISIVVSAPAMNQIQARAIAARDLYEVRESKSN 433

Query: 1329 TFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACAF 1388
             F W   +V+Q L E+P++L   TI F   Y+P+  +  A         G  F  +   F
Sbjct: 434  MFHWSLLLVTQYLNELPYHLFFSTIFFVSSYFPLRIFYEAP------RSGVYFLNYCIMF 487

Query: 1389 YVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTY 1448
             +Y    G++V+       +A  +  L     +SFCGV    +++P FW FM++ SP TY
Sbjct: 488  QLYYVGFGLMVLYASPNLPSANVILGLCLSFLISFCGVTQPKSLMPGFWTFMWKASPYTY 547

Query: 1449 LIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECHF 1508
             +  ++ + L    VVCS  EL    PPSG TC +YME ++ S+ +GY+ +    + C +
Sbjct: 548  FVQNMVGIMLHKKPVVCSKKELNYFNPPSGQTCGQYMEKFL-SSASGYIKNPDDTSNCAY 606

Query: 1509 CQFSSTNDYLATVSSSYSRRWMNYGIF 1535
            C +S  ++YL  +SSSYS  W N+G++
Sbjct: 607  CIYSVGDEYLTHISSSYSYLWRNFGLY 633

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 140/645 (21%), Positives = 255/645 (39%), Gaps = 100/645 (15%)

Query: 195 ILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNH 254
           +L  + G   PG +  V+G  GAG TTLL +++    G  I+ D +I  NG   + I   
Sbjct: 46  LLDHVSGYCIPGTMTAVMGESGAGKTTLLNTLAQRNVGI-ITGDMLI--NG---RPIDAS 99

Query: 255 YRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGV-DRDTFAKHMTEVAMATYGL 313
           +     Y  + D+HI  LTV ++L   AR++    R + + D +  A    E  +    +
Sbjct: 100 FERRTGYVQQQDVHIAELTVRESLQFSARMR----RAQAIPDEEKMA--YVEKIIHVLDM 153

Query: 314 SHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCW-DNATRGLDSATALEFIKALK 372
              A+  VG +  RG++  +RK++SI    +       + D  T GLDS ++   I+ L+
Sbjct: 154 QEYAEALVG-EIGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIIQLLR 212

Query: 373 TQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQ-IFFGP----SKQAKKYFQRMG-Y 426
             A   +S     I+Q S   ++ FD++ +L  G Q ++FG     S+    YF+  G  
Sbjct: 213 KLAQAGQS-ILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDVGKNSRTLLDYFEGNGAR 271

Query: 427 VCPERQTTADYLTSITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNK 486
            C  ++  A+Y+            K+             + ++ W  S+EY +   +V++
Sbjct: 272 KCDRKENPAEYILEAIGAGATASVKE-------------DWHEIWKNSKEYMRTAEKVDE 318

Query: 487 HLDTDSSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIR---DIWRIKN--DPS 541
            +   SS+  +   +++          S  Y  S+  Q  Y+L R     WR  N     
Sbjct: 319 LIKELSSKPDDANGDSN----------SGKYATSYGYQFSYVLRRTGITFWRNLNYIMSK 368

Query: 542 IQLFTVLSHAAMALILGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYET 601
           + L TV       L +G  FY+V  S       Y G                   +  + 
Sbjct: 369 MMLMTV-----GGLYIGFTFYDVGKS-------YTGLQNAMFAAFISIVVSAPAMNQIQA 416

Query: 602 RPITEKHKTYSLYRPSADAF-------ASTFSDVPTKLATAVTFNIPYYFLINLKRDAGA 654
           R I  +   Y +    ++ F           +++P  L  +  F +  YF + +  +A  
Sbjct: 417 RAIAAR-DLYEVRESKSNMFHWSLLLVTQYLNELPYHLFFSTIFFVSSYFPLRIFYEAPR 475

Query: 655 FFFYFLINIITVFAMSHL--FRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLG 712
              YFL N   +F + ++     +   S  LP A V   + L     + G   P+  M G
Sbjct: 476 SGVYFL-NYCIMFQLYYVGFGLMVLYASPNLPSANVILGLCLSFLISFCGVTQPKSLMPG 534

Query: 713 WSKWISYINPLSYLFESLMINEFHGRNFPCA--------------------QYIPSGPNY 752
           +  ++   +P +Y  ++++    H +   C+                    +++ S   Y
Sbjct: 535 FWTFMWKASPYTYFVQNMVGIMLHKKPVVCSKKELNYFNPPSGQTCGQYMEKFLSSASGY 594

Query: 753 VNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSVGI 797
           +    D   C+      G+ Y++    I ++Y Y     WR+ G+
Sbjct: 595 IKNPDDTSNCAYCIYSVGDEYLT---HISSSYSYL----WRNFGL 632

>Scas_567.1
          Length = 810

 Score =  452 bits (1164), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 242/641 (37%), Positives = 361/641 (56%), Gaps = 10/641 (1%)

Query: 194 QILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKN 253
            I++   G +  GE+L V+GRPGAGC+TLLK+IS  T    +      +Y+G    E+ +
Sbjct: 168 NIIQNCTGVVESGEMLFVVGRPGAGCSTLLKTISGETSDM-VEVQGDFSYDGLDQAEMMS 226

Query: 254 HYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGL 313
            Y+G VVY  E D H P +TV +T+    + KTPR RI  + R  +   + ++    +GL
Sbjct: 227 KYKGYVVYCPELDFHFPKITVKETIDFALKCKTPRTRIDNMSRAEYVDSLRDMWCTVFGL 286

Query: 314 SHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKT 373
            HT  TKVGNDFVRGVSGGERKRVS+ E    G+    WDNATRGLD++TALEF +A++T
Sbjct: 287 RHTYATKVGNDFVRGVSGGERKRVSLVEAQAMGASIYSWDNATRGLDASTALEFAQAIRT 346

Query: 374 QATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQT 433
              +  ++A VAIYQ  ++ Y+LFDK  VLY+G QIFFGP  +A +YF+RMG+V P R T
Sbjct: 347 ATNMMNNSAIVAIYQAGENIYELFDKATVLYNGRQIFFGPGDKAVEYFERMGWVKPNRMT 406

Query: 434 TADYLTSITSPSE-RIKDKDMVKHGI--MIPQTAYEMNQYWIQSEEYKQ-LQVQVNKHLD 489
           +A++LTS+T   E R  D   +K G    +P++  E   YW+ S EY++ L+   + H  
Sbjct: 407 SAEFLTSVTVDFENRTLD---IKPGYEDKVPKSGAEFETYWLNSPEYQEVLREYEDYHQR 463

Query: 490 TDSSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLS 549
               + R++++ A   +    AR SS + V+++ QV Y +IR   R+K D +     + S
Sbjct: 464 HSPEETRDRLEVAKKQRLQSGARASSQFVVNYWSQVYYCMIRGFQRVKGDSTYTKVYLSS 523

Query: 550 HAAMALILGSMFYEV--MLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEK 607
                LI+GSMF+ +     +TT   Y RG                EI + + +RPI  K
Sbjct: 524 FLIKGLIVGSMFHNIDNKKQSTTAGAYSRGGLLFYVLLFASVTSLAEIGNSFASRPIIVK 583

Query: 608 HKTYSLYRPSADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVF 667
           H++YS+Y  SA++     ++ PTK    +  ++  Y++  LK +AGAFF Y L  +    
Sbjct: 584 HRSYSMYHLSAESLQEIITEFPTKFVAVLILSLVSYWIPVLKYEAGAFFQYMLYLLTVQQ 643

Query: 668 AMSHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLF 727
             S +F+ + + +     A     + +L   +Y GF +P  QM  W KWI +INPL+Y F
Sbjct: 644 CTSFIFKFVATTTTDGVTAHAIGGLYVLILCIYAGFVLPMGQMHHWIKWIHFINPLNYAF 703

Query: 728 ESLMINEFHGRNFPCAQYIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYR 787
           ESLM  EFHGR   C+Q +P+GP Y N +     C+ +G++ GN YVSGD +I  N+ + 
Sbjct: 704 ESLMATEFHGREMLCSQMVPNGPGYENVSISNQICNFVGAVKGNLYVSGDTYIDKNFHFG 763

Query: 788 HKNKWRSVGIGLAXXXXXXXXXXXXCEYNEGAKQNGEMLVF 828
           + + WR+ GI +              EY +     G++L+F
Sbjct: 764 YDHAWRNWGINVVWTAFYIVLNVVLSEYLKPLSGGGDLLLF 804

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 140/663 (21%), Positives = 257/663 (38%), Gaps = 111/663 (16%)

Query: 931  DIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLA-ERTTMGLITGDVFVDG 989
            D+P++N    I+ N  G V+ G +  ++G  GAG +TLL  ++ E + M  + GD   DG
Sbjct: 163  DVPLRN----IIQNCTGVVESGEMLFVVGRPGAGCSTLLKTISGETSDMVEVQGDFSYDG 218

Query: 990  RPRDQSFPRSIG---YCQQQDLHLKTATVRESLRFSAYLR----QADDVSIEEKDKYVEE 1042
              + +   +  G   YC + D H    TV+E++ F+   +    + D++S   + +YV+ 
Sbjct: 219  LDQAEMMSKYKGYVVYCPELDFHFPKITVKETIDFALKCKTPRTRIDNMS---RAEYVDS 275

Query: 1043 VIEV----------LEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPT 1092
            + ++             K+  D + GV G      +RKR+++ VE  A    +   D  T
Sbjct: 276  LRDMWCTVFGLRHTYATKVGNDFVRGVSG-----GERKRVSL-VEAQAMGASIYSWDNAT 329

Query: 1093 SGLDSQTAWSTCQLMKKLAS-RGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELG 1151
             GLD+ TA    Q ++   +    + +  I+Q    + + FD+   L  G Q ++FG   
Sbjct: 330  RGLDASTALEFAQAIRTATNMMNNSAIVAIYQAGENIYELFDKATVLYNGRQ-IFFGPGD 388

Query: 1152 KGCKTMINYFEAHGAHKCPPDANPAEWMLEI--------VGAAPGTH-----ASQDYFAI 1198
            K     + YFE  G  K P     AE++  +        +   PG       +  ++   
Sbjct: 389  KA----VEYFERMGWVK-PNRMTSAEFLTSVTVDFENRTLDIKPGYEDKVPKSGAEFETY 443

Query: 1199 WRDSEEYREMQKEL-DWMERELPKRTEG-----------SSNEEQKEFATSTLYQIKLVS 1246
            W +S EY+E+ +E  D+ +R  P+ T             S      +F  +   Q+    
Sbjct: 444  WLNSPEYQEVLREYEDYHQRHSPEETRDRLEVAKKQRLQSGARASSQFVVNYWSQVYYCM 503

Query: 1247 YRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLA---IFMFTVVFN 1303
             R F +      Y      S ++  L +G  F   +   Q       +   +  + ++F 
Sbjct: 504  IRGFQRVKGDSTYTKVYLSSFLIKGLIVGSMFHNIDNKKQSTTAGAYSRGGLLFYVLLFA 563

Query: 1304 PI--LQQYLPLFVQQRELYEARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFV-YYY 1360
             +  L +    F  +  +   + R    +   A  + +I+ E P   +A  I   V Y+ 
Sbjct: 564  SVTSLAEIGNSFASRPII--VKHRSYSMYHLSAESLQEIITEFPTKFVAVLILSLVSYWI 621

Query: 1361 PVGFYRNASYANQLHERGALF--WLFACAFYVYISSMGVLVISCIEIAENAANLASLFFI 1418
            PV  Y          E GA F   L+        S +   V +       A  +  L+ +
Sbjct: 622  PVLKY----------EAGAFFQYMLYLLTVQQCTSFIFKFVATTTTDGVTAHAIGGLYVL 671

Query: 1419 MSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSG 1478
            +   + G +     +  +  +++ ++PL Y  ++L++       ++CS     ++VP   
Sbjct: 672  ILCIYAGFVLPMGQMHHWIKWIHFINPLNYAFESLMATEFHGREMLCS-----QMVP--- 723

Query: 1479 MTCSEYMEPYMQSTGTGYLLDGSSETECHFCQFSSTNDYLA-------TVSSSYSRRWMN 1531
                          G GY     S   C+F      N Y++            Y   W N
Sbjct: 724  -------------NGPGYENVSISNQICNFVGAVKGNLYVSGDTYIDKNFHFGYDHAWRN 770

Query: 1532 YGI 1534
            +GI
Sbjct: 771  WGI 773

>AFR326W [3518] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W -
            NSH] complement(1025594..1029523) [3930 bp, 1309 aa]
          Length = 1309

 Score =  390 bits (1003), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 348/1372 (25%), Positives = 605/1372 (44%), Gaps = 144/1372 (10%)

Query: 187  EDNDSGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGF 246
            E+ +S   I++ +   +  GE+++V+G      +  L++++       ISP+  + +  +
Sbjct: 23   EEYNSNATIIRDLTFKVGAGEIVLVVGDKS---SQFLRNLADGNSA--ISPENKLVFKNY 77

Query: 247  SNKEIKNHYRGEVVYNAESDIHIPHLTVFQTL-YTVARLKTPRNRIKGVDRDTFAKHMTE 305
               +      GE++Y+   D H+  LTV +T+ + V          K + RDT       
Sbjct: 78   EYLKFAERCTGEIIYSNAEDNHMKQLTVQETIDFAVNCNVDVAKEDKILLRDTL------ 131

Query: 306  VAMATYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATAL 365
              ++ + LS    T V ++    +S GER+R+SI E  +  +    WDN T GLDS TA+
Sbjct: 132  --LSAFKLSEVRHTLVADENSSKLSVGERRRLSIIEAFLGNASLYLWDNCTNGLDSMTAM 189

Query: 366  EFIKALKTQATITKSAATVAIYQCSKDAYDLF---DKVCVLYDGYQIFFGPSKQAKKYFQ 422
            + I+ LK  A +TK   TV ++ C++    L    DKV VL   YQ+F+G  +    +F+
Sbjct: 190  DIIQGLKLMARVTK---TVNLFGCTQANGILLGQVDKVLVLIGDYQVFYGSYQDCILFFE 246

Query: 423  RMGYVCPERQTTADYLT-----SITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEY 477
             + +        ++Y +     SI SP               + +T  + ++ WI S  Y
Sbjct: 247  SLYFPKDPNLLDSEYFSAVIYGSIQSP---------------LIKTDSDFHRQWIHSSYY 291

Query: 478  KQLQVQVNKHLDTDSSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIK 537
            +++          D SQ +   K   + K  K  +P     VS   QV Y ++R     +
Sbjct: 292  RKVN---------DESQIKYSKKTIDL-KDLKSLQP-----VSALRQVIYCVLRSWNMFR 336

Query: 538  NDPSIQLFTVLSHAAMALILGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFS 597
            +D       V +    +L LG++F +  L TT      R                  +  
Sbjct: 337  SDKFATGLQVTTAFLRSLTLGALFLD--LPTTAVGSQARERLIFYILLMCMFSGITTVPL 394

Query: 598  LYETRPITEKHKTYSLYRPSADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFF 657
            +++ RP+  K      YRP  D+ A+T   +   L      +   Y +++ +R    F  
Sbjct: 395  IFDRRPVIMKQIQMQFYRPWTDSLANTTLSLSVNLILVTISSSVLYTMVDFQRSLLRFSV 454

Query: 658  YFLINIITVFAMSHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWI 717
            + LI I +   +  +F  I ++S     A   + +LL++ ++     IP  QM  W K +
Sbjct: 455  FILIAITSDCIIHLMFLTIANISPNSALANGLSGILLISASVTGSLGIPLKQMNRWFKVL 514

Query: 718  SYINPLSYLFESLMINEFHGRNFPCA-QYIPSGPNYVNATGDEVTCSALGSIPGNNYVSG 776
            S INP+ Y  E+ + NE    +  CA   +P G  Y N  G   TC   G+ P ++ ++G
Sbjct: 515  SLINPIRYAGETFLTNELFNVSLECADMLVPGGAAYQNVAGSFRTCVWPGAEPESSVING 574

Query: 777  DDFIQTNYGYRHKNKWRSVGIGLAXXXXXXXXXXXXCEYNEGAKQNGEMLVFPHSXXXXX 836
              ++   + + H + W++ GI  A             EY           + P       
Sbjct: 575  TKYLSAQFAFSHAHFWKNYGILQAFSIFFFIASLLSAEY-----------IMPLFCTKYA 623

Query: 837  XXXXXXXXXXXXNQPTLSTSDAEKDVEMNNNSSAT--DSRFLRDSDAAIMGNDKTVAKEH 894
                          P  +     K+V ++N+S +T    RF+  + A    +     +  
Sbjct: 624  PRICWPREKYENCHP--ARIKLRKEVVIDNDSHSTFCSDRFIEKAYAVAPSSSCGTREFS 681

Query: 895  YXXXXXXXXXXXXXXXXDDIELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTL 954
            Y                   EL  S  I  W NL Y +   NGK  +L N+ G++ PG L
Sbjct: 682  YGN-----------------ELYHS--IISWSNLSYQV---NGK-MLLQNISGYIGPG-L 717

Query: 955  TALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPR---SIGYCQQQDLHLK 1011
              ++G S +GK+ LL+ LA R   G ITG++ + GRP  + +P     +GY      H  
Sbjct: 718  CLVLGESSSGKSALLNVLARREASG-ITGNLMLAGRPI-KDYPNYLIEVGYVPHLYAHFG 775

Query: 1012 TATVRESLRFSAYLR-QADDVSIEEKDKYVEEVIEVLEM--KLYADAIVGVPGEGLNVEQ 1068
            +  V   L FSA +R Q D V       ++ EV+ +L +  + Y DA        L +++
Sbjct: 776  SLKVIVPLEFSANIRGQTDKV-------HISEVLSMLNLSGQRYVDA--------LCLQE 820

Query: 1069 RKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALL 1128
            ++ L+IG ELA+KP + +F+DEP+ G+DS+ A +  + + +LA  GQ ILC+I QPS  +
Sbjct: 821  KRILSIGPELASKPAVALFVDEPSMGMDSEAAIAMIERLNRLADEGQTILCSISQPSKSI 880

Query: 1129 MQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGAHKCPP-DANPAEWMLEIVGAAP 1187
               FD L+ L + GQ VYFG      +  I+YF  H A +      NP++ +L I+ +  
Sbjct: 881  FHYFDNLIVLDKNGQCVYFGS----TEGAISYFTKHSAIQYDERKHNPSDLILSIIRS-- 934

Query: 1188 GTHASQDYFAIWRDSEEYREMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSY 1247
                 + +   W+ ++EY   +        EL +++ G+   +Q+   +   +     + 
Sbjct: 935  -NLKDRTWAENWQCTKEYAAAEAT----RIELERKSFGAWASDQRHLDSFLTWPTCFCAT 989

Query: 1248 --RLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPI 1305
              R F    R   YL S+   ++ + L++  + +    S   L   + ++F+F  +  P+
Sbjct: 990  LKRQFILIARDKSYLTSRIILSLTTGLYLAGSLWNTGNSGSALDTTIFSVFVFLAMSLPL 1049

Query: 1306 LQQYLPLFVQQRELYEARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFY 1365
             QQ         + Y  RE  S T  W   + +Q L EIP  L    + +F  Y  +G  
Sbjct: 1050 AQQIQTKAATVMKAYITREMKSHTVGWSTLMAAQFLAEIPLLLSCCVLFYFCIYCTMGTS 1109

Query: 1366 RNASYANQLHERGALFWLFACAFYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCG 1425
             N +  +        F++    F +Y  S+G+  +       ++  L SL   + L+ CG
Sbjct: 1110 VNPAVMDA-------FFVNCLVFGLYCLSIGLATLFVGLKVYHSTALLSLVSSLLLAVCG 1162

Query: 1426 VLATPNI-LPRFWIFMYRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEY 1484
            +L  PN+ +   W  +Y++SPLTY  D   S+ L +  ++CS ++L+ +  P G +CSEY
Sbjct: 1163 IL-QPNLKVTPIWRTIYQMSPLTYFADTFTSLLLYDKHILCSQDDLISVSRPDGQSCSEY 1221

Query: 1485 MEPYMQSTGTGYLLDGSSETECHFCQFSSTNDYLATVSSSYSRRWMNYGIFS 1536
               ++Q  G G ++D + +  C +C     +++L+    SY+  W N  I S
Sbjct: 1222 FGTFIQEFG-GKIVDHADKNMCAYCSSDEISNFLSLRDMSYNHIWRNVAICS 1272

>YIL013C (PDR11) [2652] chr9 complement(328205..332440) Membrane
            transporter of the ATP-binding cassette (ABC)
            superfamily, plays a role in sterol uptake and anaerobic
            growth [4236 bp, 1411 aa]
          Length = 1411

 Score =  383 bits (983), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 225/648 (34%), Positives = 360/648 (55%), Gaps = 56/648 (8%)

Query: 912  DDIELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDC 971
            + + +   + +  WKN+ Y I    G ++++++  G++  G LTAL+G SGAGKTTLL+ 
Sbjct: 740  ESVAMETQKHVISWKNINYTI----GDKKLINDASGYISSG-LTALMGESGAGKTTLLNV 794

Query: 972  LAERTTMGLITGDVFVDGRPRDQ--SFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQAD 1029
            L++RT  G++TG++ +DG+P     +F RSIG+ QQQD+HL+  TVRESL  S  LR   
Sbjct: 795  LSQRTESGVVTGELLIDGQPLTNIDAFRRSIGFVQQQDVHLELLTVRESLEISCVLRGDG 854

Query: 1030 DVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLD 1089
            D    +    V  ++ +   KL AD         L+  QRK L+IGVEL  KP LL+FLD
Sbjct: 855  D---RDYLGVVSNLLRLPSEKLVAD---------LSPTQRKLLSIGVELVTKPSLLLFLD 902

Query: 1090 EPTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGE 1149
            EPTSGLD++ A +  Q +KKL+ +GQAILCTIHQPS  ++  FD +  L+ GG+ VYFG 
Sbjct: 903  EPTSGLDAEAALTIVQFLKKLSMQGQAILCTIHQPSKSVISYFDNIYLLKRGGECVYFGS 962

Query: 1150 LGKGCKTMINYFEAHGAHKCPPDA---NPAEWMLEIVGAA----PGTHASQDYFAIWRDS 1202
            L   C    +YF AH   +   D    NPA++++++VG+     P   A +   +   + 
Sbjct: 963  LPNAC----DYFVAHD-RRLTFDREMDNPADFVIDVVGSGSTNIPMDDAEKPTSSKIDEP 1017

Query: 1203 EEYREMQKELDWME--RELPKRT---------EGSSNEEQKEFATST------LYQIKLV 1245
              Y +    ++W E  +  P++          E  + +   +F TS       + QIKL+
Sbjct: 1018 VSYHKQSDSINWAELWQSSPEKVRVADDLLLLEEEARKSGVDFTTSVWSPPSYMEQIKLI 1077

Query: 1246 SYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPI 1305
            + R +    R   Y+++K+     + LFIGF+F++   ++ GLQ+ +   FM   V +P+
Sbjct: 1078 TKRQYICTKRDMTYVFAKYALNAGAGLFIGFSFWRTKHNINGLQDAIFLCFMMLCVSSPL 1137

Query: 1306 LQQYLPLFVQQRELYEARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFY 1365
            + Q     +Q +E+Y ARE  S T+ W   +++Q +VE+P  + + T+ F   Y+  GF 
Sbjct: 1138 INQVQDKALQSKEVYIAREARSNTYHWTVLLIAQTIVELPLAISSSTLFFLCCYFCCGFE 1197

Query: 1366 RNASYANQLHERGALFWLFACAFYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCG 1425
             +A  A        +F+L    F +Y  S G+ ++      + AA   +  +  + SFCG
Sbjct: 1198 TSARVA-------GVFYLNYILFSMYYLSFGLWLLYSAPDLQTAAVFVAFLYSFTASFCG 1250

Query: 1426 VLATPNILPRFWIFMYRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYM 1485
            V+   ++ PRFW FMYRVSP TY I+  +S+ L +  V CS++E++   P  G TC ++M
Sbjct: 1251 VMQPYSLFPRFWTFMYRVSPYTYFIETFVSLLLHDREVNCSTSEMVPSQPVMGQTCGQFM 1310

Query: 1486 EPYMQSTGTGYLLDGSSETECHFCQFSSTNDYLATVSSSYSRRWMNYG 1533
            +P++   G G L   ++ T C +C ++  +D+LA  + SY  RW N+G
Sbjct: 1311 KPFIDEFG-GKLHINNTYTVCAYCMYTVGDDFLAQENMSYHHRWRNFG 1357

 Score =  259 bits (662), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 186/611 (30%), Positives = 285/611 (46%), Gaps = 46/611 (7%)

Query: 204 NPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNA 263
           N GE+++VLG P +    L K +       K SP+  I +     K+  +    +++YN 
Sbjct: 57  NEGEVVLVLGNPTSA---LFKGLFHGHKHLKYSPEGSIRFKDNEYKQFASKCPHQIIYNN 113

Query: 264 ESDIHIPHLTVFQTL--YTVARLKTPRN-RIKGVDRDTFAKHMTEVAMATYGLSHTADTK 320
           E DIH P+LTV QT+      +   P+  RI+          M +  +  +GLSH   T 
Sbjct: 114 EQDIHFPYLTVEQTIDFALSCKFHIPKQERIE----------MRDELLKEFGLSHVKKTY 163

Query: 321 VGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKS 380
           VGND+VRGVSGGERKR+SI E  I       WDN+T+GLDSATALEF+   +  A  T+S
Sbjct: 164 VGNDYVRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSATALEFLSITQKMAKATRS 223

Query: 381 AATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPE-RQTTADYLT 439
              V I Q S      FDK+ +L D +Q+F+G  ++   +F     +         +YLT
Sbjct: 224 VNFVKISQASDKIVSKFDKILMLGDSFQVFYGTMEECLTHFHDTLQIKKNPNDCIIEYLT 283

Query: 440 SITSPSERIKDKDMVKHGIMIPQTAYEMNQ------------YWIQSEEYKQLQVQVNKH 487
           SI +   +     +V  G+  P    E NQ             WIQS  YK  +   +K 
Sbjct: 284 SILNFKFKETSNSIV--GLDTPSVVSEENQALNINNETDLHTLWIQSPYYKHWKAITSK- 340

Query: 488 LDTDSSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTV 547
             T     R+ +    I         S  +++    Q+K   +R   RI  D +  +   
Sbjct: 341 --TVQECTRKDVNPDDI---------SPIFSIPLKTQLKTCTVRAFERIIGDRNYLISQF 389

Query: 548 LSHAAMALILGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEK 607
           +S    +L++GS+FY + L+T  +  + RG                ++ + ++ +P+  K
Sbjct: 390 VSVVVQSLVIGSLFYNIPLTTIGS--FSRGSLTFFSILFFTFLSLADMPASFQRQPVVRK 447

Query: 608 HKTYSLYRPSADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVF 667
           H     Y    +  A+ F D  +K    V F I  YFL +L+ +A  FF + L   +  F
Sbjct: 448 HVQLHFYYNWVETLATNFFDCCSKFILVVIFTIILYFLAHLQYNAARFFIFLLFLSVYNF 507

Query: 668 AMSHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLF 727
            M  LF     ++ TL  A + A +LLLA AMY  + I    M  W  WI+Y+NP  +  
Sbjct: 508 CMVSLFALTALIAPTLSMANLLAGILLLAIAMYASYVIYMKDMHPWFIWIAYLNPAMFAM 567

Query: 728 ESLMINEFHGRNFPCAQ-YIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGY 786
           E+++ NE       C +  IP G  Y N +     C+  G+  GN+YV G D++++   Y
Sbjct: 568 EAILSNELFNLKLDCHESIIPRGEYYDNISFSHKACAWQGATLGNDYVRGRDYLKSGLKY 627

Query: 787 RHKNKWRSVGI 797
            + + WR+ GI
Sbjct: 628 TYHHVWRNFGI 638

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 137/644 (21%), Positives = 247/644 (38%), Gaps = 91/644 (14%)

Query: 194  QILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKN 253
            +++    G I+ G L  ++G  GAG TTLL  +S  T    ++ + +I     +N +   
Sbjct: 764  KLINDASGYISSG-LTALMGESGAGKTTLLNVLSQRTESGVVTGELLIDGQPLTNIDA-- 820

Query: 254  HYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGL 313
             +R  + +  + D+H+  LTV ++L     L+         DRD        + + +  L
Sbjct: 821  -FRRSIGFVQQQDVHLELLTVRESLEISCVLRGDG------DRDYLGVVSNLLRLPSEKL 873

Query: 314  SHTADTKVGNDFVRGVSGGERKRVSIA-EVSICGSKFQCWDNATRGLDSATALEFIKALK 372
                        V  +S  +RK +SI  E+    S     D  T GLD+  AL  ++ LK
Sbjct: 874  ------------VADLSPTQRKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFLK 921

Query: 373  TQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQ-IFFGPSKQAKKYFQRMGYVCPER 431
             + ++   A    I+Q SK     FD + +L  G + ++FG    A  YF     V  +R
Sbjct: 922  -KLSMQGQAILCTIHQPSKSVISYFDNIYLLKRGGECVYFGSLPNACDYF-----VAHDR 975

Query: 432  QTTADYLTSITSPSERIKDKDMVKHG-IMIPQTAYE--MNQYWIQSEEYKQLQVQVNKHL 488
            + T D    + +P++ +   D+V  G   IP    E   +    +   Y +    +N   
Sbjct: 976  RLTFD--REMDNPADFV--IDVVGSGSTNIPMDDAEKPTSSKIDEPVSYHKQSDSINWAE 1031

Query: 489  DTDSSQQREQIKNAHIAKQSKRARPSSPYTV------SFFLQVKYILIRDIWRIKNDPSI 542
               SS ++ ++ +  +  + +  +    +T       S+  Q+K I  R     K D + 
Sbjct: 1032 LWQSSPEKVRVADDLLLLEEEARKSGVDFTTSVWSPPSYMEQIKLITKRQYICTKRDMTY 1091

Query: 543  QLFTVLSHAAMALILGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETR 602
                   +A   L +G  F+        T     G                 + +  + +
Sbjct: 1092 VFAKYALNAGAGLFIGFSFWR-------TKHNINGLQDAIFLCFMMLCVSSPLINQVQDK 1144

Query: 603  PITEK------HKTYSLYRPSADAFASTFSDVPTKLATAVTFNIPYYFLINLK---RDAG 653
             +  K          + Y  +    A T  ++P  ++++  F +  YF    +   R AG
Sbjct: 1145 ALQSKEVYIAREARSNTYHWTVLLIAQTIVELPLAISSSTLFFLCCYFCCGFETSARVAG 1204

Query: 654  AFFFYFLINIITVFAMSHLFRCIGSV--SKTLPQAMVPASVLLLAFAMYTGFAIPRVQML 711
             F+  +++     F+M +L   +  +  +  L  A V  + L    A + G   P     
Sbjct: 1205 VFYLNYIL-----FSMYYLSFGLWLLYSAPDLQTAAVFVAFLYSFTASFCGVMQPYSLFP 1259

Query: 712  GWSKWISYINPLSYLFESLMINEFHGRNFPC--AQYIPSGPNYVNATG-------DEVTC 762
             +  ++  ++P +Y  E+ +    H R   C  ++ +PS P      G       DE   
Sbjct: 1260 RFWTFMYRVSPYTYFIETFVSLLLHDREVNCSTSEMVPSQPVMGQTCGQFMKPFIDEFG- 1318

Query: 763  SALGSIPGNN---------YVSGDDFI-QTNYGYRHKNKWRSVG 796
               G +  NN         Y  GDDF+ Q N  Y H  +WR+ G
Sbjct: 1319 ---GKLHINNTYTVCAYCMYTVGDDFLAQENMSYHH--RWRNFG 1357

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 123/580 (21%), Positives = 224/580 (38%), Gaps = 89/580 (15%)

Query: 997  PRSIGYCQQQDLHLKTATVRESLRF--SAYLRQADDVSIEEKDKYVEEVIEVLEMKLYA- 1053
            P  I Y  +QD+H    TV +++ F  S          IE +D+ ++E       K Y  
Sbjct: 106  PHQIIYNNEQDIHFPYLTVEQTIDFALSCKFHIPKQERIEMRDELLKEFGLSHVKKTYVG 165

Query: 1054 -DAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLAS 1112
             D + GV G      +RKR++I     A   + ++ D  T GLDS TA     + +K+A 
Sbjct: 166  NDYVRGVSGG-----ERKRISIIETFIANGSVYLW-DNSTKGLDSATALEFLSITQKMAK 219

Query: 1113 RGQAI-LCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGAHKCPP 1171
              +++    I Q S  ++ +FD++L L +  Q V++G + + C T       H       
Sbjct: 220  ATRSVNFVKISQASDKIVSKFDKILMLGDSFQ-VFYGTM-EECLT-------HFHDTLQI 270

Query: 1172 DANPAEWMLE----------------IVG-----------AAPGTHASQDYFAIWRDSEE 1204
              NP + ++E                IVG            A   +   D   +W  S  
Sbjct: 271  KKNPNDCIIEYLTSILNFKFKETSNSIVGLDTPSVVSEENQALNINNETDLHTLWIQSPY 330

Query: 1205 YREMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKF 1264
            Y+  +       +E   R + + ++    F+     Q+K  + R F +      YL S+F
Sbjct: 331  YKHWKAITSKTVQEC-TRKDVNPDDISPIFSIPLKTQLKTCTVRAFERIIGDRNYLISQF 389

Query: 1265 FSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARE 1324
             S +V  L IG  F+    +  G  ++    F   + F  +    +P   Q++ +     
Sbjct: 390  VSVVVQSLVIGSLFYNIPLTTIGSFSRGSLTFFSILFFTFLSLADMPASFQRQPVVRKHV 449

Query: 1325 RPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLF 1384
            +    ++W   + +    +     +   I   + Y+      NA+       R  +F LF
Sbjct: 450  QLHFYYNWVETLATNFF-DCCSKFILVVIFTIILYFLAHLQYNAA-------RFFIFLLF 501

Query: 1385 ACAF---YVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMY 1441
               +    V + ++  L+   + +A   A +  L   M  S+  V+   ++ P F I++ 
Sbjct: 502  LSVYNFCMVSLFALTALIAPTLSMANLLAGILLLAIAMYASY--VIYMKDMHPWF-IWIA 558

Query: 1442 RVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGS 1501
             ++P  + ++A+L            SNEL  +     + C E + P     G  Y     
Sbjct: 559  YLNPAMFAMEAIL------------SNELFNL----KLDCHESIIP----RGEYYDNISF 598

Query: 1502 SETECHFCQFSSTNDYL-------ATVSSSYSRRWMNYGI 1534
            S   C +   +  NDY+       + +  +Y   W N+GI
Sbjct: 599  SHKACAWQGATLGNDYVRGRDYLKSGLKYTYHHVWRNFGI 638

>CAGL0F01419g complement(142623..146819) highly similar to tr|Q08409
            Saccharomyces cerevisiae YOR011w AUS1, start by
            similarity
          Length = 1398

 Score =  382 bits (980), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 221/637 (34%), Positives = 356/637 (55%), Gaps = 45/637 (7%)

Query: 913  DIELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCL 972
            D  +   + +  WKN+ Y +    G +R+++NV G++  G LTAL+G SGAGKTTLL+ L
Sbjct: 745  DKTVQAQKHVISWKNINYTV---GGDKRLINNVSGYIGSG-LTALMGESGAGKTTLLNVL 800

Query: 973  AERTTMGLITGDVFVDGRP--RDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADD 1030
            ++RT  G+++G++ +DG+P   + +F RSIG+ QQQD+HL+  TV+ESL  S+ LR   D
Sbjct: 801  SQRTESGVVSGEILIDGKPLTNENAFRRSIGFVQQQDIHLELLTVKESLEISSELRGDGD 860

Query: 1031 VSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDE 1090
            +      +YVE + E+L++ L  D++V      LN  QRK L+IGVEL  KP LL+FLDE
Sbjct: 861  M------EYVESISELLKLPL--DSLV----RELNPTQRKLLSIGVELVTKPSLLLFLDE 908

Query: 1091 PTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGEL 1150
            PTSGLD++ A +  Q +KKL+ +GQAI CTIHQPS  ++  FD +  L+ GG+ VYFG  
Sbjct: 909  PTSGLDAEAALTIVQFLKKLSLQGQAIFCTIHQPSKSVISYFDNIYLLKRGGECVYFGPT 968

Query: 1151 GKGCKTMINYFEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDY--FAI-----WRDSE 1203
             + C   ++Y ++      P   NPA++++++VG         D   FAI     W    
Sbjct: 969  SEACGYFMSYDKSLTYD--PESDNPADFVIDVVGNNESMEEMDDKADFAIREENPWSTRW 1026

Query: 1204 EYREMQKELDWMERELPKRTEGSSNEEQKEFAT------STLYQIKLVSYRLFHQYWRTP 1257
            E    +K +D    E   R E  +     +F T      S + Q+ +++ R +    R  
Sbjct: 1027 ENSHERKNID----ETVVRLEQEAAASGVDFTTAVWEQPSYMKQLIMITKRQYTCTRRDR 1082

Query: 1258 FYLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQR 1317
             Y+ +K+     + LFIGF+F+K   ++ GLQ+ +   FM   V +P++ Q     +Q +
Sbjct: 1083 SYIAAKYLLNGGAGLFIGFSFWKIKHTISGLQDTIFFCFMALCVSSPLINQVQDKALQSK 1142

Query: 1318 ELYEARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHER 1377
            E++ ARE  S T+ W   +++Q ++E+P  + + T+ F   ++  GF  +   A      
Sbjct: 1143 EVFIARESRSNTYHWTCLLLAQFIIELPLAMSSSTLFFVCAFFCCGFDNSGKVA------ 1196

Query: 1378 GALFWLFACAFYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFW 1437
              +F+L    F  Y  ++G+ +I      + AA   +  +  + SFCGV+    + P FW
Sbjct: 1197 -GVFYLNYILFSAYYLTLGLWLIYTAPNLQTAAVFVAFIYSFTASFCGVMQPYALFPGFW 1255

Query: 1438 IFMYRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYL 1497
             FMYRVSP TY +D  +S  L N  V+C++ E++   P  G TC ++ + Y+   G G+L
Sbjct: 1256 KFMYRVSPYTYFVDTFVSTLLHNRKVICNTGEMVPGQPTGGKTCGQFFKAYIDEYG-GWL 1314

Query: 1498 LDGSSETECHFCQFSSTNDYLATVSSSYSRRWMNYGI 1534
             + ++ T C +C + + +D+L   + S+S  W NYGI
Sbjct: 1315 KNPNTFTVCAYCTYDTGDDFLKQQNMSHSHIWRNYGI 1351

 Score =  265 bits (676), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 184/649 (28%), Positives = 294/649 (45%), Gaps = 58/649 (8%)

Query: 183 HGKSEDNDSGFQI-LKPMDGCIN-----------PGELLVVLGRPGAGCTTLLKSISVNT 230
           H  +ED + G ++ L  +  C N            GE+++VLG P +G   + KS+    
Sbjct: 33  HSHAEDPEFGEKLPLPSVSPCENGQVVDLTFQATAGEMVLVLGAPTSG---IFKSLFHAH 89

Query: 231 HGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAESDIHIPHLTVFQTL--YTVARLKTPR 288
                SP   I +     K   +    +++YN E D+H P LTV QT+      +   P+
Sbjct: 90  KHLSYSPQGSIRFKDNEFKAYSSKSPHQIIYNNEQDVHFPFLTVNQTVDFALSCKFDIPK 149

Query: 289 NRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSK 348
                       ++M    +  +GLSH  DT VGND+ RGVSGGERKR+SI E  I    
Sbjct: 150 EE---------RENMRNELLREFGLSHVGDTIVGNDYFRGVSGGERKRISIIETFIANGS 200

Query: 349 FQCWDNATRGLDSATALEFIKALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQ 408
              WDN+T+GLDS+TAL+F+  L+  A  T+S   V I Q S    + FDK+ +L D YQ
Sbjct: 201 VYLWDNSTKGLDSSTALDFLTILQKMARTTRSVNLVRISQASDKIVEKFDKILMLSDSYQ 260

Query: 409 IFFGPSKQAKKYFQ-RMGYVCPERQTTADYLTSITSPSERIKDKDMV--KHGIMIPQTAY 465
           +F+G   +   +F+  +G          +YLTSI +   R K  D+      + +  T +
Sbjct: 261 VFYGTVDECLHHFRDNLGIKKDPNDCIIEYLTSILNFQFRTKSLDITGSSEDLDLKDTDH 320

Query: 466 --------------EMNQY--WIQSEEYKQLQVQVNKHLDTDSSQQREQIKNAHIAKQSK 509
                         E++ Y  W +S  Y+ ++ Q+    + ++      I    + K   
Sbjct: 321 NEQTFSGIASSLCSEVDLYTQWKKSSYYQDIKEQIGA-FNVENKADGNHINPEDVTKT-- 377

Query: 510 RARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYEVMLSTT 569
                  + +    Q+ Y   R   R   D +  +  V+S    +L++GS+FY++ ++T 
Sbjct: 378 -------FDIPLKKQILYCTKRAFQRSLGDKAYMISQVISVIIQSLVIGSLFYDIPMTTI 430

Query: 570 TTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFASTFSDVP 629
            +  + RG                ++   ++ + + +K      Y  S +  A+T  D  
Sbjct: 431 GS--FSRGSLTFFSILFFTFLSLADMPIAFQRQAVVKKQTLLHFYFNSVETLATTLFDYC 488

Query: 630 TKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTLPQAMVP 689
            K    V F I  YFL +L+ +A  FF + L   +  F M  LF      + T+  A + 
Sbjct: 489 FKFCLVVIFTIILYFLAHLQYNAARFFIFLLFLSVYNFCMVSLFSLTTMFTPTISLANLF 548

Query: 690 ASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFHGRNFPCAQ-YIPS 748
           A +LLLA AMY  + I    M  W  WI+Y+NP  Y  ES++ NE       C +  +P 
Sbjct: 549 AGILLLAIAMYASYVIYMKDMHPWFVWIAYLNPAMYAMESILANEMFNLKLDCTESVVPR 608

Query: 749 GPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNYGYRHKNKWRSVGI 797
           GP Y N       C+  G+  GN+YV G D+++    Y++ + WR+ GI
Sbjct: 609 GPTYQNVPVTNKACAWQGATLGNDYVRGKDYLKNGLSYKYSHVWRNFGI 657

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 136/640 (21%), Positives = 252/640 (39%), Gaps = 87/640 (13%)

Query: 194  QILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKN 253
            +++  + G I  G L  ++G  GAG TTLL  +S  T    +S + +I     +N   +N
Sbjct: 769  RLINNVSGYIGSG-LTALMGESGAGKTTLLNVLSQRTESGVVSGEILIDGKPLTN---EN 824

Query: 254  HYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGL 313
             +R  + +  + DIH+  LTV ++L   + L       +G     + + ++E+      L
Sbjct: 825  AFRRSIGFVQQQDIHLELLTVKESLEISSEL-------RGDGDMEYVESISEL------L 871

Query: 314  SHTADTKVGNDFVRGVSGGERKRVSIA-EVSICGSKFQCWDNATRGLDSATALEFIKALK 372
                D+      VR ++  +RK +SI  E+    S     D  T GLD+  AL  ++ LK
Sbjct: 872  KLPLDS-----LVRELNPTQRKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFLK 926

Query: 373  TQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQ-IFFGPSKQAKKYFQRMGY----- 426
             + ++   A    I+Q SK     FD + +L  G + ++FGP+ +A  YF  M Y     
Sbjct: 927  -KLSLQGQAIFCTIHQPSKSVISYFDNIYLLKRGGECVYFGPTSEACGYF--MSYDKSLT 983

Query: 427  VCPERQTTADYLTSITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNK 486
              PE    AD++  +   +E +++ D      +  +  +     W  S E K +      
Sbjct: 984  YDPESDNPADFVIDVVGNNESMEEMDDKADFAIREENPWSTR--WENSHERKNI------ 1035

Query: 487  HLDTDSSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFT 546
                D +  R + + A        A    P   S+  Q+  I  R     + D S     
Sbjct: 1036 ----DETVVRLEQEAAASGVDFTTAVWEQP---SYMKQLIMITKRQYTCTRRDRSYIAAK 1088

Query: 547  VLSHAAMALILGSMFYEVMLSTT----TTTFYYRGXXXXX---XXXXXXXXXXXEIFSLY 599
             L +    L +G  F+++  + +    T  F +                     E+F   
Sbjct: 1089 YLLNGGAGLFIGFSFWKIKHTISGLQDTIFFCFMALCVSSPLINQVQDKALQSKEVFIAR 1148

Query: 600  ETRPITEKHKTYSLYRPSADAFASTFSDVPTKLATAVTFNIPYYFLI---NLKRDAGAFF 656
            E+R  T        Y  +    A    ++P  ++++  F +  +F     N  + AG F+
Sbjct: 1149 ESRSNT--------YHWTCLLLAQFIIELPLAMSSSTLFFVCAFFCCGFDNSGKVAGVFY 1200

Query: 657  FYFLINIITVFAMSHLFRCIGSV--SKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWS 714
              +++     F+  +L   +  +  +  L  A V  + +    A + G   P     G+ 
Sbjct: 1201 LNYIL-----FSAYYLTLGLWLIYTAPNLQTAAVFVAFIYSFTASFCGVMQPYALFPGFW 1255

Query: 715  KWISYINPLSYLFESLMINEFHGRNFPC--AQYIPSGPN-----------YVNATGDEVT 761
            K++  ++P +Y  ++ +    H R   C   + +P  P            Y++  G  + 
Sbjct: 1256 KFMYRVSPYTYFVDTFVSTLLHNRKVICNTGEMVPGQPTGGKTCGQFFKAYIDEYGGWLK 1315

Query: 762  CSALGSIPGN-NYVSGDDFIQTNYGYRHKNKWRSVGIGLA 800
                 ++     Y +GDDF++      H + WR+ GI  A
Sbjct: 1316 NPNTFTVCAYCTYDTGDDFLKQQ-NMSHSHIWRNYGIEWA 1354

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 121/578 (20%), Positives = 234/578 (40%), Gaps = 75/578 (12%)

Query: 997  PRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAI 1056
            P  I Y  +QD+H    TV +++ F+  L    D+  EE++    E++    +    D I
Sbjct: 115  PHQIIYNNEQDVHFPFLTVNQTVDFA--LSCKFDIPKEERENMRNELLREFGLSHVGDTI 172

Query: 1057 VGVP-GEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQ 1115
            VG     G++  +RKR++I     A   + ++ D  T GLDS TA     +++K+A   +
Sbjct: 173  VGNDYFRGVSGGERKRISIIETFIANGSVYLW-DNSTKGLDSSTALDFLTILQKMARTTR 231

Query: 1116 AI-LCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGAHKCPPDAN 1174
            ++ L  I Q S  ++++FD++L L +  Q V++G + +     +++F  +   K  P+  
Sbjct: 232  SVNLVRISQASDKIVEKFDKILMLSDSYQ-VFYGTVDE----CLHHFRDNLGIKKDPNDC 286

Query: 1175 PAEWMLEIV-------------------------------GAAPGTHASQDYFAIWRDSE 1203
              E++  I+                               G A    +  D +  W+ S 
Sbjct: 287  IIEYLTSILNFQFRTKSLDITGSSEDLDLKDTDHNEQTFSGIASSLCSEVDLYTQWKKSS 346

Query: 1204 EYREMQKELDWMERELPKRTEGSS-NEEQ--KEFATSTLYQIKLVSYRLFHQYWRTPFYL 1260
             Y+++++++     E   + +G+  N E   K F      QI   + R F +      Y+
Sbjct: 347  YYQDIKEQIGAFNVE--NKADGNHINPEDVTKTFDIPLKKQILYCTKRAFQRSLGDKAYM 404

Query: 1261 WSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELY 1320
             S+  S I+  L IG  F+    +  G  ++    F   + F  +    +P+  Q++ + 
Sbjct: 405  ISQVISVIIQSLVIGSLFYDIPMTTIGSFSRGSLTFFSILFFTFLSLADMPIAFQRQAVV 464

Query: 1321 EARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGAL 1380
            + +      F+     ++  L +  +      I   + Y+      NA+       R  +
Sbjct: 465  KKQTLLHFYFN-SVETLATTLFDYCFKFCLVVIFTIILYFLAHLQYNAA-------RFFI 516

Query: 1381 FWLFACAF---YVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFW 1437
            F LF   +    V + S+  +    I +A   A +  L   M  S+  V+   ++ P F 
Sbjct: 517  FLLFLSVYNFCMVSLFSLTTMFTPTISLANLFAGILLLAIAMYASY--VIYMKDMHPWF- 573

Query: 1438 IFMYRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYL 1497
            +++  ++P  Y ++++L+  + N  + C+ +     V P G T              G  
Sbjct: 574  VWIAYLNPAMYAMESILANEMFNLKLDCTES-----VVPRGPTYQNVPVTNKACAWQGAT 628

Query: 1498 LDGSSETECHFCQFSSTNDYLAT-VSSSYSRRWMNYGI 1534
            L            +    DYL   +S  YS  W N+GI
Sbjct: 629  LGN---------DYVRGKDYLKNGLSYKYSHVWRNFGI 657

>Scas_288.1
          Length = 494

 Score =  348 bits (894), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/496 (39%), Positives = 279/496 (56%), Gaps = 18/496 (3%)

Query: 138 GCAWKDLSASGDSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILK 197
           G   +D+ A G  A      TFGN+          C+   ++     K+  +    +IL+
Sbjct: 16  GVTLEDVGAEGTDASALEGATFGNI---------LCLPYTIYKGI--KARKSMKMRKILQ 64

Query: 198 PMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRG 257
            ++     GE+++VLGRPGAGC++ LK  +  T  F       I Y+G    E+   YR 
Sbjct: 65  NVNALAEAGEMVLVLGRPGAGCSSFLKVTAGETDQFAGGVTGEIAYDGIPQDEMMKKYRA 124

Query: 258 EVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTA 317
           +V+YN E D+H P+LTV QTL      KTP  R+  V ++ + K   E+    +GL HT 
Sbjct: 125 DVIYNGELDVHFPYLTVQQTLDFAIACKTPAKRVNDVSKEEYIKSTRELYATIFGLRHTY 184

Query: 318 DTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATI 377
           +TKVGNDFVRGVSGGERKRVSIAE         CWDNATRGLD++TALE+ KA++    +
Sbjct: 185 NTKVGNDFVRGVSGGERKRVSIAEALAANGTIYCWDNATRGLDASTALEYAKAIRIMTNL 244

Query: 378 TKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADY 437
            KS A V IYQ S++ Y+ FDKV VLY G QI++GP  +AK YF +MGY+CP RQ TA++
Sbjct: 245 LKSTAFVTIYQASENIYETFDKVTVLYSGRQIYYGPIHEAKDYFAQMGYLCPPRQVTAEF 304

Query: 438 LTSITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHLDT-DSSQQR 496
           LT++T P+   + K   +H   +P+TA E  +YW++S+EY +L+  +N +  T D+ + R
Sbjct: 305 LTALTDPNGYHEIKPGYEH--KVPRTAEEFEKYWLESDEYAKLRSDINTYKSTVDTEKTR 362

Query: 497 EQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALI 556
           E  K +   +++K  R  S +T+S+  QVK   IR   RI  + +  +  V S    A I
Sbjct: 363 ELYKESMADEKAKGTRKKSYFTISYMEQVKLCTIRGFQRIYGNKAYTVINVSSSVIQAFI 422

Query: 557 LGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRP 616
           +GS FY     ++T   + RG                 I   ++ R I +KHK YSLY P
Sbjct: 423 VGSNFYAS--PSSTNGAFSRGGVLYFALLFYSLMGLANI--SFDDRHILQKHKGYSLYHP 478

Query: 617 SADAFASTFSDVPTKL 632
           SA+A AST S  P ++
Sbjct: 479 SAEAIASTVSSFPFRM 494

 Score =  107 bits (266), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 97/408 (23%), Positives = 188/408 (46%), Gaps = 53/408 (12%)

Query: 939  RRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTM--GLITGDVFVDGRPRDQSF 996
            R+IL NV+   + G +  ++G  GAG ++ L   A  T    G +TG++  DG P+D+  
Sbjct: 60   RKILQNVNALAEAGEMVLVLGRPGAGCSSFLKVTAGETDQFAGGVTGEIAYDGIPQDEMM 119

Query: 997  PR---SIGYCQQQDLHLKTATVRESLRFSAYL----RQADDVSIEEKDKYVEEVIEVL-- 1047
             +    + Y  + D+H    TV+++L F+       ++ +DVS EE  K   E+   +  
Sbjct: 120  KKYRADVIYNGELDVHFPYLTVQQTLDFAIACKTPAKRVNDVSKEEYIKSTRELYATIFG 179

Query: 1048 -----EMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWS 1102
                   K+  D + GV G      +RKR++I   LAA   +  + D  T GLD+ TA  
Sbjct: 180  LRHTYNTKVGNDFVRGVSG-----GERKRVSIAEALAANGTIYCW-DNATRGLDASTALE 233

Query: 1103 TCQLMKKLASRGQAI-LCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYF 1161
              + ++ + +  ++    TI+Q S  + + FD++  L  G Q +Y+G + +      +YF
Sbjct: 234  YAKAIRIMTNLLKSTAFVTIYQASENIYETFDKVTVLYSGRQ-IYYGPIHEAK----DYF 288

Query: 1162 EAHGAHKCPPDANPAEWMLEIVGA------APG-----THASQDYFAIWRDSEEYREMQK 1210
               G + CPP    AE++  +          PG        ++++   W +S+EY +++ 
Sbjct: 289  AQMG-YLCPPRQVTAEFLTALTDPNGYHEIKPGYEHKVPRTAEEFEKYWLESDEYAKLRS 347

Query: 1211 ELDWME--------RELPKRT----EGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPF 1258
            +++  +        REL K +    +     ++  F  S + Q+KL + R F + +    
Sbjct: 348  DINTYKSTVDTEKTRELYKESMADEKAKGTRKKSYFTISYMEQVKLCTIRGFQRIYGNKA 407

Query: 1259 YLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPIL 1306
            Y      S+++    +G  F+ + +S  G  ++   +  F ++F  ++
Sbjct: 408  YTVINVSSSVIQAFIVGSNFYASPSSTNGAFSRG-GVLYFALLFYSLM 454

>YOR011W (AUS1) [4826] chr15 (349678..353862) Protein involved in
            sterol uptake and anaerobic growth, member of the
            ATP-binding cassette (ABC) superfamily of membrane
            transporters [4185 bp, 1394 aa]
          Length = 1394

 Score =  370 bits (949), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 216/630 (34%), Positives = 351/630 (55%), Gaps = 48/630 (7%)

Query: 922  IFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLI 981
            I  WKN+ Y +    G +++++N  G++  G LTAL+G SGAGKTTLL+ L++R   G++
Sbjct: 750  IISWKNINYTV----GTKKLINNASGFISSG-LTALMGESGAGKTTLLNVLSQRVETGVV 804

Query: 982  TGDVFVDGRP--RDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKY 1039
            +G++ +DG P   + +F RSIG+ QQQDLHL   +V+ESL  S  LR   D +      Y
Sbjct: 805  SGEILIDGHPLTDEDAFKRSIGFVQQQDLHLDLLSVKESLEISCLLRGDGDRA------Y 858

Query: 1040 VEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQT 1099
            ++ V  +L  KL +D +V      LN  QRK L+IGVEL  KP LL+FLDEPTSGLD++ 
Sbjct: 859  LDTVSNLL--KLPSDILVA----DLNPTQRKLLSIGVELVTKPSLLLFLDEPTSGLDAEA 912

Query: 1100 AWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMIN 1159
            A +  + +K+L+ +GQAI CTIHQPS  ++  FD +  L+ GG+ V+FG +   C     
Sbjct: 913  ALTIVKFLKQLSLQGQAIFCTIHQPSKSVISHFDNIFLLKRGGECVFFGPMDDAC----G 968

Query: 1160 YFEAHGAHKC--PPDANPAEWMLEIVG---AAPGTHASQ----------DYFAIWRDSEE 1204
            YF +H           NPA+++++ VG   ++ G   ++          D+ A+W  S E
Sbjct: 969  YFMSHDNTLVYDKEHDNPADFVIDAVGNSNSSAGKDTAEEALTLNKEAIDWSALWESSVE 1028

Query: 1205 YREMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKF 1264
             + ++KE   +E +   R  G           S L Q+ L++ R +    R   Y+ +K+
Sbjct: 1029 KKLVKKETARLEDD--ARASGVDYTTSLWKQPSYLQQLALITRRQYICTKRDMTYVMAKY 1086

Query: 1265 FSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARE 1324
                 + LFIGF+F+    ++ GLQ+ +   FM   V +P++ Q     ++ +E+Y ARE
Sbjct: 1087 CLNGGAGLFIGFSFWHIKHNIIGLQDSIFFCFMALCVSSPLINQIQDKALKTKEVYVARE 1146

Query: 1325 RPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLF 1384
              S T+ W   ++SQ ++E+P  L + T+ F   ++  GF  NA ++        +F+L 
Sbjct: 1147 ARSNTYHWTVLLLSQSIIELPLALTSSTLFFVCAFFSCGF-NNAGWS------AGVFFLN 1199

Query: 1385 ACAFYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVS 1444
               F  Y S++G+ +I      + AA   +  +  + SFCGV+   ++ P FW FMYRVS
Sbjct: 1200 YMLFAAYYSTLGLWLIYTAPNLQTAAVFVAFIYSFTASFCGVMQPYSLFPTFWKFMYRVS 1259

Query: 1445 PLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSET 1504
            P TY ++  +S+ L N  + C  +E++   P +G +C ++ME +++  G GYL + ++ T
Sbjct: 1260 PYTYFVETFVSILLHNWEIKCDMSEMVPGQPLTGQSCGQFMEAFIEEYG-GYLHNKNTFT 1318

Query: 1505 ECHFCQFSSTNDYLATVSSSYSRRWMNYGI 1534
             C +C ++  +D+L   + SY   W N+GI
Sbjct: 1319 VCAYCTYTVGDDFLKNENMSYDHVWRNFGI 1348

 Score =  257 bits (657), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 183/613 (29%), Positives = 284/613 (46%), Gaps = 50/613 (8%)

Query: 206 GELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAES 265
           GE+++VLG P    +TL K++         SP   I +     K        +++YN E 
Sbjct: 59  GEMVLVLGYP---TSTLFKTLFHGKTSLSYSPPGSIKFKNNEFKSFSEKCPHQIIYNNEQ 115

Query: 266 DIHIPHLTVFQTL--YTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGN 323
           D+H P LTV QT+      +   P+      +RD     +    +  +GLSH   T VGN
Sbjct: 116 DVHFPFLTVEQTIDFALSCKFDIPKG-----ERDQIRNEL----LREFGLSHVLKTIVGN 166

Query: 324 DFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAAT 383
           DF RGVSGGERKR+SI E  I       WDN+T+GLDSATAL+F++ L+  A  T+S   
Sbjct: 167 DFFRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSATALDFLEILRKMAKATRSVNL 226

Query: 384 VAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQ-RMGYVCPERQTTADYLTSIT 442
           V I Q S    D FDK+ +L D YQ+F+G   +   YF+  +G          +YLTSI 
Sbjct: 227 VRISQASDKIVDKFDKILMLSDSYQLFYGTVDECLTYFRDTLGIEKDPNDCIIEYLTSIL 286

Query: 443 SPSERIKDKDMVKH--GIMIPQTA------------YEMNQYWIQSEEYKQLQVQVNKHL 488
           +   + K+   + +     + +TA            +++   W  S  Y+ +        
Sbjct: 287 NFQFKNKNLGNLSNSSSASVLKTATGEVTKYTYNSDFDLYDQWKHSSYYRNI-------- 338

Query: 489 DTDSSQQREQIKNAHIAKQSKRARPS--SP-YTVSFFLQVKYILIRDIWRIKNDPSIQLF 545
                  ++QI+ + I    K   PS  SP + +    Q+ +   R   R   D +    
Sbjct: 339 -------KQQIQGSSIDDSIKEVDPSDVSPIFNIPLKKQLLFCTKRAFQRSLGDKAYMTA 391

Query: 546 TVLSHAAMALILGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPIT 605
             +S    +L++GS+FYE+ L+T  +  Y RG                ++   ++ +P+ 
Sbjct: 392 QFISVVIQSLVIGSLFYEIPLTTIGS--YSRGSLTFFSILFFTFLSLADMPIAFQRQPVV 449

Query: 606 EKHKTYSLYRPSADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIIT 665
           +K      Y    +  ++T  D   KL   + F+I  YFL +L+  A  FF + L     
Sbjct: 450 KKQSQLHFYTNWVETLSTTVFDYCFKLCLVIVFSIILYFLAHLQYKAARFFIFLLFLSFY 509

Query: 666 VFAMSHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSY 725
            F M  LF     V+ T+  A + A +LLLA AMY  + I    M  W  WI+Y+NP  Y
Sbjct: 510 NFCMVSLFALTTLVAPTISVANLFAGILLLAIAMYASYVIYLKNMHPWFVWIAYLNPAMY 569

Query: 726 LFESLMINEFHGRNFPCAQYI-PSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTNY 784
             E+++ NE +     C++ I P GP Y +       C+  G+  GN+YV G D+++   
Sbjct: 570 AMEAILSNELYNLKLDCSETIVPRGPTYNDVPFSHKACAWQGATLGNDYVRGRDYLKQGL 629

Query: 785 GYRHKNKWRSVGI 797
            Y + + WR+ GI
Sbjct: 630 SYTYHHVWRNFGI 642

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 118/568 (20%), Positives = 229/568 (40%), Gaps = 61/568 (10%)

Query: 997  PRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAI 1056
            P  I Y  +QD+H    TV +++ F+  L    D+   E+D+   E++    +      I
Sbjct: 106  PHQIIYNNEQDVHFPFLTVEQTIDFA--LSCKFDIPKGERDQIRNELLREFGLSHVLKTI 163

Query: 1057 VGVPG-EGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQ 1115
            VG     G++  +RKR++I     A   + ++ D  T GLDS TA    ++++K+A   +
Sbjct: 164  VGNDFFRGVSGGERKRISIIETFIANGSVYLW-DNSTKGLDSATALDFLEILRKMAKATR 222

Query: 1116 AI-LCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGAHKCPPDAN 1174
            ++ L  I Q S  ++ +FD++L L +  Q  Y    G   + +  + +  G  K P D  
Sbjct: 223  SVNLVRISQASDKIVDKFDKILMLSDSYQLFY----GTVDECLTYFRDTLGIEKDPNDC- 277

Query: 1175 PAEWMLEIVG---------------------AAPG-----THASQ-DYFAIWRDSEEYRE 1207
              E++  I+                       A G     T+ S  D +  W+ S  YR 
Sbjct: 278  IIEYLTSILNFQFKNKNLGNLSNSSSASVLKTATGEVTKYTYNSDFDLYDQWKHSSYYRN 337

Query: 1208 MQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFST 1267
            +++++     +   + E   ++    F      Q+   + R F +      Y+ ++F S 
Sbjct: 338  IKQQIQGSSIDDSIK-EVDPSDVSPIFNIPLKKQLLFCTKRAFQRSLGDKAYMTAQFISV 396

Query: 1268 IVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPS 1327
            ++  L IG  F++   +  G  ++    F   + F  +    +P+  Q++ + + + +  
Sbjct: 397  VIQSLVIGSLFYEIPLTTIGSYSRGSLTFFSILFFTFLSLADMPIAFQRQPVVKKQSQLH 456

Query: 1328 RTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACA 1387
               +W   + + +        L    +  +Y+     Y+ A +   L       +     
Sbjct: 457  FYTNWVETLSTTVFDYCFKLCLVIVFSIILYFLAHLQYKAARFFIFLLFLSFYNFCMVSL 516

Query: 1388 FYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLT 1447
            F     ++  LV   I +A   A +  L   M  S+  V+   N+ P F +++  ++P  
Sbjct: 517  F-----ALTTLVAPTISVANLFAGILLLAIAMYASY--VIYLKNMHPWF-VWIAYLNPAM 568

Query: 1448 YLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSETECH 1507
            Y ++A+LS  L N  + CS     + + P G T ++    +      G  L         
Sbjct: 569  YAMEAILSNELYNLKLDCS-----ETIVPRGPTYNDVPFSHKACAWQGATLGN------- 616

Query: 1508 FCQFSSTNDYLAT-VSSSYSRRWMNYGI 1534
               +    DYL   +S +Y   W N+GI
Sbjct: 617  --DYVRGRDYLKQGLSYTYHHVWRNFGI 642

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 137/647 (21%), Positives = 241/647 (37%), Gaps = 99/647 (15%)

Query: 194  QILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKN 253
            +++    G I+ G L  ++G  GAG TTLL  +S       +S + +I  +  ++++   
Sbjct: 764  KLINNASGFISSG-LTALMGESGAGKTTLLNVLSQRVETGVVSGEILIDGHPLTDED--- 819

Query: 254  HYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGL 313
             ++  + +  + D+H+  L+V ++L     L+   +R      DT +  +          
Sbjct: 820  AFKRSIGFVQQQDLHLDLLSVKESLEISCLLRGDGDR---AYLDTVSNLL---------- 866

Query: 314  SHTADTKVGND-FVRGVSGGERKRVSIA-EVSICGSKFQCWDNATRGLDSATALEFIKAL 371
                  K+ +D  V  ++  +RK +SI  E+    S     D  T GLD+  AL  +K L
Sbjct: 867  ------KLPSDILVADLNPTQRKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVKFL 920

Query: 372  KTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQ-IFFGPSKQAKKYFQRMGYVC-- 428
            K Q ++   A    I+Q SK     FD + +L  G + +FFGP   A  YF         
Sbjct: 921  K-QLSLQGQAIFCTIHQPSKSVISHFDNIFLLKRGGECVFFGPMDDACGYFMSHDNTLVY 979

Query: 429  -PERQTTADYLTSITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKH 487
              E    AD++      S     KD  +  + + + A + +  W                
Sbjct: 980  DKEHDNPADFVIDAVGNSNSSAGKDTAEEALTLNKEAIDWSALW---------------- 1023

Query: 488  LDTDSSQQREQIKNAHIAKQSKRARPSS-PYTVSFFLQVKY------ILIRDIWRIKNDP 540
               +SS +++ +K    A+    AR S   YT S + Q  Y      I  R     K D 
Sbjct: 1024 ---ESSVEKKLVKK-ETARLEDDARASGVDYTTSLWKQPSYLQQLALITRRQYICTKRDM 1079

Query: 541  SIQLFTVLSHAAMALILGSMFYEV---MLSTTTTTFYYRGXXXXXX----XXXXXXXXXX 593
            +  +     +    L +G  F+ +   ++    + F+                       
Sbjct: 1080 TYVMAKYCLNGGAGLFIGFSFWHIKHNIIGLQDSIFFCFMALCVSSPLINQIQDKALKTK 1139

Query: 594  EIFSLYETRPITEKHKTYSLYRPSADAFASTFSDVPTKLATAVTFNIPYYF---LINLKR 650
            E++   E R  T        Y  +    + +  ++P  L ++  F +  +F     N   
Sbjct: 1140 EVYVAREARSNT--------YHWTVLLLSQSIIELPLALTSSTLFFVCAFFSCGFNNAGW 1191

Query: 651  DAGAFFFYFLINIITVFAM--SHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRV 708
             AG FF  +++     FA   S L   +   +  L  A V  + +    A + G   P  
Sbjct: 1192 SAGVFFLNYML-----FAAYYSTLGLWLIYTAPNLQTAAVFVAFIYSFTASFCGVMQPYS 1246

Query: 709  QMLGWSKWISYINPLSYLFESLMINEFHGRNFPC--AQYIPSGPNYVNATGD--EVTCSA 764
                + K++  ++P +Y  E+ +    H     C  ++ +P  P    + G   E     
Sbjct: 1247 LFPTFWKFMYRVSPYTYFVETFVSILLHNWEIKCDMSEMVPGQPLTGQSCGQFMEAFIEE 1306

Query: 765  LGSIPGN----------NYVSGDDFIQT-NYGYRHKNKWRSVGIGLA 800
             G    N           Y  GDDF++  N  Y H   WR+ GI  A
Sbjct: 1307 YGGYLHNKNTFTVCAYCTYTVGDDFLKNENMSYDH--VWRNFGIEWA 1351

>Scas_643.1
          Length = 1289

 Score =  353 bits (906), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 212/575 (36%), Positives = 326/575 (56%), Gaps = 36/575 (6%)

Query: 922  IFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLI 981
            +  WKN+ Y I    G +++++NV G++  G LTAL+G SGAGKTTLL+ LA+R   G++
Sbjct: 744  LISWKNINYTI----GDKKLINNVSGFIGSG-LTALMGESGAGKTTLLNVLAQRIESGVV 798

Query: 982  TGDVFVDGRP--RDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKY 1039
            TG++ +DG+P   + +F RSIG+ QQQDLHL   TV+ESL  S  LR   D+      KY
Sbjct: 799  TGELLIDGKPLTNENAFRRSIGFVQQQDLHLDLLTVKESLEISCRLRGDGDM------KY 852

Query: 1040 VEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQT 1099
            +E +  +L  KL  + +V      L+  Q+K L+IGVEL  KP LL+FLDEPTSGLDS+ 
Sbjct: 853  LETISSLL--KLPMNKLVA----KLSPTQKKLLSIGVELVTKPSLLLFLDEPTSGLDSEA 906

Query: 1100 AWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMIN 1159
            A +  + +KKL+ +GQAI CTIHQPS  ++  FD +  L+ GG++V+FG     C   I+
Sbjct: 907  ALTIVKFLKKLSQQGQAIFCTIHQPSKSVISYFDNIFLLKRGGESVFFGPTKDACDYFIS 966

Query: 1160 YFEAHGAHKCPPDANPAEWMLEIVGAAPG----THASQDYFAIWRDSEEYREMQKELDWM 1215
              +         D NPA++++++VG             ++  IW +S E   ++ +L  +
Sbjct: 967  K-DPSLTFDSEYD-NPADFIIDVVGGTTQNEEIVEKENNWANIWENSFEKGAIENDLLSL 1024

Query: 1216 ERE-LPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFI 1274
            ERE L +  + S++  ++    S   Q+ L+S R +    R   Y+ +K+     + LFI
Sbjct: 1025 EREALSENVDYSTSVWEQP---SYWKQLLLISRRQYLCTKRDKTYVAAKYLLNSGAGLFI 1081

Query: 1275 GFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSRTFSWKA 1334
            GF+F+    +L GLQ+ +   FM   V +P++ Q     ++ +E++ ARE  S T+ W  
Sbjct: 1082 GFSFWNIKKNLSGLQDCIFFCFMALCVSSPLINQVQDKALKSKEVFIARESRSNTYHWSV 1141

Query: 1335 FIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACAFYVYISS 1394
             ++SQI++E+P  L + T+ F   Y+  GF       N  H  G +F+L    F  Y  +
Sbjct: 1142 LLLSQIIIEMPLALTSSTLFFLCAYFCCGF------DNSPHIAG-VFYLNYILFSAYYLT 1194

Query: 1395 MGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDALL 1454
             G+ +I      + AA   + F+  + SFCGV+    + P FW FMYRVSP TY ID  +
Sbjct: 1195 FGLWLIYAAPNLQTAAVFVAFFYSFTASFCGVMQPYGLFPGFWKFMYRVSPYTYFIDTFV 1254

Query: 1455 SVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYM 1489
            S+ L +  VVC + EL+   PP G TC ++M  Y+
Sbjct: 1255 SLLLHDREVVCGNMELVPGQPPVGQTCGQFMAAYI 1289

 Score =  275 bits (703), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 195/617 (31%), Positives = 291/617 (47%), Gaps = 48/617 (7%)

Query: 204 NPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNA 263
           N GE+++VLG+P    ++L KS+  +    + SP   I +     K   +    +++YN 
Sbjct: 68  NGGEMVLVLGKP---TSSLFKSLFRSKESLEYSPKGSIKFKTNEYKSYASKCPHQIIYNN 124

Query: 264 ESDIHIPHLTVFQTLYTVARLK---TPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTK 320
           E D+H P LTV QT+      K   T   RIK  D            +  +GLSH  DT 
Sbjct: 125 EQDVHFPFLTVQQTIDFALSCKFDITKNERIKIRDE----------LLREFGLSHVMDTV 174

Query: 321 VGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKS 380
           VGNDFVRGVSGGERKR+SI E  I       WDN+T+GLDS+TAL+F+  LK     TKS
Sbjct: 175 VGNDFVRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALDFLSILKKMTEATKS 234

Query: 381 AATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPE--RQTTADYL 438
              V I Q S    + FDK+ +L D YQ+F+G   +   YF R     P+       +YL
Sbjct: 235 VNLVKISQASDKIVNKFDKILMLSDSYQVFYGTVDECLIYF-RDTLAIPKNPNDCIIEYL 293

Query: 439 TSITS--------------PSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQV 484
           TSI +               S + K    V    + P +  ++   WI+S+ Y+  +  +
Sbjct: 294 TSILNLQFDNTDSSVASISSSTKGKITSHVTDLAVTPSSELDLYHLWIKSKNYQHWKNVI 353

Query: 485 NKHLDTDSSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQL 544
            K   + S+ +   +  A +    K + P+         Q++Y   R   R   D     
Sbjct: 354 TK---SSSTIESTSLNPADVTPVFKISLPT---------QIRYCTQRAFQRSLGDKIYLT 401

Query: 545 FTVLSHAAMALILGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPI 604
              +S    +L++GS+FY++ LST  +  Y RG                E+ + ++ +P+
Sbjct: 402 AQTISVIIQSLVIGSLFYDIPLSTLGS--YSRGSLTFFSILFFTFLSLAEMPAAFQRQPV 459

Query: 605 TEKHKTYSLYRPSADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINII 664
             K      Y    +  A+TF D   KL   + F+I  YFL +L+ +   FF + L   +
Sbjct: 460 VSKQAQLHFYYAWVETLATTFFDYTFKLLLVIIFSILLYFLAHLQYNGARFFIFLLFLAV 519

Query: 665 TVFAMSHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLS 724
             FAM  LF     +S TL  A + A +LLLA AMY  + I    M  W  WI+Y+NP  
Sbjct: 520 YNFAMVSLFSLATLISPTLSIANLLAGILLLAIAMYASYVIYLKDMHPWFVWIAYLNPAR 579

Query: 725 YLFESLMINEFHGRNFPCAQYI-PSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFIQTN 783
           Y  E+++ NE +     C   I P GP Y N +     C+  G+  GN+YV G D++  +
Sbjct: 580 YAMEAILANELYNLKLDCKDSIVPRGPTYDNVSFTRKACAWQGATLGNDYVRGRDYLSQS 639

Query: 784 YGYRHKNKWRSVGIGLA 800
             Y + + WR+ GI +A
Sbjct: 640 LHYSYSHVWRNFGIIIA 656

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 122/574 (21%), Positives = 228/574 (39%), Gaps = 73/574 (12%)

Query: 997  PRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAI 1056
            P  I Y  +QD+H    TV++++ F+  L    D++  E+ K  +E++    +    D +
Sbjct: 117  PHQIIYNNEQDVHFPFLTVQQTIDFA--LSCKFDITKNERIKIRDELLREFGLSHVMDTV 174

Query: 1057 VGVP-GEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQ 1115
            VG     G++  +RKR++I     A   + ++ D  T GLDS TA     ++KK+    +
Sbjct: 175  VGNDFVRGVSGGERKRISIIETFIANGSVYLW-DNSTKGLDSSTALDFLSILKKMTEATK 233

Query: 1116 AI-LCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGAHKCPPDAN 1174
            ++ L  I Q S  ++ +FD++L L +  Q  Y    G   + +I + +     K P D  
Sbjct: 234  SVNLVKISQASDKIVNKFDKILMLSDSYQVFY----GTVDECLIYFRDTLAIPKNPNDC- 288

Query: 1175 PAEWMLEIVG---------------------------AAPGTHASQDYFAIWRDSEEYRE 1207
              E++  I+                             A    +  D + +W  S+ Y+ 
Sbjct: 289  IIEYLTSILNLQFDNTDSSVASISSSTKGKITSHVTDLAVTPSSELDLYHLWIKSKNYQH 348

Query: 1208 MQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFST 1267
             +  +      + + T  +  +    F  S   QI+  + R F +      YL ++  S 
Sbjct: 349  WKNVITKSSSTI-ESTSLNPADVTPVFKISLPTQIRYCTQRAFQRSLGDKIYLTAQTISV 407

Query: 1268 IVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPS 1327
            I+  L IG  F+    S  G  ++    F   + F  +    +P   Q++ +   + +  
Sbjct: 408  IIQSLVIGSLFYDIPLSTLGSYSRGSLTFFSILFFTFLSLAEMPAAFQRQPVVSKQAQLH 467

Query: 1328 RTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACA 1387
              ++W   + +    +  + LL   I F +  Y         +   L   GA F++F   
Sbjct: 468  FYYAWVETLATTFF-DYTFKLLL-VIIFSILLY---------FLAHLQYNGARFFIFLLF 516

Query: 1388 FYVY------ISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMY 1441
              VY      + S+  L+   + IA   A +  L   M  S+  V+   ++ P F +++ 
Sbjct: 517  LAVYNFAMVSLFSLATLISPTLSIANLLAGILLLAIAMYASY--VIYLKDMHPWF-VWIA 573

Query: 1442 RVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGS 1501
             ++P  Y ++A+L+  L N  + C  +     + P G T              G  L   
Sbjct: 574  YLNPARYAMEAILANELYNLKLDCKDS-----IVPRGPTYDNVSFTRKACAWQGATLGN- 627

Query: 1502 SETECHFCQFSSTNDYLA-TVSSSYSRRWMNYGI 1534
                     +    DYL+ ++  SYS  W N+GI
Sbjct: 628  --------DYVRGRDYLSQSLHYSYSHVWRNFGI 653

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 104/230 (45%), Gaps = 25/230 (10%)

Query: 194 QILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKN 253
           +++  + G I  G L  ++G  GAG TTLL  ++       ++ + +I     +N+   N
Sbjct: 758 KLINNVSGFIGSG-LTALMGESGAGKTTLLNVLAQRIESGVVTGELLIDGKPLTNE---N 813

Query: 254 HYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGL 313
            +R  + +  + D+H+  LTV ++L    RL+           D   K++ E   +   L
Sbjct: 814 AFRRSIGFVQQQDLHLDLLTVKESLEISCRLRG----------DGDMKYL-ETISSLLKL 862

Query: 314 SHTADTKVGNDFVRGVSGGERKRVSIA-EVSICGSKFQCWDNATRGLDSATALEFIKALK 372
                    N  V  +S  ++K +SI  E+    S     D  T GLDS  AL  +K LK
Sbjct: 863 PM-------NKLVAKLSPTQKKLLSIGVELVTKPSLLLFLDEPTSGLDSEAALTIVKFLK 915

Query: 373 TQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQ-IFFGPSKQAKKYF 421
            + +    A    I+Q SK     FD + +L  G + +FFGP+K A  YF
Sbjct: 916 -KLSQQGQAIFCTIHQPSKSVISYFDNIFLLKRGGESVFFGPTKDACDYF 964

>Scas_145.1*
          Length = 258

 Score =  313 bits (803), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 147/238 (61%), Positives = 178/238 (74%), Gaps = 2/238 (0%)

Query: 595 IFSLYETRPITEKHKTYSLYRPSADAFASTFSD-VPTKLATAVTFNIPYYFLINLKRDAG 653
           I SLYE RPITEKH+TYSL+          F   +P  L  +V+  +   FL+N KRD G
Sbjct: 7   IISLYEARPITEKHRTYSLFIQVLMHLPQCFQKYLPNWLPPSVS-TLFTTFLVNFKRDGG 65

Query: 654 AFFFYFLINIITVFAMSHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGW 713
            FFFYFLI+I+  FA+SHLFRCIGS++KTL +AMVPAS+LLLA +MYTGFAIP  +MLGW
Sbjct: 66  VFFFYFLISIVATFALSHLFRCIGSLTKTLSEAMVPASILLLAISMYTGFAIPETKMLGW 125

Query: 714 SKWISYINPLSYLFESLMINEFHGRNFPCAQYIPSGPNYVNATGDEVTCSALGSIPGNNY 773
           SKWI YINPL+YLFESLMINEFH R FPCAQYIP GP YVNATG E  C+A+G++PG ++
Sbjct: 126 SKWIWYINPLAYLFESLMINEFHDRKFPCAQYIPMGPPYVNATGTERVCAAVGAVPGEDF 185

Query: 774 VSGDDFIQTNYGYRHKNKWRSVGIGLAXXXXXXXXXXXXCEYNEGAKQNGEMLVFPHS 831
           VSGD F++ +YGY+HK+KWR  G+G+A            CEYNEGAKQ GEML+FP S
Sbjct: 186 VSGDLFLRESYGYQHKHKWRGFGVGMAYVVFFFFVYLVLCEYNEGAKQKGEMLIFPQS 243

>Scas_108.1
          Length = 335

 Score =  246 bits (627), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 137/341 (40%), Positives = 192/341 (56%), Gaps = 11/341 (3%)

Query: 285 KTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSI 344
           KTP  R+  + +  + K   E+    +GL HT  TKVGNDFVRGVSGGERKRVSIAE  +
Sbjct: 3   KTPAKRVNNISKAEYVKTTRELYATIFGLRHTYHTKVGNDFVRGVSGGERKRVSIAEALV 62

Query: 345 CGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLY 404
                 CWDNATRGLD++TALE+ KA++    + +S A V IYQ S++ Y+ FDKV VLY
Sbjct: 63  ANGSVYCWDNATRGLDASTALEYAKAIRIMTNLLESTAFVTIYQASENIYETFDKVTVLY 122

Query: 405 DGYQIFFGPSKQAKKYFQRMGYVCPERQTTADYLTSITSPSERIKDKDMVKHGI--MIPQ 462
           DG QI++G   +A +YF  MGY  P RQ TA+YLT++T  +        ++ G    +P+
Sbjct: 123 DGRQIYYGGIHEATEYFTEMGYERPSRQATAEYLTALTDRN----GYHQIRPGFEDKVPR 178

Query: 463 TAYEMNQYWIQSEEYKQLQVQVNKH-LDTDSSQQREQIKNAHIAKQSKRARPSSPYTVSF 521
           +  E  +YW++S E+ QL+  +  +  + DS + RE    +   +++K  R  S YT+S+
Sbjct: 179 SVEEFERYWLESPEFAQLRADITSYKAEIDSQKTRELYNQSLAEEKAKGTRTKSYYTISY 238

Query: 522 FLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYEVMLSTTTTTFYYRGXXXX 581
             Q+K    R   RI  + +  +  V S    A I GS+FY+   S T+ +F   G    
Sbjct: 239 LEQIKLCTKRGFQRIYGNKAYTVINVSSSVIQAFIAGSLFYKSP-SDTSGSFSRSGVLYF 297

Query: 582 XXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFA 622
                         F   E RPI +KHK YSLY PSA+A A
Sbjct: 298 SLLFYSLMGLANITF---EHRPILQKHKNYSLYHPSAEALA 335

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 126/296 (42%), Gaps = 48/296 (16%)

Query: 1050 KLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKK 1109
            K+  D + GV G      +RKR++I   L A   +  + D  T GLD+ TA    + ++ 
Sbjct: 38   KVGNDFVRGVSGG-----ERKRVSIAEALVANGSVYCW-DNATRGLDASTALEYAKAIRI 91

Query: 1110 LASRGQAI-LCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGAHK 1168
            + +  ++    TI+Q S  + + FD++  L +G Q +Y+G    G      YF   G ++
Sbjct: 92   MTNLLESTAFVTIYQASENIYETFDKVTVLYDGRQ-IYYG----GIHEATEYFTEMG-YE 145

Query: 1169 CPPDANPAEWMLEIVGA------APG-----THASQDYFAIWRDSEEYREMQKELDWMER 1217
             P     AE++  +          PG       + +++   W +S E+ +++ ++   + 
Sbjct: 146  RPSRQATAEYLTALTDRNGYHQIRPGFEDKVPRSVEEFERYWLESPEFAQLRADITSYKA 205

Query: 1218 EL-PKRTEGSSNE---EQKEFATST--------LYQIKLVSYRLFHQYWRTPFYLWSKFF 1265
            E+  ++T    N+   E+K   T T        L QIKL + R F + +    Y      
Sbjct: 206  EIDSQKTRELYNQSLAEEKAKGTRTKSYYTISYLEQIKLCTKRGFQRIYGNKAYTVINVS 265

Query: 1266 STIVSELFIGFTFFKANTSLQG------------LQNQMLAIFMFTVVFNPILQQY 1309
            S+++     G  F+K+ +   G            L   ++ +   T    PILQ++
Sbjct: 266  SSVIQAFIAGSLFYKSPSDTSGSFSRSGVLYFSLLFYSLMGLANITFEHRPILQKH 321

>Scas_167.1*
          Length = 279

 Score =  234 bits (598), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 147/188 (78%), Gaps = 1/188 (0%)

Query: 918  KSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTT 977
            ++  +F W+++CY IP   G+R +LD+V G+  PGTLTAL+G SGAGKTTLL+ LA+R  
Sbjct: 92   EATGVFIWRDVCYTIPYDGGQRMLLDHVSGYCIPGTLTALMGESGAGKTTLLNTLAQRN- 150

Query: 978  MGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKD 1037
            +G+ITGD+ ++G P D SF R  GY QQQD+H+   TVRESL+FSA +R+A  +  EEK 
Sbjct: 151  VGIITGDMLINGHPIDASFERRTGYVQQQDIHIAELTVRESLQFSARMRRAQAIPDEEKM 210

Query: 1038 KYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDS 1097
             YVE++I+VL+M+ YA+A+VG  G GLNVEQRK+L+IGVEL AKP LL+FLDEPTSGLDS
Sbjct: 211  AYVEKIIQVLDMEYYAEALVGEIGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDS 270

Query: 1098 QTAWSTCQ 1105
            Q++W+  Q
Sbjct: 271  QSSWAIIQ 278

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 85/176 (48%), Gaps = 13/176 (7%)

Query: 195 ILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNH 254
           +L  + G   PG L  ++G  GAG TTLL +++    G  I+ D +I  NG     I   
Sbjct: 115 LLDHVSGYCIPGTLTALMGESGAGKTTLLNTLAQRNVGI-ITGDMLI--NGHP---IDAS 168

Query: 255 YRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLS 314
           +     Y  + DIHI  LTV ++L   AR++  +  I   ++  + + + +V      + 
Sbjct: 169 FERRTGYVQQQDIHIAELTVRESLQFSARMRRAQ-AIPDEEKMAYVEKIIQV----LDME 223

Query: 315 HTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCW-DNATRGLDSATALEFIK 369
           + A+  VG +  RG++  +RK++SI    +       + D  T GLDS ++   I+
Sbjct: 224 YYAEALVG-EIGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIIQ 278

>Scas_522.7
          Length = 633

 Score =  212 bits (539), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 114/340 (33%), Positives = 177/340 (52%), Gaps = 7/340 (2%)

Query: 1194 DYFAIWRDSEEYREMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQY 1253
            D+  +W +S E    ++E++ + R LP R      E    FA S L Q+K V  R   Q+
Sbjct: 236  DWHDLWLESPECAAAREEVEELHRVLPSRPTSDDPELAGTFAASFLTQMKCVLNRTNIQF 295

Query: 1254 WRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLF 1313
            WR+P Y+ +KF   +   LFIG ++     ++ G  +   ++FM  V+   ++ Q     
Sbjct: 296  WRSPIYIRAKFLECVSCALFIGLSYLNVKHTVGGATSAFSSMFMVLVIALAMINQLHVFA 355

Query: 1314 VQQRELYEARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQ 1373
               RELYE RE  S TF W   ++  ++VE  W ++     +  YY+P GF   AS+A  
Sbjct: 356  YDSRELYEVREAASNTFHWSVLLLCHMIVECGWTMICQFCCYICYYWPAGFSGRASHA-- 413

Query: 1374 LHERGALFWLFACAFYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNIL 1433
                G  F+ +   F +Y  S G+ ++       +A+ + S  F   L FCG+L      
Sbjct: 414  ----GFFFFFYVLIFPMYFVSYGLWILYMSPDVPSASMINSNLFAAMLLFCGILQPLAKA 469

Query: 1434 PRFWIFMYRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTG 1493
            PRFWIFM+R+SPL Y++ AL++  + N  V C ++ELL + PPSG  C EY+E Y+ S  
Sbjct: 470  PRFWIFMFRLSPLGYVVQALVTPLVHNKKVRCDAHELLVMDPPSGQNCGEYLETYI-SNN 528

Query: 1494 TGYLLDGSSETECHFCQFSSTNDYLATVSSSYSRRWMNYG 1533
            TGYL + S+   C +C ++  +D LA     +  RW N+G
Sbjct: 529  TGYLTNPSATENCGYCPYTIQDDALARFDIKWVYRWRNFG 568

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 11/87 (12%)

Query: 138 GCAWKDLSASGDSADITYQGTFGNMPIKYLKMSWRCISRRLFHRTHGKSEDNDSGFQILK 197
           G   +D+SA G +A ++   T G++    L   +        H+ + +S  N    +IL+
Sbjct: 132 GVTLEDVSAEGINASMSEGRTVGDL----LAFPYT------IHK-YIRSMSNTKMRKILQ 180

Query: 198 PMDGCINPGELLVVLGRPGAGCTTLLK 224
             +    PGE+++VLGRPGAGC++ LK
Sbjct: 181 NCNALAKPGEMILVLGRPGAGCSSFLK 207

>Scas_664.27
          Length = 411

 Score =  206 bits (523), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 114/340 (33%), Positives = 177/340 (52%), Gaps = 7/340 (2%)

Query: 1194 DYFAIWRDSEEYREMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQY 1253
            D+  +W +S E    ++E++ + R LP R      E    FA S L Q+K V  R   Q+
Sbjct: 14   DWHDLWLESPECAAAREEVEELHRVLPSRPTSDDPELAGTFAASFLTQMKCVLNRTNIQF 73

Query: 1254 WRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLF 1313
            WR+P Y+ +KF   +   LFIG ++     ++ G  +   ++FM  V+   ++ Q     
Sbjct: 74   WRSPIYIRAKFLECVSCALFIGLSYLNVKHTVGGATSAFSSMFMVLVIALAMINQLHVFA 133

Query: 1314 VQQRELYEARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQ 1373
               RELYE RE  S TF W   ++  ++VE  W ++     +  YY+P GF   AS+A  
Sbjct: 134  YDSRELYEVREAASNTFHWSVLLLCHMIVECGWTMICQFCCYICYYWPAGFSGRASHA-- 191

Query: 1374 LHERGALFWLFACAFYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNIL 1433
                G  F+ +   F +Y  S G+ ++       +A+ + S  F   L FCG+L      
Sbjct: 192  ----GFFFFFYVLIFPMYFVSYGLWILYMSPDVPSASMINSNLFAAMLLFCGILQPLAKA 247

Query: 1434 PRFWIFMYRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTG 1493
            PRFWIFM+R+SPL Y++ AL++  + N  V C ++ELL + PPSG  C EY+E Y+ S  
Sbjct: 248  PRFWIFMFRLSPLGYVVQALVTPLVHNKKVRCDAHELLVMDPPSGQNCGEYLETYI-SNN 306

Query: 1494 TGYLLDGSSETECHFCQFSSTNDYLATVSSSYSRRWMNYG 1533
            TGYL + S+   C +C ++  +D LA     +  RW N+G
Sbjct: 307  TGYLTNPSATENCGYCPYTIQDDALARFDIKWVYRWRNFG 346

>AER190W [2692] [Homologous to ScYCR011C (ADP1) - SH; ScYOL075C - SH]
            complement(994534..997569) [3036 bp, 1011 aa]
          Length = 1011

 Score =  198 bits (504), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 170/611 (27%), Positives = 290/611 (47%), Gaps = 86/611 (14%)

Query: 912  DDIELSKSQAIFHWKNLCYDI-PIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLD 970
            +D   S S A   ++NLCY + P ++   RIL+++ G+V PG + A++G SGAGKT LLD
Sbjct: 353  EDFLKSGSMATLTFENLCYKVFPSRSSPVRILNSISGYVSPGEILAVMGGSGAGKTCLLD 412

Query: 971  CLAERTTMGLITGDVFVDGRP-RDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQAD 1029
             L  +   G ++G V ++G P    +  + +G+  Q +  L T TV E++  SA LR   
Sbjct: 413  ILGMKNKAGEVSGTVKINGVPITKHTVSKVVGFVDQDNHLLPTLTVYETVLNSALLRLPR 472

Query: 1030 DVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGE-GLNVEQRKRLTIGVELAAKPKLLVFL 1088
             +S   K K V +V+E L +    D ++G   E G++  +++R++I  EL   P L++FL
Sbjct: 473  SMSFAAKQKRVYQVLEELRIFDIRDRLIGNDFERGISGGEKRRVSIACELVTSP-LILFL 531

Query: 1089 DEPTSGLDSQTAWSTCQLMKKLASR-GQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYF 1147
            DEPTSGLDS  A +  + + +LAS+  + ++ +IHQP + + + FD L+ L E G+ VY 
Sbjct: 532  DEPTSGLDSNNANNVIECLVRLASQYRRTLVLSIHQPRSNIFRLFDNLVLLNE-GEMVYS 590

Query: 1148 GELGKGCKTMINYFEAHGAHKCPPDANPAEWMLEIVGAAP-------------------- 1187
            G +     T +N F  +    CP D N A+++++I   +P                    
Sbjct: 591  GPI-----TRVNDFLRNTGFNCPSDYNIADYLIDINFMSPTAPSLENPDSADVEAEAGKS 645

Query: 1188 ----------GTHASQ---DYFAIWRDSEEYREMQK--------------ELDWMERELP 1220
                      G  ++Q   ++FA+ RD  E R M +               L  + +E  
Sbjct: 646  VENSLHVPELGRSSTQREWEHFALHRD--ELRSMLQTGEAAGAAGHMSSHNLSRLFKEGS 703

Query: 1221 KRTEGSSNEE--QKEFATSTL-----YQ-------IKLVSYRLFHQYWRTPFYLWSKFFS 1266
               E  S+ E   KE  ++ L     YQ       + +++ R F   +R P  L   +  
Sbjct: 704  HFGELLSHIEDVNKECHSNKLTLPSSYQGASFLQQLSILNSRSFKNIYRNPKLLIGNYVL 763

Query: 1267 TIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERP 1326
            T++  LF+G  ++     + G QN++   F     F  +    L  F Q+R ++  +ER 
Sbjct: 764  TVILGLFLGALYYGIENDISGFQNRLGLFFFVLTYFGFLTFTGLSSFAQERIIF-VKERS 822

Query: 1327 SRTFSWKAFIVSQILVEI-PWNLLAGTIAFFVYYYPVGF-YRNASYANQLHERGALFWLF 1384
            +  +S  AF VS++L +I P  ++   +   V Y  VG    N ++ N +     +  LF
Sbjct: 823  NNYYSPVAFYVSKVLSDILPLRVVPPILLCLVIYPLVGLNMSNGAFLNCI----GILVLF 878

Query: 1385 ACAFYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRF-WIFMYRV 1443
              +  + I ++G+      E   N+   + L  + SL FCG+      +  F + +M  +
Sbjct: 879  NLSISMEILAVGLF----FEDLNNSIVFSVLILLGSLLFCGLFVNTQRITNFAFRYMKNL 934

Query: 1444 SPLTYLIDALL 1454
            S   Y  +AL+
Sbjct: 935  SVFYYAYEALI 945

 Score =  152 bits (384), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 139/585 (23%), Positives = 250/585 (42%), Gaps = 56/585 (9%)

Query: 191 SGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKE 250
           S  +IL  + G ++PGE+L V+G  GAG T LL  + +     ++S    +  NG     
Sbjct: 379 SPVRILNSISGYVSPGEILAVMGGSGAGKTCLLDILGMKNKAGEVS--GTVKINGVP--- 433

Query: 251 IKNHYRGEVVYNAESDIHI-PHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEV--A 307
           I  H   +VV   + D H+ P LTV++T+   A L+ PR+        +FA     V   
Sbjct: 434 ITKHTVSKVVGFVDQDNHLLPTLTVYETVLNSALLRLPRSM-------SFAAKQKRVYQV 486

Query: 308 MATYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEF 367
           +    +    D  +GNDF RG+SGGE++RVSIA   +        D  T GLDS  A   
Sbjct: 487 LEELRIFDIRDRLIGNDFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDSNNANNV 546

Query: 368 IKALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYV 427
           I+ L   A+  +    ++I+Q   + + LFD + +L +G  ++ GP  +   + +  G+ 
Sbjct: 547 IECLVRLASQYRRTLVLSIHQPRSNIFRLFDNLVLLNEGEMVYSGPITRVNDFLRNTGFN 606

Query: 428 CPERQTTADYLTSI-----TSPS-ERIKDKDM-------VKHGIMIPQ-----TAYEMNQ 469
           CP     ADYL  I     T+PS E     D+       V++ + +P+     T  E   
Sbjct: 607 CPSDYNIADYLIDINFMSPTAPSLENPDSADVEAEAGKSVENSLHVPELGRSSTQREWEH 666

Query: 470 YWIQSEEYKQLQVQVNKHLDTDSSQQREQIKN------------AHIAKQSKRAR----- 512
           + +  +E + + +Q  +            +              +HI   +K        
Sbjct: 667 FALHRDELRSM-LQTGEAAGAAGHMSSHNLSRLFKEGSHFGELLSHIEDVNKECHSNKLT 725

Query: 513 -PSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYEVMLSTTTT 571
            PSS    SF  Q+  +  R    I  +P + +   +    + L LG+++Y +      +
Sbjct: 726 LPSSYQGASFLQQLSILNSRSFKNIYRNPKLLIGNYVLTVILGLFLGALYYGI--ENDIS 783

Query: 572 TFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFASTFSDV-PT 630
            F  R                  + S  + R I  K ++ + Y P A   +   SD+ P 
Sbjct: 784 GFQNRLGLFFFVLTYFGFLTFTGLSSFAQERIIFVKERSNNYYSPVAFYVSKVLSDILPL 843

Query: 631 KLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTLPQAMVPA 690
           ++   +   +  Y L+ L    GAF     I ++   ++S     +G   + L  ++V +
Sbjct: 844 RVVPPILLCLVIYPLVGLNMSNGAFLNCIGILVLFNLSISMEILAVGLFFEDLNNSIVFS 903

Query: 691 SVLLLAFAMYTGFAIPRVQMLGWS-KWISYINPLSYLFESLMINE 734
            ++LL   ++ G  +   ++  ++ +++  ++   Y +E+L+INE
Sbjct: 904 VLILLGSLLFCGLFVNTQRITNFAFRYMKNLSVFYYAYEALIINE 948

>KLLA0D04554g complement(385733..388801) similar to sp|P25371
            Saccharomyces cerevisiae YCR011c ADP1 ATP-dependent
            permease, start by similarity
          Length = 1022

 Score =  194 bits (493), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 151/553 (27%), Positives = 259/553 (46%), Gaps = 84/553 (15%)

Query: 917  SKSQAIFHWKNLCYDI-PIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAER 975
            + S A   ++N+ Y++ P KN    +L+ V G VKPG + A++G SGAGKTTLLD LA +
Sbjct: 364  TNSSATLTFENITYEVSPAKNVTADVLNEVTGSVKPGEMLAIMGGSGAGKTTLLDILAMK 423

Query: 976  TTMGLITGDVFVDGRPRDQ-SFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIE 1034
               G +TG + V+G   D+  + + IG+  Q+D  L T TV E++  SA LR    +S  
Sbjct: 424  NKTGKVTGSIKVNGVDIDKDKYSKIIGFVDQEDYLLPTLTVYETVLNSALLRLPRQLSFS 483

Query: 1035 EKDKYVEEVIEVLEMKLYADAIVGVPGE-GLNVEQRKRLTIGVELAAKPKLLVFLDEPTS 1093
             K + V +V+E L +    D ++G   E G++  +++R++I  EL   P++L FLDEPTS
Sbjct: 484  AKQRRVYDVLEELRIFDIRDRVIGSEYERGISGGEKRRVSIACELVTSPQVL-FLDEPTS 542

Query: 1094 GLDSQTAWSTCQLMKKLASR-GQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGK 1152
            GLD+  A +  + + +LA+   + ++ +IHQP + + Q FD+L+ L   G+ VY G+  K
Sbjct: 543  GLDANNANNVIECLVRLANHYNKTLVLSIHQPRSSIFQLFDKLVLLSN-GKMVYSGDAHK 601

Query: 1153 GCKTMINYFEAHGAHKCPPDANPAEWMLEIV-----------------------GAAP-- 1187
                 +N F  +  + CPPD N A++++++                        G  P  
Sbjct: 602  -----VNEFLKNEGYACPPDYNIADYLIDVTFEPSKFVTRANIDDLEATLPTTEGLNPVH 656

Query: 1188 ------------GTHASQDYFAIWRDSEEYREMQKE------------------------ 1211
                         T    ++ A+ RD  E+R++  +                        
Sbjct: 657  RVEPHRRSLTGSPTQTEWEHLALHRD--EFRDLLSQSENEGQTVGDVNTHLLHSLFKDGA 714

Query: 1212 -LDWMERELPKRTEGSSNEE----QKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFS 1266
                ++ E+ +      NEE    Q   A + L Q+ ++S R F    R P  L   +  
Sbjct: 715  YFQKLKFEINEILSAGINEELRIPQAYKAATFLQQLSILSSRTFKNVCRNPKLLLGNYVL 774

Query: 1267 TIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERP 1326
            T+   LF+G  ++     + G QN++   F     F  +    L  F  +R ++  +ER 
Sbjct: 775  TVALGLFLGILYYNVENDISGFQNRLGLFFFILTYFGFLTFTGLSSFSLERLIF-IKERS 833

Query: 1327 SRTFSWKAFIVSQILVE-IPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFA 1385
            +  +S  A+ +S+IL + IP  ++   +   + Y  VG   N    N   +   +  LF 
Sbjct: 834  NHYYSPLAYYISKILSDIIPLRVVPPILLGLILYPLVGLNMN---DNGFFKFEGILILFN 890

Query: 1386 CAFYVYISSMGVL 1398
             A  + I ++G++
Sbjct: 891  LAISLEILTVGII 903

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 138/584 (23%), Positives = 245/584 (41%), Gaps = 57/584 (9%)

Query: 195 ILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNH 254
           +L  + G + PGE+L ++G  GAG TTLL  +++     K++    I  NG      K+ 
Sbjct: 389 VLNEVTGSVKPGEMLAIMGGSGAGKTTLLDILAMKNKTGKVTGS--IKVNGVDID--KDK 444

Query: 255 YRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEV--AMATYG 312
           Y   + +  + D  +P LTV++T+   A L+ PR         +F+     V   +    
Sbjct: 445 YSKIIGFVDQEDYLLPTLTVYETVLNSALLRLPRQL-------SFSAKQRRVYDVLEELR 497

Query: 313 LSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALK 372
           +    D  +G+++ RG+SGGE++RVSIA   +   +    D  T GLD+  A   I+ L 
Sbjct: 498 IFDIRDRVIGSEYERGISGGEKRRVSIACELVTSPQVLFLDEPTSGLDANNANNVIECLV 557

Query: 373 TQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQ 432
             A        ++I+Q     + LFDK+ +L +G  ++ G + +  ++ +  GY CP   
Sbjct: 558 RLANHYNKTLVLSIHQPRSSIFQLFDKLVLLSNGKMVYSGDAHKVNEFLKNEGYACPPDY 617

Query: 433 TTADYLTSIT-SPSERIKDKDMVKHGIMIPQTA---------------------YEMNQY 470
             ADYL  +T  PS+ +   ++      +P T                       E    
Sbjct: 618 NIADYLIDVTFEPSKFVTRANIDDLEATLPTTEGLNPVHRVEPHRRSLTGSPTQTEWEHL 677

Query: 471 WIQSEEYKQLQVQ----------VNKHL------DTDSSQQRE-QIKNAHIAKQSKRARP 513
            +  +E++ L  Q          VN HL      D    Q+ + +I     A  ++  R 
Sbjct: 678 ALHRDEFRDLLSQSENEGQTVGDVNTHLLHSLFKDGAYFQKLKFEINEILSAGINEELRI 737

Query: 514 SSPYTVSFFLQVKYIL-IRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYEVMLSTTTTT 572
              Y  + FLQ   IL  R    +  +P + L   +   A+ L LG ++Y V      + 
Sbjct: 738 PQAYKAATFLQQLSILSSRTFKNVCRNPKLLLGNYVLTVALGLFLGILYYNV--ENDISG 795

Query: 573 FYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFASTFSD-VPTK 631
           F  R                  + S    R I  K ++   Y P A   +   SD +P +
Sbjct: 796 FQNRLGLFFFILTYFGFLTFTGLSSFSLERLIFIKERSNHYYSPLAYYISKILSDIIPLR 855

Query: 632 LATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTLPQAMVPAS 691
           +   +   +  Y L+ L  +   FF +  I I+   A+S     +G + + L  +++ + 
Sbjct: 856 VVPPILLGLILYPLVGLNMNDNGFFKFEGILILFNLAISLEILTVGIIFEDLNNSIIISV 915

Query: 692 VLLLAFAMYTGFAIPRVQMLG-WSKWISYINPLSYLFESLMINE 734
           +++L   +++G  I    +     K++  ++   Y +ESL+INE
Sbjct: 916 LIILGSLLFSGLFINTKDINNILFKYLKNLSVFYYAYESLIINE 959

>Kwal_0.327
          Length = 1019

 Score =  189 bits (480), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 161/607 (26%), Positives = 285/607 (46%), Gaps = 88/607 (14%)

Query: 920  QAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMG 979
            ++   ++N+ Y+I  + G+R IL+ + G VKPG + AL+G SGAGKTTLLD LA +   G
Sbjct: 363  KSTLTFENIEYNIRSEKGERMILNGISGSVKPGEIMALMGGSGAGKTTLLDILAMKDKAG 422

Query: 980  LITGDVFVDGRP-RDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDK 1038
              +G + ++G     Q+  +  G+  Q++  L T TV E++  SA LR    +S  +K K
Sbjct: 423  KASGSIKINGSEITKQNLSKIAGFVDQENFLLPTLTVYETVLNSALLRLPRKLSFVQKQK 482

Query: 1039 YVEEVIEVLEMKLYADAIVGVPGE-GLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDS 1097
             V +V+E L +    D I+G   E G++  +++R++I  EL   P +L FLDEPTSGLDS
Sbjct: 483  RVYQVLEELRILDIKDRIIGDDLERGISGGEKRRVSIACELVTSPSVL-FLDEPTSGLDS 541

Query: 1098 QTAWSTCQLMKKLASR-GQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKT 1156
              A +  + + +LA    + ++ +IHQP + + + FD+L+ L + G+ V+      G  T
Sbjct: 542  NNANNVIECLVRLALHYNRTLILSIHQPRSNIFKSFDKLVLLSQ-GEMVF-----SGVAT 595

Query: 1157 MINYFEAHGAHKCPPDANPAEWMLEI---------------------------------- 1182
             ++ F  +  + CP D N A+++++I                                  
Sbjct: 596  DVSEFLRNNGYNCPSDYNIADYLIDITFETRKPLTALTSGPDDLESNIHSNHNHEIGLDE 655

Query: 1183 -VGAAPGTHASQ---DYFAIWRDS-------------------------EEYREMQKELD 1213
             +G    T A+Q   +++A+ RD                           ++RE Q    
Sbjct: 656  PIGRKDSTVATQREWEHYAVHRDELRSLLDQAADTGNDIQGFLNTQVLHAKFREGQYFST 715

Query: 1214 WMER-ELPKRTEGSSNEEQKEFATSTLY--QIKLVSYRLFHQYWRTPFYLWSKFFSTIVS 1270
             +E  E  K +  S  EE    + S  +  Q+ ++S R F   +R P  L   +  TI  
Sbjct: 716  LIEDIENTKASSVSGGEEMPISSMSASFKEQLTILSSRTFKNIYRNPKLLLGNYVVTIFM 775

Query: 1271 ELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEARERPSRTF 1330
              F+G  ++    ++ G QN++   F     F  +    L  F  +R ++  +ER +  +
Sbjct: 776  GCFLGSLYYNVENNISGFQNRLGLFFFILTYFGFLTFTGLTSFSLERIIF-LKERSNNYY 834

Query: 1331 SWKAFIVSQILVEI-PWNLLAGTIAFFVYYYPVGF-YRNASYANQLHERGALFWLFACAF 1388
            S  A+ +S+IL ++ P  ++   +   V Y  VG    N ++   +    A+  LF    
Sbjct: 835  SPMAYYISKILSDVLPLRVIPPILLALVVYPTVGLNMSNGAFFKFV----AILVLFNVGI 890

Query: 1389 YVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGV-LATPNILPRFWIFMYRVSPLT 1447
             + I ++G+LV    E   N+  ++ L  + SL F G+ + T +I    + ++  +S   
Sbjct: 891  SLEILTVGILV----EDLNNSIVISVLILLASLLFSGLFINTKDISNVAFKYLKNLSIFY 946

Query: 1448 YLIDALL 1454
            Y  ++L+
Sbjct: 947  YAYESLI 953

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 143/587 (24%), Positives = 242/587 (41%), Gaps = 61/587 (10%)

Query: 195 ILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNH 254
           IL  + G + PGE++ ++G  GAG TTLL  +++     K S    I  NG    EI   
Sbjct: 384 ILNGISGSVKPGEIMALMGGSGAGKTTLLDILAMKDKAGKASGS--IKING---SEITKQ 438

Query: 255 YRGEVV-YNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEV--AMATY 311
              ++  +  + +  +P LTV++T+   A L+ PR       + +F +    V   +   
Sbjct: 439 NLSKIAGFVDQENFLLPTLTVYETVLNSALLRLPR-------KLSFVQKQKRVYQVLEEL 491

Query: 312 GLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKAL 371
            +    D  +G+D  RG+SGGE++RVSIA   +        D  T GLDS  A   I+ L
Sbjct: 492 RILDIKDRIIGDDLERGISGGEKRRVSIACELVTSPSVLFLDEPTSGLDSNNANNVIECL 551

Query: 372 KTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPER 431
              A        ++I+Q   + +  FDK+ +L  G  +F G +    ++ +  GY CP  
Sbjct: 552 VRLALHYNRTLILSIHQPRSNIFKSFDKLVLLSQGEMVFSGVATDVSEFLRNNGYNCPSD 611

Query: 432 QTTADYL-----------TSITSPSERIKDKDMVKH----GIMIP--------QTAYEMN 468
              ADYL           T++TS  + ++      H    G+  P         T  E  
Sbjct: 612 YNIADYLIDITFETRKPLTALTSGPDDLESNIHSNHNHEIGLDEPIGRKDSTVATQREWE 671

Query: 469 QYWIQSEEYKQLQVQ-------VNKHLDTDSSQQR-----------EQIKNAHIAKQSK- 509
            Y +  +E + L  Q       +   L+T     +           E I+N   +  S  
Sbjct: 672 HYAVHRDELRSLLDQAADTGNDIQGFLNTQVLHAKFREGQYFSTLIEDIENTKASSVSGG 731

Query: 510 RARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYEVMLSTT 569
              P S  + SF  Q+  +  R    I  +P + L   +    M   LGS++Y V     
Sbjct: 732 EEMPISSMSASFKEQLTILSSRTFKNIYRNPKLLLGNYVVTIFMGCFLGSLYYNV--ENN 789

Query: 570 TTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFASTFSDV- 628
            + F  R                  + S    R I  K ++ + Y P A   +   SDV 
Sbjct: 790 ISGFQNRLGLFFFILTYFGFLTFTGLTSFSLERIIFLKERSNNYYSPMAYYISKILSDVL 849

Query: 629 PTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTLPQAMV 688
           P ++   +   +  Y  + L    GAFF +  I ++    +S     +G + + L  ++V
Sbjct: 850 PLRVIPPILLALVVYPTVGLNMSNGAFFKFVAILVLFNVGISLEILTVGILVEDLNNSIV 909

Query: 689 PASVLLLAFAMYTGFAIPRVQMLGWS-KWISYINPLSYLFESLMINE 734
            + ++LLA  +++G  I    +   + K++  ++   Y +ESL+INE
Sbjct: 910 ISVLILLASLLFSGLFINTKDISNVAFKYLKNLSIFYYAYESLIINE 956

>Scas_628.13
          Length = 1060

 Score =  165 bits (418), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 150/569 (26%), Positives = 258/569 (45%), Gaps = 88/569 (15%)

Query: 912  DDIELSKSQAIFHWKNLCYDIPIKNGKRR--------ILDNVDGWVKPGTLTALIGASGA 963
            D+   S++ A   ++N+ Y++P  N   +        +L ++DG VKPG + A++G SGA
Sbjct: 379  DNFLKSETSATLSFENITYEVPSLNKNHKSQPNSNVKVLKSIDGIVKPGQIFAIMGGSGA 438

Query: 964  GKTTLLDCLAERTTMGLITGDVFVDGRPRD-QSFPRSIGYCQQQDLHLKTATVRESLRFS 1022
            GKTTLLD LA +   G + G++ V+G     +S+ + IG+  Q D    T TV E++  S
Sbjct: 439  GKTTLLDILAMKRKTGQVGGEIKVNGNIMSRKSYSKLIGFVDQNDYLHPTLTVYETVLNS 498

Query: 1023 AYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGE-GLNVEQRKRLTIGVELAAK 1081
            A LR    +S E K   V +++E L +    D I+G   E G++  +++R++I  EL   
Sbjct: 499  ALLRLPRTMSFESKQSRVFQILEELRIFDIKDRIIGNDFERGISGGEKRRVSIACELVTS 558

Query: 1082 PKLLVFLDEPTSGLDSQTAWSTCQLMKKLASR-GQAILCTIHQPSALLMQEFDRLLFLQE 1140
            P L++FLDEPTSGLD+  A +    + +LA    + ++ TIHQP + +  +F++L+ L +
Sbjct: 559  P-LILFLDEPTSGLDANNANNVITSLVRLAKNYNRTLILTIHQPRSNIFNQFNKLVLLSQ 617

Query: 1141 G-----GQTVYFGEL--GKGCKTMINY----------FEAHGAHKCPP-----DANPAEW 1178
            G     G ++   E     G +  INY          +E+    K P      +  P + 
Sbjct: 618  GEMVFSGDSIKIHEFLYNNGYECPINYNIADYLIDITYESKKKVKKPSNLEDLEVGPLQI 677

Query: 1179 MLEIVGAAPGTHASQDYF-----AIWRDSEEYRE-MQKELDWMERELPKRTEGSSN---- 1228
              EI   +  + A Q        A W +   +RE +Q  L   + +  + T GS N    
Sbjct: 678  EGEIDPNSTDSVAKQGLRRSTTQAEWENFAAHREELQTILSTHDEDQEEETVGSLNTMIL 737

Query: 1229 --------------EEQKEF-ATST----------------------LYQIKLVSYRLFH 1251
                           E KE  AT T                      + Q+ ++  R F 
Sbjct: 738  HGKFVEGSYYGELLNEIKEVSATGTTSNTGRGSDVTGDMEIPKSATFIQQLSILCSRTFK 797

Query: 1252 QYWRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLP 1311
              +R P  L   F  TI+  +F+G  +++ +  + G QN+M   F     F  +    L 
Sbjct: 798  NIYRNPKLLIGNFALTILLSIFLGTLYYQLSNDISGFQNRMGLFFFMLTYFGFVTFTGLS 857

Query: 1312 LFVQQRELYEARERPSRTFSWKAFIVSQILVEI-PWNLLAGTIAFFVYYYPVGF-YRNAS 1369
             F  +R ++  +ER +  +S  A+  S+IL ++ P  ++   +   + Y   G   RN  
Sbjct: 858  SFSLERLIF-IKERSNNYYSPLAYYTSKILSDVLPLRVIPPILMAIIIYPMAGLNMRNEG 916

Query: 1370 YANQLHERGALFWLFACAFYVYISSMGVL 1398
            +   +     +  LF  +  + I ++G++
Sbjct: 917  FFKFI----GILILFNLSISLEILTIGII 941

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 143/617 (23%), Positives = 248/617 (40%), Gaps = 82/617 (13%)

Query: 179 FHRTHGKSEDNDSGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPD 238
            ++ H KS+ N S  ++LK +DG + PG++  ++G  GAG TTLL  +++     ++  +
Sbjct: 402 LNKNH-KSQPN-SNVKVLKSIDGIVKPGQIFAIMGGSGAGKTTLLDILAMKRKTGQVGGE 459

Query: 239 TIITYNGFSNKEIKNHYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDT 298
             +  N  S K     Y   + +  ++D   P LTV++T+   A L+ PR         +
Sbjct: 460 IKVNGNIMSRKS----YSKLIGFVDQNDYLHPTLTVYETVLNSALLRLPRTM-------S 508

Query: 299 FAKHMTEV--AMATYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNAT 356
           F    + V   +    +    D  +GNDF RG+SGGE++RVSIA   +        D  T
Sbjct: 509 FESKQSRVFQILEELRIFDIKDRIIGNDFERGISGGEKRRVSIACELVTSPLILFLDEPT 568

Query: 357 RGLDSATALEFIKALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQ 416
            GLD+  A   I +L   A        + I+Q   + ++ F+K+ +L  G  +F G S +
Sbjct: 569 SGLDANNANNVITSLVRLAKNYNRTLILTIHQPRSNIFNQFNKLVLLSQGEMVFSGDSIK 628

Query: 417 AKKYFQRMGYVCPERQTTADYLTSITSPSERIKDK------------------------D 452
             ++    GY CP     ADYL  IT  S++   K                         
Sbjct: 629 IHEFLYNNGYECPINYNIADYLIDITYESKKKVKKPSNLEDLEVGPLQIEGEIDPNSTDS 688

Query: 453 MVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHLDTDSSQQREQIKNAH--------- 503
           + K G+    T  E   +    EE   LQ  ++ H   D  Q+ E + + +         
Sbjct: 689 VAKQGLRRSTTQAEWENFAAHREE---LQTILSTH---DEDQEEETVGSLNTMILHGKFV 742

Query: 504 -----------------IAKQSKRARPSS-------PYTVSFFLQVKYILIRDIWRIKND 539
                                S   R S        P + +F  Q+  +  R    I  +
Sbjct: 743 EGSYYGELLNEIKEVSATGTTSNTGRGSDVTGDMEIPKSATFIQQLSILCSRTFKNIYRN 802

Query: 540 PSIQLFTVLSHAAMALILGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLY 599
           P + +        +++ LG+++Y+  LS   + F  R                  + S  
Sbjct: 803 PKLLIGNFALTILLSIFLGTLYYQ--LSNDISGFQNRMGLFFFMLTYFGFVTFTGLSSFS 860

Query: 600 ETRPITEKHKTYSLYRPSADAFASTFSDV-PTKLATAVTFNIPYYFLINLKRDAGAFFFY 658
             R I  K ++ + Y P A   +   SDV P ++   +   I  Y +  L      FF +
Sbjct: 861 LERLIFIKERSNNYYSPLAYYTSKILSDVLPLRVIPPILMAIIIYPMAGLNMRNEGFFKF 920

Query: 659 FLINIITVFAMSHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWS-KWI 717
             I I+   ++S     IG + + L   ++ + ++LL   +++G  I    +   + K++
Sbjct: 921 IGILILFNLSISLEILTIGIIFEDLNNGIILSVLVLLGSLLFSGLFINTKDITNVAFKYL 980

Query: 718 SYINPLSYLFESLMINE 734
              +   Y +ESL+INE
Sbjct: 981 KNFSVFYYAYESLLINE 997

>CAGL0L07744g 849961..853128 similar to sp|P25371 Saccharomyces
            cerevisiae YCR011c ADP1 ATP-dependent permease, start by
            similarity
          Length = 1055

 Score =  152 bits (384), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 90/248 (36%), Positives = 148/248 (59%), Gaps = 10/248 (4%)

Query: 938  KRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGR-PRDQSF 996
            K+R+L+++ G VKPG + +++G SGAGKTTLLD LA +   G ++G + V+G+    + +
Sbjct: 389  KQRVLNDISGLVKPGEILSIMGGSGAGKTTLLDILAMKRKTGDVSGSIRVNGKVVSRKDY 448

Query: 997  PRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAI 1056
             + IG+  Q D  L T TV E++  SA LR    +S E K   V  V+E L +    D I
Sbjct: 449  TKLIGFVDQDDYLLPTLTVYETVLNSALLRLPRTMSFEAKQARVFHVLEELRIMDIKDRI 508

Query: 1057 VGVPGE-GLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASR-G 1114
            VG   E G++  +++R++I  EL   P L++FLDEPTSGLD+  A +  + + +LA    
Sbjct: 509  VGNDFERGISGGEKRRVSIACELVTSP-LVLFLDEPTSGLDANNANNVIECLVRLARNYD 567

Query: 1115 QAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGAHKCPPDAN 1174
            + ++ +IHQP + +   FD+L+ L   G+ VY GE  +     +N F  +  ++CP + N
Sbjct: 568  RTLVMSIHQPRSNIFYRFDKLVLLSR-GELVYSGEALR-----VNEFLKNNGYQCPSNYN 621

Query: 1175 PAEWMLEI 1182
             A+++++I
Sbjct: 622  IADYLIDI 629

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 121/259 (46%), Gaps = 13/259 (5%)

Query: 189 NDSGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSN 248
           +D   ++L  + G + PGE+L ++G  GAG TTLL  +++      +S    +     S 
Sbjct: 386 SDEKQRVLNDISGLVKPGEILSIMGGSGAGKTTLLDILAMKRKTGDVSGSIRVNGKVVSR 445

Query: 249 KEIKNHYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEV-- 306
           K+    Y   + +  + D  +P LTV++T+   A L+ PR         +F      V  
Sbjct: 446 KD----YTKLIGFVDQDDYLLPTLTVYETVLNSALLRLPRTM-------SFEAKQARVFH 494

Query: 307 AMATYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALE 366
            +    +    D  VGNDF RG+SGGE++RVSIA   +        D  T GLD+  A  
Sbjct: 495 VLEELRIMDIKDRIVGNDFERGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDANNANN 554

Query: 367 FIKALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGY 426
            I+ L   A        ++I+Q   + +  FDK+ +L  G  ++ G + +  ++ +  GY
Sbjct: 555 VIECLVRLARNYDRTLVMSIHQPRSNIFYRFDKLVLLSRGELVYSGEALRVNEFLKNNGY 614

Query: 427 VCPERQTTADYLTSITSPS 445
            CP     ADYL  IT  S
Sbjct: 615 QCPSNYNIADYLIDITFES 633

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 77/166 (46%), Gaps = 7/166 (4%)

Query: 1235 ATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLA 1294
            A S   Q+ ++  R F   +R P  L   +  T++  +F+G  ++K    + G QN+M  
Sbjct: 776  AASFSEQLSILCSRSFKNIYRNPKLLLGNYLLTVLLGVFLGVLYYKVENDISGFQNRMGL 835

Query: 1295 IFMFTVVFNPILQQYLPLFVQQRELYEARERPSRTFSWKAFIVSQILVE-IPWNLLAGTI 1353
             F     F  +    L  F  +R ++  +ER +  +S  A+  S+ILV+ IP  ++   +
Sbjct: 836  FFFILTYFGFVTFTGLSSFALERIIF-LKERSNNYYSPLAYYGSKILVDVIPLRVIPPIL 894

Query: 1354 AFFVYYYPVGF-YRNASYANQLHERGALFWLFACAFYVYISSMGVL 1398
               + Y  VG   R+ ++   +     +  LF  A  + I ++G++
Sbjct: 895  LCMIVYPLVGLNMRDDAFFKCI----GILVLFNLAISMEILTIGII 936

>YCR011C (ADP1) [545] chr3 complement(133721..136870) Member of the
            ATP-binding cassette (ABC) superfamily of membrane
            transporters [3150 bp, 1049 aa]
          Length = 1049

 Score =  146 bits (369), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 95/272 (34%), Positives = 156/272 (57%), Gaps = 13/272 (4%)

Query: 921  AIFHWKNLCYDIPIKNG---KRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTT 977
            A   ++N+ Y +P  N    +  +L+ + G VKPG + A++G SGAGKTTLLD LA +  
Sbjct: 382  ATLSFENITYSVPSINSDGVEETVLNEISGIVKPGQILAIMGGSGAGKTTLLDILAMKRK 441

Query: 978  MGLITGDVFVDGRPRD-QSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEK 1036
             G ++G + V+G   D +SF + IG+  Q D  L T TV E++  SA LR    +S E K
Sbjct: 442  TGHVSGSIKVNGISMDRKSFSKIIGFVDQDDFLLPTLTVFETVLNSALLRLPKALSFEAK 501

Query: 1037 DKYVEEVIEVLEMKLYADAIVGVP-GEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGL 1095
               V +V+E L +    D I+G     G++  +++R++I  EL   P L++FLDEPTSGL
Sbjct: 502  KARVYKVLEELRIIDIKDRIIGNEFDRGISGGEKRRVSIACELVTSP-LVLFLDEPTSGL 560

Query: 1096 DSQTAWSTCQLMKKLASR-GQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGC 1154
            D+  A +  + + +L+S   + ++ +IHQP + +   FD+L+ L + G+ VY G   K  
Sbjct: 561  DASNANNVIECLVRLSSDYNRTLVLSIHQPRSNIFYLFDKLVLLSK-GEMVYSGNAKK-- 617

Query: 1155 KTMINYFEAHGAHKCPPDANPAEWMLEIVGAA 1186
               ++ F  +  + CP + N A+++++I   A
Sbjct: 618  ---VSEFLRNEGYICPDNYNIADYLIDITFEA 646

 Score =  118 bits (296), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 137/593 (23%), Positives = 250/593 (42%), Gaps = 64/593 (10%)

Query: 195 ILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKEIKNH 254
           +L  + G + PG++L ++G  GAG TTLL  +++      +S    I  NG S    +  
Sbjct: 405 VLNEISGIVKPGQILAIMGGSGAGKTTLLDILAMKRKTGHVSGS--IKVNGISMD--RKS 460

Query: 255 YRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLS 314
           +   + +  + D  +P LTVF+T+   A L+ P+       +    K + E+ +      
Sbjct: 461 FSKIIGFVDQDDFLLPTLTVFETVLNSALLRLPKALSFEAKKARVYKVLEELRIID---- 516

Query: 315 HTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQ 374
              D  +GN+F RG+SGGE++RVSIA   +        D  T GLD++ A   I+ L   
Sbjct: 517 -IKDRIIGNEFDRGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDASNANNVIECLVRL 575

Query: 375 ATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTT 434
           ++       ++I+Q   + + LFDK+ +L  G  ++ G +K+  ++ +  GY+CP+    
Sbjct: 576 SSDYNRTLVLSIHQPRSNIFYLFDKLVLLSKGEMVYSGNAKKVSEFLRNEGYICPDNYNI 635

Query: 435 ADYLTSIT------SPSERIKDKDMVKHGI-------MIPQTAYEMNQYWIQSE------ 475
           ADYL  IT          RI++   ++ G         I QT +  +    Q E      
Sbjct: 636 ADYLIDITFEAGPQGKRRRIRNISDLEAGTDTNDIDNTIHQTTFTSSDGTTQREWAHLAA 695

Query: 476 ---EYKQL-----------------QVQVNKHLDTDS----------SQQREQIKNAHIA 505
              E + L                 ++ +N  L  D           SQ+ E++ +    
Sbjct: 696 HRDEIRSLLRDEEDVEGTDGRRGATEIDLNTKLLHDKYKDSVYYAELSQEIEEVLSEGDE 755

Query: 506 KQS--KRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYE 563
           + +      P+   +  F  Q+  +  R    +  +P + L   L    ++L LG+++Y 
Sbjct: 756 ESNVLNGDLPTGQQSAGFLQQLSILNSRSFKNMYRNPKLLLGNYLLTILLSLFLGTLYYN 815

Query: 564 VMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFAS 623
           V  S   + F  R                  + S    R I  K ++ + Y P A   + 
Sbjct: 816 V--SNDISGFQNRMGLFFFILTYFGFVTFTGLSSFALERIIFIKERSNNYYSPLAYYISK 873

Query: 624 TFSD-VPTKLATAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKT 682
             S+ VP ++   +  ++  Y +  L     AFF    I I+    +S     IG + + 
Sbjct: 874 IMSEVVPLRVVPPILLSLIVYPMTGLNMKDNAFFKCIGILILFNLGISLEILTIGIIFED 933

Query: 683 LPQAMVPASVLLLAFAMYTGFAIPRVQMLGWS-KWISYINPLSYLFESLMINE 734
           L  +++ + ++LL   +++G  I    +   + K++   +   Y +ESL+INE
Sbjct: 934 LNNSIILSVLVLLGSLLFSGLFINTKNITNVAFKYLKNFSVFYYAYESLLINE 986

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 90/206 (43%), Gaps = 14/206 (6%)

Query: 1199 WRDSEEYREMQKELDWMERELPKRTEGSSNEEQKEFATST-----LYQIKLVSYRLFHQY 1253
            ++DS  Y E+ +E++    E+    +  SN    +  T       L Q+ +++ R F   
Sbjct: 733  YKDSVYYAELSQEIE----EVLSEGDEESNVLNGDLPTGQQSAGFLQQLSILNSRSFKNM 788

Query: 1254 WRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLF 1313
            +R P  L   +  TI+  LF+G  ++  +  + G QN+M   F     F  +    L  F
Sbjct: 789  YRNPKLLLGNYLLTILLSLFLGTLYYNVSNDISGFQNRMGLFFFILTYFGFVTFTGLSSF 848

Query: 1314 VQQRELYEARERPSRTFSWKAFIVSQILVE-IPWNLLAGTIAFFVYYYPVGFYRNASYAN 1372
              +R ++  +ER +  +S  A+ +S+I+ E +P  ++   +   + Y   G        N
Sbjct: 849  ALERIIF-IKERSNNYYSPLAYYISKIMSEVVPLRVVPPILLSLIVYPMTGLNMK---DN 904

Query: 1373 QLHERGALFWLFACAFYVYISSMGVL 1398
               +   +  LF     + I ++G++
Sbjct: 905  AFFKCIGILILFNLGISLEILTIGII 930

>Kwal_27.12711
          Length = 1246

 Score =  146 bits (368), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 142/541 (26%), Positives = 246/541 (45%), Gaps = 67/541 (12%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSI 1000
            I++++   V  G++ A+IG SG+GKTTLL+ LA + +  L     F    P   S    I
Sbjct: 35   IVNDISMTVPSGSIMAIIGGSGSGKTTLLNVLASKMSKTLKQRGSF-RFVPETSSHSGEI 93

Query: 1001 --GYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVG 1058
               Y  QQD+     T RE+L+++A L+     S  E+   VEE+I  L +K  A+ +VG
Sbjct: 94   TTSYLTQQDILASNLTCRETLQYAADLKLQSSKS--ERQGLVEELIAELGLKDCANTLVG 151

Query: 1059 VPGE-GLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASR-GQA 1116
             P   GL+  +++RL+IGV++ + P L+ FLDEPT+GLD+ +A+   + ++KL+ + G++
Sbjct: 152  SPNRPGLSGGEKRRLSIGVQMISNPSLM-FLDEPTTGLDAYSAYLVVRTLRKLSHKGGRS 210

Query: 1117 ILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGAHKCPPDANPA 1176
             + +IHQP A ++   D++  +  G     F       + M+ YFE  G +K P  ANPA
Sbjct: 211  FIMSIHQPRADILFLLDQVCIMSHG-----FNVFCDRVEKMVPYFEQLG-YKVPLHANPA 264

Query: 1177 EWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKELD-----WMERELPKRTEGSSNEEQ 1231
            +  +++                 R  E     QK LD     W +++       S+    
Sbjct: 265  DHFIDLCSVDS------------RSPELLEHTQKRLDRLIEAWKDQQDHHEPHASTATPV 312

Query: 1232 K--EFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFK-ANTSLQGL 1288
            +  + + S   QI++++ R      R      +     I+  +  G+ F+K   TSL+G+
Sbjct: 313  RPTQPSVSLWSQIQVLTRRAVKLNLRDHTTCIAVLLEPIIIGVITGWIFYKPEQTSLKGI 372

Query: 1289 QNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEA------RERPSRTFSWKAFIVSQ--- 1339
            +    A++         LQ YL L  +   L E       RER     +  +F++S+   
Sbjct: 373  RTTTSALYSAAA-----LQGYLFLLFEIYRLCEQDIRVYDRERAEGCVTPWSFVISRRLA 427

Query: 1340 --ILVEIPWNLLAGTIAFFVYYYPV---GFYRNASYANQLHERGALFWLFACAFYVYISS 1394
              ++ + P   L   I +F+Y   V    F+   S    +H+  A F L           
Sbjct: 428  NFLMEDFPVPFLFSIITYFMYGLEVTAKNFFVYFSVVLLIHQSSASFAL----------- 476

Query: 1395 MGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDALL 1454
               L +S       A+ + +L + +    CG      ++P +  +   ++ L Y   AL+
Sbjct: 477  ---LSVSISRDFSQASLVGNLNYTLQSMACGFFVNAKVMPVYVRWTKYITYLWYGFGALM 533

Query: 1455 S 1455
            S
Sbjct: 534  S 534

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/252 (31%), Positives = 139/252 (55%), Gaps = 16/252 (6%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLI-----TGDVFVDGRPRDQS 995
            IL N++   +P  + A++G SG+GK+TLL+ L+ +T   ++     +G +F +     Q 
Sbjct: 665  ILRNINAVFQPHAINAIMGPSGSGKSTLLNFLSGKTHSTVLASFETSGSIFFNNSQVTQD 724

Query: 996  -FPRSIGYCQQQDLHL-KTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYA 1053
             F     +  Q D HL    TVRE+L F+A LR    +    +   V+++I  L +K   
Sbjct: 725  IFKDVCSFVPQDDDHLLPQLTVRETLLFAADLR-LHHMKARNRISRVDDLISELGLKHCE 783

Query: 1054 DAIVGVP-GEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLAS 1112
            + +VG    +G++  +++RL++G  L     +L+ LDEPTSGLDS T++   +++  ++ 
Sbjct: 784  NTLVGSELVKGISGGEKRRLSMGTHLLTDSPILL-LDEPTSGLDSFTSFKILEVLTNISR 842

Query: 1113 R-GQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGAHKCPP 1171
            + G+ ++ TIHQP   L Q+   +L L +GG+  Y G   +    MI YF  H   +CPP
Sbjct: 843  KPGKTVILTIHQPRTELFQQLGNILLLAKGGRVAYNGPSAE----MIQYFH-HLGFECPP 897

Query: 1172 DANPAEWMLEIV 1183
              N A++ L+++
Sbjct: 898  LTNVADYFLDLI 909

 Score =  117 bits (293), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 130/565 (23%), Positives = 239/565 (42%), Gaps = 66/565 (11%)

Query: 191 SGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKE 250
           +G  I+  +   +  G ++ ++G  G+G TTLL     N    K+S  T+     F    
Sbjct: 31  NGTAIVNDISMTVPSGSIMAIIGGSGSGKTTLL-----NVLASKMS-KTLKQRGSFRFVP 84

Query: 251 IKNHYRGEVV--YNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAM 308
             + + GE+   Y  + DI   +LT  +TL   A LK   ++ +        + + E  +
Sbjct: 85  ETSSHSGEITTSYLTQQDILASNLTCRETLQYAADLKLQSSKSE-------RQGLVEELI 137

Query: 309 ATYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFI 368
           A  GL   A+T VG+    G+SGGE++R+SI    I        D  T GLD+ +A   +
Sbjct: 138 AELGLKDCANTLVGSPNRPGLSGGEKRRLSIGVQMISNPSLMFLDEPTTGLDAYSAYLVV 197

Query: 369 KALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVC 428
           + L+  +     +  ++I+Q   D   L D+VC++  G+ +F    ++   YF+++GY  
Sbjct: 198 RTLRKLSHKGGRSFIMSIHQPRADILFLLDQVCIMSHGFNVFCDRVEKMVPYFEQLGYKV 257

Query: 429 PERQTTADYLTSITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHL 488
           P     AD+   + S   R    ++++H                        Q ++++ +
Sbjct: 258 PLHANPADHFIDLCSVDSR--SPELLEHT-----------------------QKRLDRLI 292

Query: 489 DTDSSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVL 548
           +    QQ     +A  A      RP+ P +VS + Q++ +  R +     D +  +  +L
Sbjct: 293 EAWKDQQDHHEPHASTATP---VRPTQP-SVSLWSQIQVLTRRAVKLNLRDHTTCIAVLL 348

Query: 549 SHAAMALILGSMFYEVMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKH 608
               + +I G +FY+   ++       +G                 +F L+E   + E+ 
Sbjct: 349 EPIIIGVITGWIFYKPEQTS------LKGIRTTTSALYSAAALQGYLFLLFEIYRLCEQD 402

Query: 609 -KTYSLYRPSADAFASTFSDVPTK---------LATAVTFNIPYYFLINLKRDAGAFFFY 658
            + Y   R  A+   + +S V ++               F+I  YF+  L+  A  FF Y
Sbjct: 403 IRVYD--RERAEGCVTPWSFVISRRLANFLMEDFPVPFLFSIITYFMYGLEVTAKNFFVY 460

Query: 659 FLINIITVFAMSHLFRCIG-SVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWI 717
           F + ++ +   S  F  +  S+S+   QA +  ++     +M  GF +    M  + +W 
Sbjct: 461 FSV-VLLIHQSSASFALLSVSISRDFSQASLVGNLNYTLQSMACGFFVNAKVMPVYVRWT 519

Query: 718 SYINPLSYLFESLMINEFHGRNFPC 742
            YI  L Y F +LM N+F   +F C
Sbjct: 520 KYITYLWYGFGALMSNQF--SDFGC 542

 Score =  114 bits (286), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 132/277 (47%), Gaps = 17/277 (6%)

Query: 174 ISRRLFHRTHGKSEDNDSGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGF 233
           + +  F   H KS D+    +IL+ ++    P  +  ++G  G+G +TLL  +S  TH  
Sbjct: 644 VEKMRFPLIHNKSSDSHKSIEILRNINAVFQPHAINAIMGPSGSGKSTLLNFLSGKTHST 703

Query: 234 KISPDTIITYNGFSNKEI-KNHYRGEVVYNAESDIHI-PHLTVFQTLYTVARLK----TP 287
            ++         F+N ++ ++ ++    +  + D H+ P LTV +TL   A L+      
Sbjct: 704 VLASFETSGSIFFNNSQVTQDIFKDVCSFVPQDDDHLLPQLTVRETLLFAADLRLHHMKA 763

Query: 288 RNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGS 347
           RNRI  VD            ++  GL H  +T VG++ V+G+SGGE++R+S+    +  S
Sbjct: 764 RNRISRVDD----------LISELGLKHCENTLVGSELVKGISGGEKRRLSMGTHLLTDS 813

Query: 348 KFQCWDNATRGLDSATALEFIKALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGY 407
                D  T GLDS T+ + ++ L   +        + I+Q   + +     + +L  G 
Sbjct: 814 PILLLDEPTSGLDSFTSFKILEVLTNISRKPGKTVILTIHQPRTELFQQLGNILLLAKGG 873

Query: 408 QIFF-GPSKQAKKYFQRMGYVCPERQTTADYLTSITS 443
           ++ + GPS +  +YF  +G+ CP     ADY   + S
Sbjct: 874 RVAYNGPSAEMIQYFHHLGFECPPLTNVADYFLDLIS 910

>CAGL0I08019g complement(782863..786720) highly similar to sp|Q08234
            Saccharomyces cerevisiae YOL075c, hypothetical start
          Length = 1285

 Score =  138 bits (347), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 143/521 (27%), Positives = 245/521 (47%), Gaps = 66/521 (12%)

Query: 952  GTLTALIGASGAGKTTLLDCLAERTTMGLI-TGDVF---------VDGRPRDQSFPR--- 998
            G++ A++G SG+GKTTLL+ LA + + GL  +G++          VD    + SF     
Sbjct: 48   GSVMAIMGGSGSGKTTLLNVLASKISSGLTHSGEISYILEADKNNVDDSSSEASFDLNAT 107

Query: 999  -----SIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYA 1053
                 ++ Y  QQD+     T RE+L ++A L+   D S  EK   V ++I+ L +K  A
Sbjct: 108  YKENVTLAYVPQQDVLCSRLTCRETLMYAADLKL--DASKVEKTLIVNQLIDELGLKDCA 165

Query: 1054 DAIVGVPGE-GLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLAS 1112
            D +VG     GL+  +++RL++G ++ + P ++ FLDEPT+GLD+ +A+   + +KKLA 
Sbjct: 166  DTLVGDNSHRGLSGGEKRRLSMGTQMVSNPSVM-FLDEPTTGLDAYSAYLVVKTLKKLAK 224

Query: 1113 R-GQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGAHKCPP 1171
              G+  + +IHQP + ++  FD +  L + G  V+  ++ +    +I YF++  ++  P 
Sbjct: 225  EDGRTFILSIHQPRSDILFLFDYVCILSK-GNVVFCNQMNE----LIPYFKSI-SYDVPD 278

Query: 1172 DANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKE--LDWMERELPKRTEGSSNE 1229
              NPA++ +++      T   +D  AI   + E  EM       + E+ L  +      E
Sbjct: 279  LVNPADYFIDLSSVDGRT---EDSLAI---TSERLEMLVSHWRKYEEKTLSYKPINHKYE 332

Query: 1230 EQKEFATSTL---YQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQ 1286
             Q +  T  L    Q+ +++ R +   +     L + F   +V    +G+ +FK +TS  
Sbjct: 333  IQLKSMTGRLPFWKQVSVLTRRNYKLNFNDTNTLIATFAEPVVMGAIVGWIYFKPDTSNI 392

Query: 1287 GLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEA------RERPSRTFSWKAFIVSQI 1340
            G    +++    +V    ILQ YL L      L E       RER     S  AFIV++ 
Sbjct: 393  GGLRTLISCLYASV----ILQSYLYLLFDTYRLCEQDIALFDRERAEGAVSGIAFIVARK 448

Query: 1341 LV-----EIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACAFYVYISSM 1395
            L      +I   +L  +I +F++    G  +NAS     +    L  L   A    ++ +
Sbjct: 449  LALFITDDILMTILYTSITYFMF----GLEKNASKFFFQYAVNLLAQLICSA----LAMV 500

Query: 1396 GVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRF 1436
             V V      A    NL+   F MS   CG      ++P +
Sbjct: 501  SVAVSRDFAKASLVGNLSFTLFSMS---CGFFVNAKLMPVY 538

 Score =  127 bits (318), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 152/276 (55%), Gaps = 29/276 (10%)

Query: 918  KSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTT 977
            K+  IF ++N           ++IL NV    KPG + A++G SG+GK++ L+ ++ R  
Sbjct: 689  KNHKIFEYEN-----------KKILQNVSAVFKPGMINAIMGPSGSGKSSFLNLISGRLE 737

Query: 978  MGLIT-----GDVFVDGRPRDQS-FPRSIGYCQQQDLH-LKTATVRESLRFSAYLRQADD 1030
              L+      G + ++  P  Q  F     Y  Q D H L   TVRE+  F+A LR    
Sbjct: 738  SSLLVKFNTAGTIKLNDTPISQDMFKHLCSYVSQDDDHLLAMLTVRETFDFAAALR-LKH 796

Query: 1031 VSIEEKDKYVEEVIEVLEMKLYADAIVGVPG-EGLNVEQRKRLTIGVELAA-KPKLLVFL 1088
            +S ++K    + +I +L +K   + I+G    +G++  +++R+++G++L + +P LL  L
Sbjct: 797  LSKDDKRSRTDSLIAILGLKHCENTIIGNEFIKGISGGEKRRVSMGIQLLSDRPILL--L 854

Query: 1089 DEPTSGLDSQTAWSTCQLMKKLAS-RGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYF 1147
            DEPTSGLDS T+ +  ++++ L S   + ++ TIHQP + L  +F  +L L + G+T + 
Sbjct: 855  DEPTSGLDSFTSSTILEILENLCSEHNKTVILTIHQPRSELFMKFGNILLLAKSGRTAFN 914

Query: 1148 GELGKGCKTMINYFEAHGAHKCPPDANPAEWMLEIV 1183
            G      + MI +F+  G +KCP   N A++ L+++
Sbjct: 915  GS----PEEMIKHFDLMG-YKCPSFTNIADFFLDLI 945

 Score =  120 bits (302), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 140/603 (23%), Positives = 241/603 (39%), Gaps = 67/603 (11%)

Query: 168 KMSWRCISRRLFHRTHGKSEDNDSGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKSIS 227
           K+S+  I R   H        + +   ++ P+   +  G ++ ++G  G+G TTLL  ++
Sbjct: 10  KLSFSKIPRVGLHVRDLSITASKTDSVLVHPLSLDLPSGSVMAIMGGSGSGKTTLLNVLA 69

Query: 228 VN-----THGFKIS------PDTIITYNGFSNKEIKNHYRGEVV--YNAESDIHIPHLTV 274
                  TH  +IS       + +   +  ++ ++   Y+  V   Y  + D+    LT 
Sbjct: 70  SKISSGLTHSGEISYILEADKNNVDDSSSEASFDLNATYKENVTLAYVPQQDVLCSRLTC 129

Query: 275 FQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGNDFVRGVSGGER 334
            +TL   A LK   ++   V++      + +      GL   ADT VG++  RG+SGGE+
Sbjct: 130 RETLMYAADLKLDASK---VEKTLIVNQLID----ELGLKDCADTLVGDNSHRGLSGGEK 182

Query: 335 KRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATVAIYQCSKDAY 394
           +R+S+    +        D  T GLD+ +A   +K LK  A        ++I+Q   D  
Sbjct: 183 RRLSMGTQMVSNPSVMFLDEPTTGLDAYSAYLVVKTLKKLAKEDGRTFILSIHQPRSDIL 242

Query: 395 DLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADYLTSITSPSERIKDKDMV 454
            LFD VC+L  G  +F     +   YF+ + Y  P+    ADY   ++S   R +D    
Sbjct: 243 FLFDYVCILSKGNVVFCNQMNELIPYFKSISYDVPDLVNPADYFIDLSSVDGRTED---- 298

Query: 455 KHGIMIPQTAYEM-NQYWIQSEEYKQLQVQVNKHLDTDSSQQREQIKNAHIAKQSKRARP 513
              + I     EM   +W + EE K L  +   H                I  +S   R 
Sbjct: 299 --SLAITSERLEMLVSHWRKYEE-KTLSYKPINH-------------KYEIQLKSMTGR- 341

Query: 514 SSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTVLSHAAMALILGSMFYEVMLSTTTTTF 573
                + F+ QV  +  R+     ND +  + T      M  I+G ++++        T 
Sbjct: 342 -----LPFWKQVSVLTRRNYKLNFNDTNTLIATFAEPVVMGAIVGWIYFK------PDTS 390

Query: 574 YYRGXXXXXXXXXXXXXXXXEIFSLYETRPITEKHKTYSLYRPSADAFASTFSDVPTKLA 633
              G                 ++ L++T  + E+         +  A +     V  KLA
Sbjct: 391 NIGGLRTLISCLYASVILQSYLYLLFDTYRLCEQDIALFDRERAEGAVSGIAFIVARKLA 450

Query: 634 TAVTFNIPY--------YFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTLPQ 685
             +T +I          YF+  L+++A  FFF + +N++     S L     +VS+   +
Sbjct: 451 LFITDDILMTILYTSITYFMFGLEKNASKFFFQYAVNLLAQLICSALAMVSVAVSRDFAK 510

Query: 686 AMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFH------GRN 739
           A +  ++    F+M  GF +    M  + +W  YI    Y F SL+ N F       G  
Sbjct: 511 ASLVGNLSFTLFSMSCGFFVNAKLMPVYVRWTKYIAFTWYGFGSLLSNTFSDSYCNGGEG 570

Query: 740 FPC 742
           F C
Sbjct: 571 FEC 573

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 140/613 (22%), Positives = 246/613 (40%), Gaps = 88/613 (14%)

Query: 177  RLFHRTHGKSEDNDSGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKSIS--------- 227
            +L++R + K  + ++  +IL+ +     PG +  ++G  G+G ++ L  IS         
Sbjct: 684  KLYNRKNHKIFEYENK-KILQNVSAVFKPGMINAIMGPSGSGKSSFLNLISGRLESSLLV 742

Query: 228  -VNTHGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAESDIHI-PHLTVFQTLYTVARLK 285
              NT G     DT I+         ++ ++    Y ++ D H+   LTV +T    A L 
Sbjct: 743  KFNTAGTIKLNDTPIS---------QDMFKHLCSYVSQDDDHLLAMLTVRETFDFAAAL- 792

Query: 286  TPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSIC 345
                R+K + +D   +  T+  +A  GL H  +T +GN+F++G+SGGE++RVS+    + 
Sbjct: 793  ----RLKHLSKDD-KRSRTDSLIAILGLKHCENTIIGNEFIKGISGGEKRRVSMGIQLLS 847

Query: 346  GSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLY- 404
                   D  T GLDS T+   ++ L+   +       + I+Q   + +  F  + +L  
Sbjct: 848  DRPILLLDEPTSGLDSFTSSTILEILENLCSEHNKTVILTIHQPRSELFMKFGNILLLAK 907

Query: 405  DGYQIFFGPSKQAKKYFQRMGYVCPERQTTADY---LTSITSPSER--IKDKDMVKHGIM 459
             G   F G  ++  K+F  MGY CP     AD+   L S+ + +E+  I  K  V++   
Sbjct: 908  SGRTAFNGSPEEMIKHFDLMGYKCPSFTNIADFFLDLISVNTQNEQNEIHSKTRVEN--- 964

Query: 460  IPQTAYEMNQYWIQSEEYKQLQVQVNKHLDTDSSQQREQIKNAHIAKQSKRARPSSPYTV 519
                        + +   ++L++   K + T+     E  ++ +    SK A     Y V
Sbjct: 965  -----------ILSTWRAERLRLSAEKSIVTEEEHTLETFEDEYGQYFSKPAGLKLAYMV 1013

Query: 520  SFFLQVKYILIRD----IWRIKNDPSIQLFTVLSHAAMALILGSMFYEVMLSTTTTTFYY 575
            +   Q     IR+    + RI   P +     L  A +     S+   + L+  +T+ Y+
Sbjct: 1014 NLRRQYT-TTIRNFDSLMARIAQVPGLGGIFALYFAPLKHNYTSISNRLGLAQESTSLYF 1072

Query: 576  RGXXXXXXXXXXXXXXXXEIF--SLYETRPITEKHKTYSLYRPSADAFASTFSDVPTKLA 633
             G                E F   +Y   P    + T  L               P    
Sbjct: 1073 VGMLANLAVYPPERDYFYEEFKDGVYGVAPFYLAYMTLEL---------------PLTTI 1117

Query: 634  TAVTFNIPYYFLINLKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTL---PQAMVPA 690
             A+ ++    F   + R AG FF     N+     +      +G ++ TL   P  +V  
Sbjct: 1118 AAIVYSALTVFGCGMPRTAGNFF----ANVYCALMIVSCGEALGIMTNTLFKRPGFVVNC 1173

Query: 691  SVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEF---HGRNFPCAQYIP 747
              ++L+        +  + M    K I+YINP+ Y   S+++  F      NF C     
Sbjct: 1174 ISVILSIGTQLS-GLMSLHMSRVLKGINYINPVWY--TSIIVINFAFPDNLNFTCKD--- 1227

Query: 748  SGPNYVNATGDEV 760
             GP   NA G  V
Sbjct: 1228 -GPQ--NADGSCV 1237

>Scas_710.50
          Length = 602

 Score =  135 bits (339), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 149/254 (58%), Gaps = 16/254 (6%)

Query: 939  RRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLI-----TGDV-FVDGRPR 992
            ++IL +++   KPG + A++G SG+GK+TLL+ ++ R           TG + F D +  
Sbjct: 16   KQILQSINATFKPGMINAIMGPSGSGKSTLLNLVSGRIESSFFAKFATTGSIMFNDVQIS 75

Query: 993  DQSFPRSIGYCQQQDLH-LKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKL 1051
            ++ F     Y  Q D H L   TVRE+ +F+A LR   +++ E++    +E+I  L +K 
Sbjct: 76   EEMFKNVCSYVSQDDDHLLAKLTVRETFKFAADLR-LHNLTEEQRVIKSDELIRALGLKH 134

Query: 1052 YADAIVGVPG-EGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKL 1110
              + I+G    +G++  +++R+T+G++L   P  +V LDEPTSGLDS T+ +  +++KKL
Sbjct: 135  CENNIIGNEFIKGISGGEKRRVTMGIQLLNDPP-IVLLDEPTSGLDSFTSATILEILKKL 193

Query: 1111 ASR-GQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGAHKC 1169
            +   G+ I+ TIHQP + L ++F  +L L + G+T + G   +    MI YF + G + C
Sbjct: 194  SVEYGKTIIITIHQPRSELFKQFGNVLLLAKSGRTAFNGSPNE----MIEYFASLG-YDC 248

Query: 1170 PPDANPAEWMLEIV 1183
            P   N A++ L+++
Sbjct: 249  PEFTNVADFFLDLI 262

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 117/255 (45%), Gaps = 13/255 (5%)

Query: 194 QILKPMDGCINPGELLVVLGRPGAGCTTLLKSIS--VNTHGF-KISPDTIITYNGFSNKE 250
           QIL+ ++    PG +  ++G  G+G +TLL  +S  + +  F K +    I +N     E
Sbjct: 17  QILQSINATFKPGMINAIMGPSGSGKSTLLNLVSGRIESSFFAKFATTGSIMFNDVQISE 76

Query: 251 IKNHYRGEVVYNAESDIHI-PHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMA 309
               ++    Y ++ D H+   LTV +T    A L     R+  +  +       E+  A
Sbjct: 77  --EMFKNVCSYVSQDDDHLLAKLTVRETFKFAADL-----RLHNLTEEQRVIKSDELIRA 129

Query: 310 TYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIK 369
             GL H  +  +GN+F++G+SGGE++RV++    +        D  T GLDS T+   ++
Sbjct: 130 -LGLKHCENNIIGNEFIKGISGGEKRRVTMGIQLLNDPPIVLLDEPTSGLDSFTSATILE 188

Query: 370 ALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLY-DGYQIFFGPSKQAKKYFQRMGYVC 428
            LK  +        + I+Q   + +  F  V +L   G   F G   +  +YF  +GY C
Sbjct: 189 ILKKLSVEYGKTIIITIHQPRSELFKQFGNVLLLAKSGRTAFNGSPNEMIEYFASLGYDC 248

Query: 429 PERQTTADYLTSITS 443
           PE    AD+   + S
Sbjct: 249 PEFTNVADFFLDLIS 263

>KLLA0C04477g complement(409543..413304) similar to sp|Q08234
            Saccharomyces cerevisiae YOL075c, start by similarity
          Length = 1253

 Score =  137 bits (344), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 145/560 (25%), Positives = 255/560 (45%), Gaps = 64/560 (11%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGL-------ITGDVFVDGRPRD 993
            I++NV   +  G L A+IG SG+GKTT+L+ LA +T   +        + D   +G   D
Sbjct: 30   IVNNVSFSLPNGQLMAIIGGSGSGKTTMLNVLAGKTNSSINYDGEIQYSRDAAKEGSKAD 89

Query: 994  QSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYA 1053
            +    +  Y  Q D      T RE+LR +A L+    +  +E+   VEE+I  L ++  +
Sbjct: 90   EKV--TTAYLTQHDALAARLTCRETLRIAADLKL--HLPKQERYSLVEELIAELGLRDCS 145

Query: 1054 DAIVGVP-GEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLAS 1112
            +  VG    +GL+  +++RL+I V++ A P +L FLDEPT+GLD+ +A+   + +KKL  
Sbjct: 146  ETFVGDSINKGLSGGEKRRLSIAVQMIANPSVL-FLDEPTTGLDAYSAFLLIKTLKKLCE 204

Query: 1113 R-GQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGAHKCPP 1171
              G+ I+ +IHQP + ++   D++  L +G     F         M+ YF + G +  P 
Sbjct: 205  HGGRTIIMSIHQPRSDILFALDQVCLLSKG-----FPMYCGAVVGMVEYFSSMG-YTVPE 258

Query: 1172 DANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKELDWMER-----ELPKRTEGS 1226
              NPA+++++I      T  S        DSE    M    +W ER     +  K T   
Sbjct: 259  RCNPADYLIDICSVDNRTEKST------LDSEGRWNMFAS-EWQERCSTKYDTSKETAVI 311

Query: 1227 SNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFKAN-TSL 1285
            S +     + S L Q  +++ R F    R    L++  F  ++  + +G+ F+K + TS 
Sbjct: 312  SVDPSPP-SVSILQQTFILTKRNFLLSSRDRLTLFAVQFEPVIVGIVVGWIFYKPDQTSE 370

Query: 1286 QGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEA------RERPSRTFSWKAFIVSQ 1339
             GL+    A+++   +     Q YL L ++   L E       RER     +  ++++++
Sbjct: 371  SGLRTIAGALYIVGSI-----QGYLLLLLETYRLSELDIKIYDRERSEGCVTAFSYLMAR 425

Query: 1340 ILVE-IPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGALFWLFACAFYVYISSMGV- 1397
             L   +  ++L   +   + Y+  G   NA         G  F  F C    + +S+ V 
Sbjct: 426  RLSNLVQEDILIPLLFAIITYFMFGLEANA---------GRFFTYFGCTLVSHQTSVAVA 476

Query: 1398 -LVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRVSPLTYLIDALLSV 1456
             + +S       A  + +L F +    CG       +P +  +   ++ L Y   AL+S 
Sbjct: 477  YMAVSISRDFSKAGLVGNLTFTLQSMACGFFVNAEKMPVYVRWTKYIAYLWYTFSALMSN 536

Query: 1457 GLA-------NASVVCSSNE 1469
              +       N S VC+ ++
Sbjct: 537  TFSNFGCHQINGSEVCTGDQ 556

 Score =  134 bits (338), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 87/260 (33%), Positives = 150/260 (57%), Gaps = 19/260 (7%)

Query: 934  IKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLIT-----GDVFVD 988
            I +  + IL +V+   +P  + A++G SG+GKT+LL+ +++R      T     G +  +
Sbjct: 667  IGHSHKDILCSVNASFRPNAINAIMGPSGSGKTSLLNLISDRVCSNFFTKFNESGRIIFN 726

Query: 989  GRPRDQSFPRSIG-YCQQQDLHL-KTATVRESLRFSAYLRQA--DDVSIEEKDKYVEEVI 1044
             +P  +S  +S+  Y  Q D HL    TV E+L+++A LR +  ++  IE +   V  +I
Sbjct: 727  QQPVMKSMFKSVCCYVSQDDNHLLPNLTVYETLKYAARLRLSHHNESRIETR---VRTLI 783

Query: 1045 EVLEMKLYADAIVGVPG-EGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWST 1103
              L +K  A+ +VG    +G++  +++R++IG++L   P +L+ LDEPTSGLDS T+ + 
Sbjct: 784  SDLGLKNCANTLVGNDLIKGISGGEKRRVSIGIQLLTDPSVLL-LDEPTSGLDSFTSSTI 842

Query: 1104 CQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEA 1163
             +L+KKL  +G+ I+ TIHQP A +  +F  +L L +GG+  + G        MI YF  
Sbjct: 843  IELLKKLCQQGKTIILTIHQPRAEVFADFGNVLLLAKGGRVAFNGY----PSAMIEYFNK 898

Query: 1164 HGAHKCPPDANPAEWMLEIV 1183
             G   CP   N A+++L+++
Sbjct: 899  EG-FTCPQLTNIADYLLDVI 917

 Score =  133 bits (334), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 143/563 (25%), Positives = 242/563 (42%), Gaps = 52/563 (9%)

Query: 206 GELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNKE-IKNHYRGEVVYNAE 264
           G+L+ ++G  G+G TT+L  ++  T+   I+ D  I Y+  + KE  K   +    Y  +
Sbjct: 41  GQLMAIIGGSGSGKTTMLNVLAGKTNS-SINYDGEIQYSRDAAKEGSKADEKVTTAYLTQ 99

Query: 265 SDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGND 324
            D     LT  +TL   A LK     +   +R +  + +    +A  GL   ++T VG+ 
Sbjct: 100 HDALAARLTCRETLRIAADLKL---HLPKQERYSLVEEL----IAELGLRDCSETFVGDS 152

Query: 325 FVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATITKSAATV 384
             +G+SGGE++R+SIA   I        D  T GLD+ +A   IK LK           +
Sbjct: 153 INKGLSGGEKRRLSIAVQMIANPSVLFLDEPTTGLDAYSAFLLIKTLKKLCEHGGRTIIM 212

Query: 385 AIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADYLTSITSP 444
           +I+Q   D     D+VC+L  G+ ++ G      +YF  MGY  PER   ADYL  I S 
Sbjct: 213 SIHQPRSDILFALDQVCLLSKGFPMYCGAVVGMVEYFSSMGYTVPERCNPADYLIDICSV 272

Query: 445 SERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHLDTDSSQQREQIKNAHI 504
             R +   +   G          N +  + +E    +         D+S++   I     
Sbjct: 273 DNRTEKSTLDSEG--------RWNMFASEWQERCSTKY--------DTSKETAVIS---- 312

Query: 505 AKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTV-LSHAAMALILGSMFYE 563
                   PS P +VS  LQ  +IL +  + + +   + LF V      + +++G +FY+
Sbjct: 313 ------VDPSPP-SVS-ILQQTFILTKRNFLLSSRDRLTLFAVQFEPVIVGIVVGWIFYK 364

Query: 564 VMLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFSLYETR-PITEKHKTYSLYRPSADAFA 622
              ++ +      G                E + L E    I ++ ++       +   A
Sbjct: 365 PDQTSESGLRTIAGALYIVGSIQGYLLLLLETYRLSELDIKIYDRERSEGCVTAFSYLMA 424

Query: 623 STFSD-VPTKLATAVTFNIPYYFLINLKRDAGAFFFYF---LINIITVFAMSHLFRCIGS 678
              S+ V   +   + F I  YF+  L+ +AG FF YF   L++  T  A++++     S
Sbjct: 425 RRLSNLVQEDILIPLLFAIITYFMFGLEANAGRFFTYFGCTLVSHQTSVAVAYM---AVS 481

Query: 679 VSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYINPLSYLFESLMINEFHGR 738
           +S+   +A +  ++     +M  GF +   +M  + +W  YI  L Y F +LM N F   
Sbjct: 482 ISRDFSKAGLVGNLTFTLQSMACGFFVNAEKMPVYVRWTKYIAYLWYTFSALMSNTFS-- 539

Query: 739 NFPCAQY----IPSGPNYVNATG 757
           NF C Q     + +G  Y++  G
Sbjct: 540 NFGCHQINGSEVCTGDQYIDTFG 562

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 75/254 (29%), Positives = 126/254 (49%), Gaps = 14/254 (5%)

Query: 195 ILKPMDGCINPGELLVVLGRPGAGCTTLLKSIS--VNTHGF-KISPDTIITYNGFSNKEI 251
           IL  ++    P  +  ++G  G+G T+LL  IS  V ++ F K +    I +N      +
Sbjct: 674 ILCSVNASFRPNAINAIMGPSGSGKTSLLNLISDRVCSNFFTKFNESGRIIFN--QQPVM 731

Query: 252 KNHYRGEVVYNAESDIHI-PHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMAT 310
           K+ ++    Y ++ D H+ P+LTV++TL   ARL+   +       ++  +      ++ 
Sbjct: 732 KSMFKSVCCYVSQDDNHLLPNLTVYETLKYAARLRLSHHN------ESRIETRVRTLISD 785

Query: 311 YGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKA 370
            GL + A+T VGND ++G+SGGE++RVSI    +        D  T GLDS T+   I+ 
Sbjct: 786 LGLKNCANTLVGNDLIKGISGGEKRRVSIGIQLLTDPSVLLLDEPTSGLDSFTSSTIIEL 845

Query: 371 LKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFF-GPSKQAKKYFQRMGYVCP 429
           LK      K+   + I+Q   + +  F  V +L  G ++ F G      +YF + G+ CP
Sbjct: 846 LKKLCQQGKT-IILTIHQPRAEVFADFGNVLLLAKGGRVAFNGYPSAMIEYFNKEGFTCP 904

Query: 430 ERQTTADYLTSITS 443
           +    ADYL  + S
Sbjct: 905 QLTNIADYLLDVIS 918

>YOL075C (YOL075C) [4745] chr15 complement(189657..193541) Member of
            the ATP-binding cassette (ABC) superfamily, has
            similarity to Drosophila white protein [3885 bp, 1294 aa]
          Length = 1294

 Score =  132 bits (333), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 151/577 (26%), Positives = 265/577 (45%), Gaps = 93/577 (16%)

Query: 952  GTLTALIGASGAGKTTLLDCLAERTTMGLI-----------TGD---------VFVDGRP 991
            G++ A++G SG+GKTTLL+ LA + + GL            TG            +DG+ 
Sbjct: 55   GSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDTGSEPNETEPKRAHLDGQD 114

Query: 992  RDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKL 1051
                    + Y  QQD+     T RE+L+F+A L+   + S   K   VE++IE L +K 
Sbjct: 115  HPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKL--NSSERTKKLMVEQLIEELGLKD 172

Query: 1052 YADAIVGVPGE-GLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKL 1110
             AD +VG     GL+  +++RL+IG ++ + P ++ FLDEPT+GLD+ +A+   + +KKL
Sbjct: 173  CADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIM-FLDEPTTGLDAYSAFLVIKTLKKL 231

Query: 1111 ASR-GQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGAHKC 1169
            A   G+  + +IHQP + ++   D++  L + G  VY  ++       I YFE+ G H  
Sbjct: 232  AKEDGRTFIMSIHQPRSDILFLLDQVCILSK-GNVVYCDKM----DNTIPYFESIGYH-V 285

Query: 1170 PPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEEYREMQKEL--------DWMERELPK 1221
            P   NPA++ +++        +S D     R  +E    Q  L        D+    L  
Sbjct: 286  PQLVNPADYFIDL--------SSVDS----RSDKEEAATQSRLNSLIDHWHDYERTHLQL 333

Query: 1222 RTE---GSSNEEQKEFATSTL---YQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIG 1275
            + E    ++ E Q +  T+ L    Q+ +++ R F   +     L S F   ++     G
Sbjct: 334  QAESYISNATEIQIQNMTTRLPFWKQVTVLTRRNFKLNFSDYVTLISTFAEPLIIGTVCG 393

Query: 1276 FTFFKAN-TSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEA------RERPSR 1328
            + ++K + +S+ GL+     ++  T     ILQ YL L      L E       RER   
Sbjct: 394  WIYYKPDKSSIGGLRTTTACLYAST-----ILQCYLYLLFDTYRLCEQDIALYDRERAEG 448

Query: 1329 TFSWKAFIVSQILVEIPWNLLAGTIAFF-VYYYPVGFYRNASYANQLHERGALFWLFACA 1387
            + +  AFIV++ +     +  A T+ F  + Y+  G   +A            F+ FA  
Sbjct: 449  SVTPLAFIVARKISLFLSDDFAMTMIFVSITYFMFGLEADAR---------KFFYQFAVV 499

Query: 1388 FYVYISSMGVLVISCIEIAENAANLASL-----FFIMSLSFCGVLATPNILPRFWIFMYR 1442
            F   +S  G+ ++S + ++ + +  ASL     F ++S+  CG      ++P +  ++  
Sbjct: 500  FLCQLSCSGLSMLS-VAVSRDFSK-ASLVGNMTFTVLSMG-CGFFVNAKVMPVYVRWIKY 556

Query: 1443 VSPLTYLIDALLSVGLANASVV------CSSNELLKI 1473
            ++   Y    L+S    N+         C  N++L++
Sbjct: 557  IAFTWYSFGTLMSSTFTNSYCTTDNLDECLGNQILEV 593

 Score =  126 bits (316), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 83/254 (32%), Positives = 147/254 (57%), Gaps = 16/254 (6%)

Query: 939  RRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLI-----TGDV-FVDGRPR 992
            + IL +V+   KPG + A++G SG+GK++LL+ ++ R    +      +G + F D +  
Sbjct: 707  KEILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFDTSGSIMFNDIQVS 766

Query: 993  DQSFPRSIGYCQQQDLHLKTA-TVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKL 1051
            +  F     Y  Q D HL  A TV+E+L+++A LR    ++  E+ +  + +I  L +K 
Sbjct: 767  ELMFKNVCSYVSQDDDHLLAALTVKETLKYAAALR-LHHLTEAERMERTDNLIRSLGLKH 825

Query: 1052 YADAIVGVP-GEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKL 1110
              + I+G    +G++  +++R+T+GV+L   P +L+ LDEPTSGLDS T+ +  ++++KL
Sbjct: 826  CENNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILL-LDEPTSGLDSFTSATILEILEKL 884

Query: 1111 A-SRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMINYFEAHGAHKC 1169
               +G+ I+ TIHQP + L + F  +L L + G+T + G   +    MI YF   G + C
Sbjct: 885  CREQGKTIIITIHQPRSELFKRFGNVLLLAKSGRTAFNGSPDE----MIAYFTELG-YNC 939

Query: 1170 PPDANPAEWMLEIV 1183
            P   N A++ L+++
Sbjct: 940  PSFTNVADFFLDLI 953

 Score =  115 bits (288), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 143/568 (25%), Positives = 232/568 (40%), Gaps = 88/568 (15%)

Query: 206 GELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITY----NGFSNKEI---KNHYRGE 258
           G ++ V+G  G+G TTLL  ++    G  ++ +  I Y     G    E    + H  G+
Sbjct: 55  GSVMAVMGGSGSGKTTLLNVLASKISG-GLTHNGSIRYVLEDTGSEPNETEPKRAHLDGQ 113

Query: 259 ---------VVYNAESDIHIPHLTVFQTLYTVARLK-TPRNRIKGVDRDTFAKHMTEVAM 308
                    + Y  + D+  P LT  +TL   A LK     R K        K M E  +
Sbjct: 114 DHPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLNSSERTK--------KLMVEQLI 165

Query: 309 ATYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFI 368
              GL   ADT VG++  RG+SGGE++R+SI    I        D  T GLD+ +A   I
Sbjct: 166 EELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYSAFLVI 225

Query: 369 KALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVC 428
           K LK  A        ++I+Q   D   L D+VC+L  G  ++         YF+ +GY  
Sbjct: 226 KTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGNVVYCDKMDNTIPYFESIGYHV 285

Query: 429 PERQTTADYLTSITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQLQVQVNKHL 488
           P+    ADY   ++S   R  DK+          T   +N       +Y++  +Q+    
Sbjct: 286 PQLVNPADYFIDLSSVDSR-SDKEEAA-------TQSRLNSLIDHWHDYERTHLQL---- 333

Query: 489 DTDSSQQREQIKNA-HIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDPSIQLFTV 547
                Q    I NA  I  Q+   R      + F+ QV  +L R  +++     +   T+
Sbjct: 334 -----QAESYISNATEIQIQNMTTR------LPFWKQVT-VLTRRNFKLNFSDYV---TL 378

Query: 548 LSHAAMALILGS----MFYEV------MLSTTTTTFYYRGXXXXXXXXXXXXXXXXEIFS 597
           +S  A  LI+G+    ++Y+        L TTT   Y                    ++ 
Sbjct: 379 ISTFAEPLIIGTVCGWIYYKPDKSSIGGLRTTTACLY------------ASTILQCYLYL 426

Query: 598 LYETRPITEKHKTYSLY-RPSADAFASTFSDVPTK---------LATAVTFNIPYYFLIN 647
           L++T  + E+    +LY R  A+   +  + +  +          A  + F    YF+  
Sbjct: 427 LFDTYRLCEQD--IALYDRERAEGSVTPLAFIVARKISLFLSDDFAMTMIFVSITYFMFG 484

Query: 648 LKRDAGAFFFYFLINIITVFAMSHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPR 707
           L+ DA  FF+ F +  +   + S L     +VS+   +A +  ++     +M  GF +  
Sbjct: 485 LEADARKFFYQFAVVFLCQLSCSGLSMLSVAVSRDFSKASLVGNMTFTVLSMGCGFFVNA 544

Query: 708 VQMLGWSKWISYINPLSYLFESLMINEF 735
             M  + +WI YI    Y F +LM + F
Sbjct: 545 KVMPVYVRWIKYIAFTWYSFGTLMSSTF 572

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 118/257 (45%), Gaps = 17/257 (6%)

Query: 194 QILKPMDGCINPGELLVVLGRPGAGCTTLLKSIS--VNTHGF-KISPDTIITYNGFSNKE 250
           +IL+ ++    PG +  ++G  G+G ++LL  IS  + +  F K      I +N     E
Sbjct: 708 EILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFDTSGSIMFNDIQVSE 767

Query: 251 IKNHYRGEVVYNAESDIHI-PHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHM--TEVA 307
           +   ++    Y ++ D H+   LTV +TL   A L+        +   T A+ M  T+  
Sbjct: 768 LM--FKNVCSYVSQDDDHLLAALTVKETLKYAAALR--------LHHLTEAERMERTDNL 817

Query: 308 MATYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEF 367
           + + GL H  +  +GN+FV+G+SGGE++RV++    +        D  T GLDS T+   
Sbjct: 818 IRSLGLKHCENNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATI 877

Query: 368 IKALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLY-DGYQIFFGPSKQAKKYFQRMGY 426
           ++ L+           + I+Q   + +  F  V +L   G   F G   +   YF  +GY
Sbjct: 878 LEILEKLCREQGKTIIITIHQPRSELFKRFGNVLLLAKSGRTAFNGSPDEMIAYFTELGY 937

Query: 427 VCPERQTTADYLTSITS 443
            CP     AD+   + S
Sbjct: 938 NCPSFTNVADFFLDLIS 954

>Scas_566.1
          Length = 466

 Score =  128 bits (321), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 120/414 (28%), Positives = 204/414 (49%), Gaps = 54/414 (13%)

Query: 952  GTLTALIGASGAGKTTLLDCLAERTTMGLIT-GDV--FVDGRP-RDQSFPRSI------G 1001
            G++ A++G SG+GKTTLL+ LA + + GL T GD+   ++ +P RD    + +       
Sbjct: 77   GSVMAVMGGSGSGKTTLLNVLASKISGGLKTDGDIHYILEEKPQRDSEQEQEVQDHVKMA 136

Query: 1002 YCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVG-VP 1060
            Y  QQD+     T RE+L ++A L+   D S EEK   V+++I  L +K  A+ +VG   
Sbjct: 137  YLPQQDVLSARLTCRETLMYAADLKL--DRSKEEKKLVVDQLIHELGLKDCAETLVGDNT 194

Query: 1061 GEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASR-GQAILC 1119
              GL+  +++RL++G ++ + P ++ FLDEPT+GLD+ +A+   + +KKLA   G+  + 
Sbjct: 195  HRGLSGGEKRRLSVGTQMISNPSIM-FLDEPTTGLDAYSAYLVVKTLKKLAKEDGRTFIM 253

Query: 1120 TIHQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCKTMIN---YFEAHGAHKCPPDANPA 1176
            +IHQP + ++   D++  L + G+ VY       C  M N   YF+  G +K P   NPA
Sbjct: 254  SIHQPRSDILFLLDQVCILSK-GKVVY-------CDKMPNTIPYFDKLG-YKVPQLVNPA 304

Query: 1177 EWMLEIVGAAPGTHASQD--------YFAIWRDSEEYREMQKELDWMERELPKRTEGSSN 1228
            ++ ++I      + ++QD            W+D E      K +D   RE+    E  SN
Sbjct: 305  DYFIDISSVDGRSDSAQDETSKRLESLVEAWKDYETNTLNFKPVD-TSREI--EVENMSN 361

Query: 1229 EEQKEFATSTLYQIKLVSYRLFHQYWRTPFYLWSKFFSTIVSELFIGFTFFKANTSLQGL 1288
            +       S   Q+ +++ R +         L + F   IV    +G+ ++K + +  G 
Sbjct: 362  Q------LSYWKQVAVLTRRNYKLNTNDYVTLIATFGEPIVMGAIVGWVYYKPDKTTTGG 415

Query: 1289 QNQMLAIFMFTVVFNPILQQYLPLFVQQRELYEA------RERPSRTFSWKAFI 1336
               + +    +VV    +Q YL L      L E       RER   + +  AF+
Sbjct: 416  LRTITSCLYASVV----VQCYLYLLFDTYRLCEQDIALYDRERAEGSVTPVAFM 465

 Score = 99.0 bits (245), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 71/250 (28%), Positives = 116/250 (46%), Gaps = 18/250 (7%)

Query: 206 GELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITY--------NGFSNKEIKNHYRG 257
           G ++ V+G  G+G TTLL  ++    G  +  D  I Y        +    +E+++H + 
Sbjct: 77  GSVMAVMGGSGSGKTTLLNVLASKISG-GLKTDGDIHYILEEKPQRDSEQEQEVQDHVK- 134

Query: 258 EVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTA 317
            + Y  + D+    LT  +TL   A LK  R++ +        K + +  +   GL   A
Sbjct: 135 -MAYLPQQDVLSARLTCRETLMYAADLKLDRSKEE-------KKLVVDQLIHELGLKDCA 186

Query: 318 DTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQATI 377
           +T VG++  RG+SGGE++R+S+    I        D  T GLD+ +A   +K LK  A  
Sbjct: 187 ETLVGDNTHRGLSGGEKRRLSVGTQMISNPSIMFLDEPTTGLDAYSAYLVVKTLKKLAKE 246

Query: 378 TKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKYFQRMGYVCPERQTTADY 437
                 ++I+Q   D   L D+VC+L  G  ++         YF ++GY  P+    ADY
Sbjct: 247 DGRTFIMSIHQPRSDILFLLDQVCILSKGKVVYCDKMPNTIPYFDKLGYKVPQLVNPADY 306

Query: 438 LTSITSPSER 447
              I+S   R
Sbjct: 307 FIDISSVDGR 316

>Scas_202.1
          Length = 196

 Score =  102 bits (254), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 84/152 (55%), Gaps = 1/152 (0%)

Query: 1384 FACAFYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFMYRV 1443
            +   F +Y    G++V+       +A  +  L     +SFCGV    +++P FW FM++ 
Sbjct: 6    YCIMFQLYYVGFGLMVLYASPNLPSANVILGLCLSFLISFCGVTQPKSLMPGFWTFMWKA 65

Query: 1444 SPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDGSSE 1503
            SP TY +  ++ + L    VVCS  EL    PPSG TC +YME ++ S   GY+ +  + 
Sbjct: 66   SPYTYFVQNMVGIMLHKKPVVCSKKELNYFNPPSGQTCGQYMERFL-SRSPGYIQNPDAT 124

Query: 1504 TECHFCQFSSTNDYLATVSSSYSRRWMNYGIF 1535
            ++C +C ++  ++YL  +SSSYS  W N+G +
Sbjct: 125  SQCAYCVYTQGDEYLTHLSSSYSYLWRNFGFY 156

>Scas_40.1
          Length = 203

 Score = 96.7 bits (239), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 104/174 (59%), Gaps = 12/174 (6%)

Query: 939  RRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGL-ITG--DVFVDGRPRDQS 995
            + I+ +V   +  G++ A++G SG+GKTTLL+ LA + + GL + G  +   DG  R Q 
Sbjct: 34   KTIVHDVSMDLPSGSIMAIVGGSGSGKTTLLNVLASKISRGLKMEGSYEFVADGGSRQQD 93

Query: 996  FPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADA 1055
               +  Y  QQD+     TVRE+L ++A L+       +E+ + VEE+I  L +K  +D 
Sbjct: 94   I--TTAYLAQQDVSSPKLTVRETLSYAADLKL--KAPRQERRRLVEELIAELGLKECSDT 149

Query: 1056 IVG-VPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAW---STCQ 1105
             VG     GL+  +++RL+IGV++ + P LL FLDEPT+GLD+ +A+    TC+
Sbjct: 150  RVGDSEHRGLSGGEKRRLSIGVQMISNPSLL-FLDEPTTGLDAYSAYLLVKTCE 202

 Score = 72.0 bits (175), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 82/171 (47%), Gaps = 17/171 (9%)

Query: 206 GELLVVLGRPGAGCTTLLKSISVN-THGFKISPDTIITYNGFSNKEIKNHYRGEVVYNAE 264
           G ++ ++G  G+G TTLL  ++   + G K+        +G S ++          Y A+
Sbjct: 47  GSIMAIVGGSGSGKTTLLNVLASKISRGLKMEGSYEFVADGGSRQQDIT-----TAYLAQ 101

Query: 265 SDIHIPHLTVFQTLYTVA--RLKTPRNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVG 322
            D+  P LTV +TL   A  +LK PR            + + E  +A  GL   +DT+VG
Sbjct: 102 QDVSSPKLTVRETLSYAADLKLKAPRQE---------RRRLVEELIAELGLKECSDTRVG 152

Query: 323 NDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKT 373
           +   RG+SGGE++R+SI    I        D  T GLD+ +A   +K  +T
Sbjct: 153 DSEHRGLSGGEKRRLSIGVQMISNPSLLFLDEPTTGLDAYSAYLLVKTCET 203

>YPL270W (MDL2) [5181] chr16 (30482..32803) Member of the ATP-binding
            cassette (ABC) superfamily of membrane transporters,
            represents a half-sized ABC protein [2322 bp, 773 aa]
          Length = 773

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 111/237 (46%), Gaps = 17/237 (7%)

Query: 920  QAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAE--RTT 977
            + +  +K++ +  P +   + I  N++  + PG+   ++G SG GK+T+   L      T
Sbjct: 443  RGVIEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 501

Query: 978  MGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQADDVSIEEK 1036
             G IT D     +   +S  R IG  QQ+ + L + T+R+++ +   Y    +++    K
Sbjct: 502  TGTITIDNQDISKLNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAK 560

Query: 1037 DKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLD 1096
              +    I   +     D ++G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD
Sbjct: 561  QCFCHNFIT--KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALD 617

Query: 1097 SQTA----WSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGE 1149
             ++     ++  QLMK   S+   I+   H+ S +   E   ++ L   G  V  G+
Sbjct: 618  VESEGAINYTFGQLMK---SKSMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGK 669

>Sklu_2343.3 YPL270W, Contig c2343 2058-4382
          Length = 774

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 112/234 (47%), Gaps = 17/234 (7%)

Query: 923  FHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAE--RTTMGL 980
              ++N+ +  P ++  + I +N++  +  G+   ++G SG GK+T+   L +    T G 
Sbjct: 473  IKFENVSFSYPTRSANQ-IFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGR 531

Query: 981  ITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSA-YLRQADDVSIEEKDKY 1039
            IT D     +   +S  R +G  QQ+ + L + ++R+++ +   Y    D++    K  +
Sbjct: 532  ITIDGQDISKISAKSLRRHLGVVQQEPI-LMSGSIRDNITYGVPYTPTIDEIRSVSKKCF 590

Query: 1040 VEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQT 1099
                I   +     + ++G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++
Sbjct: 591  CHNFIT--KFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILI-LDEATSALDVES 647

Query: 1100 A----WSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGE 1149
                 ++  QLMK   SR   I+   H+ S +   E   ++ L + G  V  G+
Sbjct: 648  EGAINYTLGQLMK---SRDITIISIAHRLSTIRRSE--NVIVLGDDGSVVEMGK 696

>CAGL0A01133g 112037..114442 similar to sp|P33311 Saccharomyces
            cerevisiae YPL270w MDL2, hypothetical start
          Length = 801

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 112/236 (47%), Gaps = 21/236 (8%)

Query: 923  FHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLIT 982
              +KN+ +  P +     I  N++  ++ G+   ++G SG GK+T+   L +       +
Sbjct: 469  IEFKNVSFAYPTRPSNM-IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--S 525

Query: 983  GDVFVDGRP----RDQSFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQADDVSIEEKD 1037
            G++ +DG+       +S  R IG  QQ+ + L + T+R+++ +    +   D++    K 
Sbjct: 526  GEILIDGQNINDLNSKSLRRHIGLVQQEPI-LMSGTIRDNIVYGLTEMPTKDEIRQVAKQ 584

Query: 1038 KYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDS 1097
             +    I   +     D ++G  G  L+  Q++R+ I   L  KP++L+ LDE TS LD 
Sbjct: 585  CFCHNFITRFQSSY--DTVIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDV 641

Query: 1098 QTA----WSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGE 1149
            ++     ++  QLMKK   +   I+   H+ S +   E   ++ L   G  V  G+
Sbjct: 642  ESEGAINYTFGQLMKK---KEMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGK 692

>ACR022W [1070] [Homologous to ScYPL270W (MDL2) - SH]
            complement(395427..397691) [2265 bp, 754 aa]
          Length = 754

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 118/264 (44%), Gaps = 19/264 (7%)

Query: 923  FHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLIT 982
              +K++ +  P +    +I   +   + PG+   ++G SG GK+T+   L         +
Sbjct: 457  IEFKDVSFSYPTRP-TSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDAN--S 513

Query: 983  GDVFVDG----RPRDQSFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQADDVSIEEKD 1037
            G + +DG    +   +S  + +G  QQ+ + L + T+R+++ +  +Y    D++    K 
Sbjct: 514  GTILIDGQDISKVSAKSLRKHLGVVQQEPV-LMSGTIRDNITYGLSYTPSMDEIRAVAKK 572

Query: 1038 KYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDS 1097
             +    I   +     D ++G  G  L+  QR+R+ I   L  KPK+L+ LDE TS LD 
Sbjct: 573  CFCHNFIT--KFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILI-LDEATSALDV 629

Query: 1098 QTAWSTCQLMKKLASRGQAILCTI-HQPSALLMQEFDRLLFLQEGGQTVYFGELGKGCK- 1155
            ++  +    + +L    +  + +I H+ S +   E   ++ L   G  +  G+     + 
Sbjct: 630  ESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSE--NIVVLGNDGSVIEAGKFADLYRD 687

Query: 1156 ---TMINYFEAHGAHKCPPDANPA 1176
                +      H +    P+A+PA
Sbjct: 688  EDSELFKLLNEHASEPAKPEASPA 711

>KLLA0D00748g complement(69839..72208) similar to sp|P33311
            Saccharomyces cerevisiae YPL270w MDL2 ATP-binding
            cassette (ABC) transporter family member, hypothetical
            start
          Length = 789

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 82/338 (24%), Positives = 147/338 (43%), Gaps = 55/338 (16%)

Query: 924  HWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITG 983
             ++++ +  P +    +I  +++  ++PG+   ++G SG GK+T+   L         +G
Sbjct: 473  EFQHVSFSYPTRK-TNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNP--TSG 529

Query: 984  DVFVDG----RPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKY 1039
             + VDG    +   +S  R +G  QQ+ + L + T+RE++ +    RQ    S+EE    
Sbjct: 530  KILVDGQDITKLSSKSLRRQLGVVQQEPI-LMSGTIRENITYGVS-RQP---SMEE---- 580

Query: 1040 VEEVIEVLEMKLYADA-----------IVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFL 1088
                I  +  K +  A           I+G  G  L+  Q++R+ I   L  KPK+L+ L
Sbjct: 581  ----IRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILI-L 635

Query: 1089 DEPTSGLDSQTA----WSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQT 1144
            DE TS LD ++     ++  +LMK   S+   I+   H+ S +   E   ++ L   G  
Sbjct: 636  DEATSALDVESEGAINYTLGRLMK---SKELTIISIAHRLSTIRRSE--NVIVLGIDGSV 690

Query: 1145 VYFGELGKGCKTMINYFEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWRDSEE 1204
            V   E+GK      N+  A   HK   + +  +       A P         AI ++SE 
Sbjct: 691  V---EMGKFKDLYANHDSA--LHKLLTEPSEQQHSQHQQYAPP---------AITQESEP 736

Query: 1205 YREMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQI 1242
              E   + D  E +     E S ++ +K      ++Q+
Sbjct: 737  QTEENGKDDSGEDQNSDHEENSQDQNEKRLQEEVIHQV 774

>Kwal_56.22329
          Length = 776

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 111/231 (48%), Gaps = 15/231 (6%)

Query: 925  WKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAE--RTTMGLIT 982
            +K++ +  P + G + I + ++  ++PG+   ++G SG GK+T+   L      + G IT
Sbjct: 490  FKDVSFSYPTRPGNQ-IFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQIT 548

Query: 983  GDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEE 1042
             D     R   +S  R +G  QQ+ + L + +++ +L +        +VS++E     ++
Sbjct: 549  IDDQDISRLSCKSLRRHLGVVQQEPM-LMSGSIKYNLTYGL----QSEVSMDEIRSVAKK 603

Query: 1043 VI---EVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQT 1099
                  V +     D I+G  G  L+  Q++R+ I   L  KPK+L+ LDE TS LD ++
Sbjct: 604  CFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILI-LDEATSALDVES 662

Query: 1100 AWSTCQLMKKL-ASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGE 1149
              +    + KL  S+   I+   H+ S +   E   ++ L   G  V  G+
Sbjct: 663  EGAINYTLGKLMKSKELTIISIAHRLSTIRRSE--NVIVLGNDGSVVEVGK 711

>Scas_468.1
          Length = 691

 Score = 61.2 bits (147), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 111/236 (47%), Gaps = 21/236 (8%)

Query: 923  FHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLIT 982
              +KN+ +  P +  + +I  N++  ++PG+   ++G SG GK+T+   L         +
Sbjct: 390  IEFKNVSFSYPTRP-QNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHY--YNPTS 446

Query: 983  GDVFVDG----RPRDQSFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQADDVSIEEKD 1037
            G + +DG    +   +S  R +G  QQ+ + L + ++R+++ +   Y    +++    K 
Sbjct: 447  GQILIDGQDITKMNSKSLRRKLGIVQQEPV-LMSGSIRDNITYGLTYTPTKEEIRKVAKQ 505

Query: 1038 KYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDS 1097
             +    I   +     D  +G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD 
Sbjct: 506  CFCHNFIT--KFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILI-LDEATSALDV 562

Query: 1098 QTA----WSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGE 1149
            ++     ++  QLMK   ++   I+   H+ S +   E   ++ L   G  +  G+
Sbjct: 563  ESEGAINYTFGQLMK---TKSMTIVSIAHRLSTIRRSE--NVIVLGNDGSVIEMGK 613

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 103/258 (39%), Gaps = 29/258 (11%)

Query: 194 QILKPMDGCINPGELLVVLGRPGAGCTT----LLKSISVNTHGFKISPDTIITYNGFSNK 249
           QI K ++  I PG  + ++G  G G +T    LL   +  +    I    I   N  S +
Sbjct: 406 QIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLR 465

Query: 250 EIKNHYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAKHMTEVAMA 309
                 + E V  + S   I     +   YT       +  I+ V +  F  +       
Sbjct: 466 RKLGIVQQEPVLMSGS---IRDNITYGLTYTPT-----KEEIRKVAKQCFCHNFIT---- 513

Query: 310 TYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLD----SATAL 365
                HT DT++G      +SGG+++R++IA   I        D AT  LD     A   
Sbjct: 514 --KFPHTYDTQIGPSGTL-LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 570

Query: 366 EFIKALKTQA-TITKSAATVAIYQCSKDAYDLFDKVCVLYDG--YQIFFGPSKQAKKYFQ 422
            F + +KT++ TI   A  ++  + S++   L +   V+  G   ++F  PS +  K   
Sbjct: 571 TFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPSSELSKLLN 630

Query: 423 RMGYVCPERQTTADYLTS 440
                   ++T +D ++S
Sbjct: 631 EK---SSRKKTKSDPISS 645

>YLR188W (MDL1) [3591] chr12 (528302..530389) Member of the
            ATP-binding cassette (ABC) superfamily, equivalent to a
            "half-sized" ABC protein with one ATP-binding domain and
            one transmembrane domain, involved in release of peptides
            from mitochondria [2088 bp, 695 aa]
          Length = 695

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 114/248 (45%), Gaps = 26/248 (10%)

Query: 912  DDIELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDC 971
            D + L++   +F  KN+ +  P +  K +I  +++  +KPG     +G SG+GK+T+   
Sbjct: 423  DPVSLAQKPIVF--KNVSFTYPTRP-KHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASL 479

Query: 972  LAERTTMGLITGDV-FVDGRPRD---QSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQ 1027
            L     +   +G + F D   R+   + + R IGY QQ+ L L   T+ +++ +      
Sbjct: 480  LLRYYDVN--SGSIEFGDEDIRNFNLRKYRRLIGYVQQEPL-LFNGTILDNILYCI---- 532

Query: 1028 ADDVSIEEKDKYVEEVIEVLE-MKLYAD------AIVGVPGEGLNVEQRKRLTIGVELAA 1080
                 I E+D  +   I      K  A+       +VG  G  L+  Q++R+ +      
Sbjct: 533  --PPEIAEQDDRIRRAIGKANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLL 590

Query: 1081 KPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQE 1140
             P +L+ LDE TS LDSQ+     + +++   RG   +   H+ S +  +   R++ L +
Sbjct: 591  DPAVLI-LDEATSALDSQSEEIVAKNLQRRVERGFTTISIAHRLSTI--KHSTRVIVLGK 647

Query: 1141 GGQTVYFG 1148
             G  V  G
Sbjct: 648  HGSVVETG 655

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 84/202 (41%), Gaps = 29/202 (14%)

Query: 194 QILKPMDGCINPGELLVVLGRPGAGCTT----LLKSISVNTHGFKISPDTIITYNGFSNK 249
           QI K ++  I PGE +  +G  G+G +T    LL+   VN+   +   + I  +N     
Sbjct: 448 QIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNFN----- 502

Query: 250 EIKNHYRGEVVYNAESDIHIPHLTVFQTLYTVA-RLKTPRNRIKGVDRDTFAKHMTEVAM 308
                YR  + Y  +  +      +   LY +   +    +RI    R    K      +
Sbjct: 503 --LRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQDDRI----RRAIGKANCTKFL 556

Query: 309 ATY--GLSHTADTKVGNDFVRG--VSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATA 364
           A +  GL     T VG    RG  +SGG+++R+++A   +        D AT  LDS + 
Sbjct: 557 ANFPDGL----QTMVG---ARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQS- 608

Query: 365 LEFIKALKTQATITKSAATVAI 386
            E I A   Q  + +   T++I
Sbjct: 609 -EEIVAKNLQRRVERGFTTISI 629

>KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces
            cerevisiae YLR188w MDL1 ATP-binding cassette transporter
            family member, hypothetical start
          Length = 706

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 112/240 (46%), Gaps = 22/240 (9%)

Query: 923  FHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLIT 982
             H+ ++ +  P +  +  I ++++  V+PG    ++G SG GK+T+   L     +G  +
Sbjct: 428  IHFNHVKFSYPTRP-QHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVASLLLRYYDIG--S 484

Query: 983  GDVFV-DGRPRD---QSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDK 1038
            G++ + +   RD   + + R +G  QQ+ + L + T+ +++ ++      +D     + +
Sbjct: 485  GEIKLGNDNIRDFNLRKYRRLLGVVQQEPM-LFSGTILDNITYAVPQELVND-----ETR 538

Query: 1039 YVEEVIEVLEMKLYAD------AIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPT 1092
                + +    K  A+        VG  G  L+  Q++R+ +       P +L+ LDE T
Sbjct: 539  ISRAIGQANCTKFLANFPDGLQTTVGPRGTQLSGGQKQRIALARAFLLDPSILI-LDEAT 597

Query: 1093 SGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGELGK 1152
            S LDSQ+     Q +++ ++RG+  +   H+ S +  Q   R++ L   G     G   K
Sbjct: 598  SALDSQSEEVVAQSLQQRSARGKTTISIAHRVSTI--QHSSRVIVLNRHGTVAETGSFDK 655

>Kwal_56.23844
          Length = 1494

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 101/209 (48%), Gaps = 23/209 (11%)

Query: 942  LDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSIG 1001
            L N++  +KP     ++G +GAGK++L   LA    +    G + +DG P D     SIG
Sbjct: 1269 LRNINIDIKPQERIGIVGRTGAGKSSL--TLALFRIIEAAEGRIIIDGVPTD-----SIG 1321

Query: 1002 YCQQQDL-HLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMK-----LYADA 1055
                +DL H  +   ++S  F   +R+  D + E  D+ +   +E+  +K     L  D 
Sbjct: 1322 L---RDLRHHLSIIPQDSQVFEGTVRENIDPTNEYTDEEIWHALELAHLKDHIKSLGKDE 1378

Query: 1056 IVGVPGEG---LNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLAS 1112
            +  +  EG   L+V QR+ + +   L    ++LV LDE T+ +D +T     Q   + A 
Sbjct: 1379 LESMLTEGGGNLSVGQRQLMCLARALLIPTRILV-LDEATAAVDVETD-QVIQETIRTAF 1436

Query: 1113 RGQAILCTIHQPSALLMQEFDRLLFLQEG 1141
            + + IL   H+ + +L  + DR+L L  G
Sbjct: 1437 KNRTILTIAHRINTIL--DSDRILVLDSG 1463

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 73/162 (45%), Gaps = 22/162 (13%)

Query: 942  LDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVF-VDGRPRDQSFPRSI 1000
            L N++   K G LT ++G  G+GK+ L+           I GD+F V G     S   SI
Sbjct: 631  LKNINFQAKKGELTCIVGKVGSGKSALIQG---------ILGDLFRVKGFA---SVHGSI 678

Query: 1001 GYCQQQDLHLKTATVRESLRFSAYLRQAD--DVSIEEKDKYVEEVIEVLEMKLYADAIVG 1058
             Y  Q    +   TV+E++ F  +   AD  D ++      V+  I    +    + +VG
Sbjct: 679  AYVSQVPW-IMNGTVKENILF-GHKYDADFYDTTLRACALAVDLSI----LPKGDETLVG 732

Query: 1059 VPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTA 1100
              G  L+  Q+ R+++   + A+    + LD+P + +D   A
Sbjct: 733  EKGISLSGGQKARISLARAVYARADTYL-LDDPLAAVDEHVA 773

>CAGL0E00385g 31723..33549 similar to sp|P33310 Saccharomyces
            cerevisiae YLR188w MDL1 or sp|P33311 Saccharomyces
            cerevisiae YPL270w MDL2, hypothetical start
          Length = 608

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 100/208 (48%), Gaps = 9/208 (4%)

Query: 936  NGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAE--RTTMGLITGDVFVDGRPRD 993
            NGK  +L  ++  + PG     +G SG GK+T+   L    RT  G I+   +       
Sbjct: 377  NGKS-VLSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYDISAFNL 435

Query: 994  QSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYA 1053
            + + R +G  QQ+ L L   T+ +++ +  + +   D+++  K    ++ I+   M L  
Sbjct: 436  RKYRRMLGVVQQEPL-LFNGTILDNITYGLHDKSLTDLNMALKAANCDQFIKESHMGL-- 492

Query: 1054 DAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASR 1113
            D +VG  G  L+  QR+R+ +       P +L+ LDE TS LD+++     + +++    
Sbjct: 493  DTLVGPRGAQLSGGQRQRIALARVFLQNPDILI-LDEATSALDTKSEDIINKELQRRQEA 551

Query: 1114 GQAILCTIHQPSALLMQEFDRLLFLQEG 1141
            G   +   H+ S +  +   R++ +++G
Sbjct: 552  GMTTISIAHRLSTI--RHSSRVIVIEDG 577

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 71/308 (23%), Positives = 117/308 (37%), Gaps = 59/308 (19%)

Query: 129 SDFYKPFSLGCAWKDLSASGDSADITYQGTFGNMPIKYLK---MSWRCISRRLFHRTHGK 185
           + FY     GC   +      +       T G  P K LK   +++  +S   F  ++GK
Sbjct: 323 TGFYSELMKGCGAAERVLELQNMKTKISPTKGISPPKTLKGLPITFNNVS---FAYSNGK 379

Query: 186 SEDNDSGFQILKPMDGCINPGELLVVLGRPGAGCTT----LLKSISVNTHGFKISPDTII 241
           S        +L  M+  I+PGE +  +G  G G +T    LL+     +    I    I 
Sbjct: 380 S--------VLSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYDIS 431

Query: 242 TYN--------GFSNKEIKNHYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKG 293
            +N        G   +E    + G ++ N    +H   LT                 +K 
Sbjct: 432 AFNLRKYRRMLGVVQQE-PLLFNGTILDNITYGLHDKSLTDLNM------------ALKA 478

Query: 294 VDRDTFAKHMTEVAMATYGLSHTA-DTKVGNDFVRG--VSGGERKRVSIAEVSICGSKFQ 350
            + D F K            SH   DT VG    RG  +SGG+R+R+++A V +      
Sbjct: 479 ANCDQFIKE-----------SHMGLDTLVGP---RGAQLSGGQRQRIALARVFLQNPDIL 524

Query: 351 CWDNATRGLDSATALEFIKALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIF 410
             D AT  LD+ +     K L+ +     +  ++A ++ S   +    +V V+ DG  + 
Sbjct: 525 ILDEATSALDTKSEDIINKELQRRQEAGMTTISIA-HRLSTIRHS--SRVIVIEDGRVVE 581

Query: 411 FGPSKQAK 418
            G   Q +
Sbjct: 582 SGSFDQLR 589

>Scas_693.42
          Length = 1512

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 101/213 (47%), Gaps = 29/213 (13%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSI 1000
            IL +++  +KP     ++G +GAGK++L   LA    +   +G + +D  P ++     I
Sbjct: 1286 ILKDINVHIKPKEKVGIVGRTGAGKSSL--TLALFRIIEASSGRIVIDNVPINE-----I 1338

Query: 1001 GYCQQQDLHLKTATV-RESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGV 1059
            G     DL  K + + ++S  F   +R+  D + E  D   E++  VL +    D I+ +
Sbjct: 1339 GL---YDLRHKLSIIPQDSQVFEGTVRENIDPTNEYTD---EQIWNVLALSHLKDHIISM 1392

Query: 1060 PGEGLN-----------VEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMK 1108
              EGLN           V QR+ L +   L    K+L+ LDE T+ +D +T     Q   
Sbjct: 1393 GDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILL-LDEATAAVDVETD-KVIQETI 1450

Query: 1109 KLASRGQAILCTIHQPSALLMQEFDRLLFLQEG 1141
            + A + + IL   H+ + ++  + DR++ L  G
Sbjct: 1451 RTAFKDRTILTIAHRINTIM--DSDRIIVLDNG 1481

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 72/162 (44%), Gaps = 22/162 (13%)

Query: 942  LDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPR--- 998
            L N++   K G LT ++G  G+GK+ ++           I GD+F     R + F     
Sbjct: 643  LKNINFQAKKGELTCIVGKVGSGKSAMIQS---------ILGDLF-----RVKGFATIHG 688

Query: 999  SIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVG 1058
            ++ Y  Q    +   TV+E++ F     + D+   ++  K     I++  +      +VG
Sbjct: 689  NVAYVSQVAW-IMNGTVKENILFG---HKYDEDFYQKTIKACALTIDLAVLMDGDQTLVG 744

Query: 1059 VPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTA 1100
              G  L+  Q+ RL++   + ++    + LD+P + +D   A
Sbjct: 745  EKGISLSGGQKARLSLARAVYSRADTYL-LDDPLAAVDEHVA 785

>Scas_587.8
          Length = 715

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 109/233 (46%), Gaps = 14/233 (6%)

Query: 923  FHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLIT 982
              ++N+ +  P +     IL+N+   ++PG    ++G SG+GK+T+   L     +   T
Sbjct: 443  IEFQNVSFAYPTRP-THSILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLLRYYDVS--T 499

Query: 983  GDVFVDGRPRDQ----SFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDK 1038
            G + +DG+   +     + R +G  QQ+ + L   T+ +++ ++   ++    +  +  +
Sbjct: 500  GSIKIDGQNIKEFNLRKYRRLLGVVQQEPM-LFNGTILDNILYAVLSKETLTANSPDVKR 558

Query: 1039 YVEEVIEVLEMKLYADAI---VGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGL 1095
             +E+      +K + + +   VG  G  L+  Q++R+ +       P LL+ LDE TS L
Sbjct: 559  ALEQANCTKFLKNFPEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLI-LDEATSAL 617

Query: 1096 DSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFG 1148
            DSQ+     + + +    G   +   H+ S +  +   R++ L + G  V  G
Sbjct: 618  DSQSEEIVAKNLSERVELGLTTISIAHRLSTI--KHSTRVIVLDKSGSVVETG 668

>Kwal_26.9480
          Length = 719

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 110/236 (46%), Gaps = 34/236 (14%)

Query: 919  SQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTM 978
            S+ +F   +  YD       R IL N    +  G+ TA++G SG+GK+T+L  +      
Sbjct: 461  SEIVFKNVSFGYD-----PDRLILKNASFTIPTGSKTAIVGPSGSGKSTILKLVFR--FY 513

Query: 979  GLITGDVFVDG---RPRD-QSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIE 1034
              I G + +DG   R  D +S  RSIG    QD  L   ++ ++++F           I+
Sbjct: 514  DPIEGRILLDGKDVRELDIESLRRSIGVV-PQDTPLFNESIWDNVKFG---------RID 563

Query: 1035 EKDKYVEEVIEVLEMKLYA-------DAIVGVPGEGLNVEQRKRLTIG-VELAAKPKLLV 1086
              D+ +E  I+  +++          D IVG  G  ++  +++RL I  V L   P  ++
Sbjct: 564  ATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIARVLLKDAP--IM 621

Query: 1087 FLDEPTSGLDSQTAWSTCQLMKKLASRGQAILCTI-HQPSALLMQEFDRLLFLQEG 1141
            F DE TS LD+ T  +  + +K+  + G      I H+   +   + D+++ L+ G
Sbjct: 622  FFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHRLRTI--ADADKIIVLEHG 675

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 47/91 (51%), Gaps = 7/91 (7%)

Query: 318 DTKVGNDFVRG--VSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQA 375
           DT VG    RG  +SGGE++R++IA V +  +    +D AT  LD+ T    ++ +K   
Sbjct: 590 DTIVGE---RGLMISGGEKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKENF 646

Query: 376 TITKSAATVAIYQCSKDAYDLFDKVCVLYDG 406
           T T S  +V I    +   D  DK+ VL  G
Sbjct: 647 T-TGSKTSVYIAHRLRTIADA-DKIIVLEHG 675

>CAGL0M13739g complement(1346231..1348414) similar to sp|P40416
            Saccharomyces cerevisiae YMR301c ATM1, hypothetical start
          Length = 727

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 103/219 (47%), Gaps = 29/219 (13%)

Query: 936  NGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAE----RTTMGLITGDVFVDGRP 991
            +G+R+IL N    +  G  TA+ G SG+GK+T+L  +           L+ G   VD R 
Sbjct: 475  DGQRKILKNASFTIPAGMKTAIAGPSGSGKSTVLKLVFRFYDPEEGRVLVNG---VDVRE 531

Query: 992  RD-QSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIE----- 1045
             D     ++IG    QD  L   T+ E+++F           IE  D+ +  VI+     
Sbjct: 532  YDIDQLRKAIGVV-PQDTPLFNDTIWENVKFG---------RIEASDEEITRVIDKAQLS 581

Query: 1046 --VLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWST 1103
              + ++   +  IVG  G  ++  +++RL I   +  K   ++F DE TS LD+ T  S 
Sbjct: 582  DLIAKLPQGSSTIVGERGLMISGGEKQRLAIA-RVLLKDADIMFFDEATSALDTHTEQSL 640

Query: 1104 CQLMKKLASRGQAILCTI-HQPSALLMQEFDRLLFLQEG 1141
             + +++  + G+     I H+   +   + D+++ L+EG
Sbjct: 641  LRTIRRNFNSGEKTSVYIAHRLRTI--ADADKIIVLEEG 677

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 94/228 (41%), Gaps = 36/228 (15%)

Query: 190 DSGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNK 249
           D   +ILK     I  G    + G  G+G +T+LK +      F    +  +  NG   +
Sbjct: 475 DGQRKILKNASFTIPAGMKTAIAGPSGSGKSTVLKLV----FRFYDPEEGRVLVNGVDVR 530

Query: 250 EIKNHYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRI-KGVDRDTFAKHMTEVAM 308
           E       + +     D  + + T+++ +    R++     I + +D+   +  + +   
Sbjct: 531 EYDIDQLRKAIGVVPQDTPLFNDTIWENV-KFGRIEASDEEITRVIDKAQLSDLIAK--- 586

Query: 309 ATYGLSHTADTKVGNDFVRG--VSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALE 366
               L   + T VG    RG  +SGGE++R++IA V +  +    +D AT  LD+ T   
Sbjct: 587 ----LPQGSSTIVGE---RGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQS 639

Query: 367 FIKAL--------KTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDG 406
            ++ +        KT   I     T+A      DA    DK+ VL +G
Sbjct: 640 LLRTIRRNFNSGEKTSVYIAHRLRTIA------DA----DKIIVLEEG 677

>AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH]
            complement(82640..84715) [2076 bp, 691 aa]
          Length = 691

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 107/210 (50%), Gaps = 15/210 (7%)

Query: 938  KRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCL---AERTTMGLITGDVFVDGRPRD- 993
            +RRIL+NV   +  G  TA++G SG+GK+T+L  +    E     ++ G    D R  D 
Sbjct: 447  ERRILNNVSFTIPAGMKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGG--TDIRDLDL 504

Query: 994  QSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLE-MKLY 1052
             S  ++IG    QD  L   T+ E+++F   +  +DD  +   +K   ++ ++L+ +   
Sbjct: 505  LSLRKAIGVV-PQDTPLFNDTIWENVKF-GNISSSDDEILRAIEK--AQLTKLLQNLPKG 560

Query: 1053 ADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKK-LA 1111
            A  +VG  G  ++  +++RL I   +  K   L+F DE TS LD+ T  +    +++  +
Sbjct: 561  ASTVVGERGLMISGGEKQRLAIA-RVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFS 619

Query: 1112 SRGQAILCTIHQPSALLMQEFDRLLFLQEG 1141
            S  +  +   H+   +   + D+++ L++G
Sbjct: 620  SNSKTSVYVAHRLRTI--ADADKIIVLEQG 647

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 7/96 (7%)

Query: 313 LSHTADTKVGNDFVRG--VSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKA 370
           L   A T VG    RG  +SGGE++R++IA V +  +    +D AT  LD+ T    +  
Sbjct: 557 LPKGASTVVGE---RGLMISGGEKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHT 613

Query: 371 LKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDG 406
           ++ Q   + S  +V +    +   D  DK+ VL  G
Sbjct: 614 IQ-QNFSSNSKTSVYVAHRLRTIADA-DKIIVLEQG 647

>YMR301C (ATM1) [4255] chr13 complement(867554..869626) Member of the
            ATP-binding cassette (ABC) superfamily of membrane
            transporters, component of the mitochondrial inner
            membrane [2073 bp, 690 aa]
          Length = 690

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 92/202 (45%), Gaps = 34/202 (16%)

Query: 926  KNLCYDIPIKN------GKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMG 979
            +N+ YDI  +N        R+IL N    +  G  TA++G+SG+GK+T+L  +       
Sbjct: 430  ENVPYDITFENVTFGYHPDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPE 489

Query: 980  LITGDVFVDGR---PRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEK 1036
              +G + ++GR     D    R +     QD  L   T+ E+++F           I+  
Sbjct: 490  --SGRILINGRDIKEYDIDALRKVIGVVPQDTPLFNDTIWENVKFG---------RIDAT 538

Query: 1037 DKYVEEVIEVLEMKLYA----------DAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLV 1086
            D   EEVI V+E    A          D IVG  G  ++  +++RL I   L    +++ 
Sbjct: 539  D---EEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAIARVLLKNARIM- 594

Query: 1087 FLDEPTSGLDSQTAWSTCQLMK 1108
            F DE TS LD+ T  +  + ++
Sbjct: 595  FFDEATSALDTHTEQALLRTIR 616

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 96/218 (44%), Gaps = 24/218 (11%)

Query: 194 QILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKI-SPDT-IITYNGFSNKEI 251
           +ILK     I  G    ++G  G+G +T+LK +      F+   P++  I  NG   KE 
Sbjct: 450 KILKNASFTIPAGWKTAIVGSSGSGKSTILKLV------FRFYDPESGRILINGRDIKEY 503

Query: 252 KNHYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTF-AKHMTEVAMAT 310
                 +V+     D  + + T+++ +           RI   D +        ++A   
Sbjct: 504 DIDALRKVIGVVPQDTPLFNDTIWENV--------KFGRIDATDEEVITVVEKAQLAPLI 555

Query: 311 YGLSHTADTKVGNDFVRG--VSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFI 368
             L    DT VG    RG  +SGGE++R++IA V +  ++   +D AT  LD+ T    +
Sbjct: 556 KKLPQGFDTIVGE---RGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALL 612

Query: 369 KALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDG 406
           + ++   T + S  +V I    +   D  DK+ VL +G
Sbjct: 613 RTIRDNFT-SGSRTSVYIAHRLRTIADA-DKIIVLDNG 648

>Scas_574.8
          Length = 702

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 84/176 (47%), Gaps = 26/176 (14%)

Query: 936  NGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCL-----AERTTMGLITGDVFVDGR 990
            + KR+IL+N    +  G  TA++G SG+GK+T+L  +      E+  + LI G   VD +
Sbjct: 446  DSKRKILNNASFTIPGGLKTAVVGPSGSGKSTILKLVFRFYDPEQGRI-LING---VDVK 501

Query: 991  PRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIE----- 1045
              D    R +     QD  L   T+ E+++F           I+  D+ V  VIE     
Sbjct: 502  EYDVDSLRRVMGVVPQDTPLFNDTIWENVKFG---------RIDATDEEVHTVIEKAQLA 552

Query: 1046 --VLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQT 1099
              + ++    + IVG  G  ++  +++RL I   L    K++ F DE TS LD+ T
Sbjct: 553  PLIKKLPQGYETIVGERGMMISGGEKQRLAIARVLLKNAKIM-FFDEATSALDTHT 607

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 90/220 (40%), Gaps = 20/220 (9%)

Query: 190 DSGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTIITYNGFSNK 249
           DS  +IL      I  G    V+G  G+G +T+LK +      F       I  NG   K
Sbjct: 446 DSKRKILNNASFTIPGGLKTAVVGPSGSGKSTILKLV----FRFYDPEQGRILINGVDVK 501

Query: 250 EIKNHYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFAK-HMTEVAM 308
           E        V+     D  + + T+++ +           RI   D +        ++A 
Sbjct: 502 EYDVDSLRRVMGVVPQDTPLFNDTIWENV--------KFGRIDATDEEVHTVIEKAQLAP 553

Query: 309 ATYGLSHTADTKVGNDFVRG--VSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALE 366
               L    +T VG    RG  +SGGE++R++IA V +  +K   +D AT  LD+ T   
Sbjct: 554 LIKKLPQGYETIVGE---RGMMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQA 610

Query: 367 FIKALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDG 406
            +  ++     + S  +V I    +   D  DK+ VL DG
Sbjct: 611 LLTTIRANFE-SGSRTSVYIAHRLRTIADA-DKIIVLEDG 648

>KLLA0F20075g complement(1868786..1873336) similar to sp|P39109
            Saccharomyces cerevisiae YDR135c YCF1 glutathione
            S-conjugate transporter, vacuolar, start by similarity
          Length = 1516

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 105/221 (47%), Gaps = 35/221 (15%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSI 1000
            IL ++D  + P     ++G +GAGK++L   LA    +   +G + +DG P D     SI
Sbjct: 1291 ILKDIDLHIHPKEKIGIVGRTGAGKSSL--TLALFRIIEAASGHIVIDGIPID-----SI 1343

Query: 1001 GYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYV-EEVIEVLEMKLYADAIVGV 1059
            G    +  H  +   ++S  F   +R+    +I+  ++Y  EE+   L +    D I+G+
Sbjct: 1344 GLADLR--HGLSIIPQDSQIFEGTVRE----NIDPTNRYTDEEIWNALALSHLKDHILGM 1397

Query: 1060 -----------PGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMK 1108
                        G  L+V QR+ + +   L     +L+ LDE T+ +D +T     QL++
Sbjct: 1398 GSNGLETMLTEGGSNLSVGQRQLMCLARALLISSNILI-LDEATAAVDVETD----QLIQ 1452

Query: 1109 KL---ASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVY 1146
            K    A + + IL   H+ + ++  + DR++ L +G  T +
Sbjct: 1453 KTIRNAFKERTILTIAHRINTIM--DSDRIIVLDKGRVTEF 1491

>KLLA0A10131g complement(889688..891850) similar to sp|P40416
            Saccharomyces cerevisiae YMR301c ATM1 ATP-binding
            cassette transporter protein, mitochondrial, hypothetical
            start
          Length = 720

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 82/175 (46%), Gaps = 10/175 (5%)

Query: 939  RRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDG---RPRDQS 995
            R IL N    + PG  TA++G SG+GK+T+L  +          G + +DG   R  D  
Sbjct: 469  RNILKNATFTIAPGKKTAIVGPSGSGKSTILRLVFRFYDPQ--QGRILLDGKDIRELDLD 526

Query: 996  FPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADA 1055
              R I     QD  L   T+ E+++F       +++    +   + ++I  L      + 
Sbjct: 527  ELRRIVGVVPQDTPLFNDTIWENVKFGRINATDNEIVTAIEKAQLSDLIHKLPKG--TET 584

Query: 1056 IVGVPGEGLNVEQRKRLTIG-VELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKK 1109
            IVG  G  ++  +++RL I  V L   P  ++F DE TS LD+ T  S  + +K+
Sbjct: 585  IVGERGLMISGGEKQRLAIARVLLKDTP--IMFFDEATSALDTHTEQSLLKTIKE 637

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 102/230 (44%), Gaps = 26/230 (11%)

Query: 185 KSEDNDSGFQ----ILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTI 240
           K E+   G+Q    ILK     I PG+   ++G  G+G +T+L+ +      F       
Sbjct: 457 KFENVTFGYQPDRNILKNATFTIAPGKKTAIVGPSGSGKSTILRLV----FRFYDPQQGR 512

Query: 241 ITYNGFSNKEIKNHYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFA 300
           I  +G   +E+       +V     D  + + T+++ +    R+    N I        A
Sbjct: 513 ILLDGKDIRELDLDELRRIVGVVPQDTPLFNDTIWENV-KFGRINATDNEI------VTA 565

Query: 301 KHMTEVAMATYGLSHTADTKVGNDFVRG--VSGGERKRVSIAEVSICGSKFQCWDNATRG 358
               +++   + L    +T VG    RG  +SGGE++R++IA V +  +    +D AT  
Sbjct: 566 IEKAQLSDLIHKLPKGTETIVGE---RGLMISGGEKQRLAIARVLLKDTPIMFFDEATSA 622

Query: 359 LDSATALEFIKALKTQ-ATITKSAATVA-IYQCSKDAYDLFDKVCVLYDG 406
           LD+ T    +K +K   + + K++  +A   +   DA    DK+ VL +G
Sbjct: 623 LDTHTEQSLLKTIKENFSDVAKTSVYIAHRLRTIADA----DKIIVLENG 668

>Scas_612.11*
          Length = 1506

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 106/240 (44%), Gaps = 35/240 (14%)

Query: 924  HWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDC---LAERTTMGL 980
            H++N+  D   + G   +L N+   +K G    + G +GAGK+T++     L E ++  +
Sbjct: 1246 HFENV--DFSYRPGLPTVLKNLSLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISSGKM 1303

Query: 981  ITGDVFV------DGR------PRDQSFPRSI------GYCQQQDLHLKTATVRESLRFS 1022
            I  DV +      D R      P+D    R         + + QD HL  A VR      
Sbjct: 1304 IIDDVDISTIGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHQDEHLWNALVRGGAIEQ 1363

Query: 1023 AYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKP 1082
              L +      +EK  + E        K + D +V   G   ++ +R+ L +   L  + 
Sbjct: 1364 KELNEIKAQKPDEKGNHSE------MYKFHLDQLVEEEGANFSLGERQLLALTRALVRQA 1417

Query: 1083 KLLVFLDEPTSGLDSQTAWST-CQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEG 1141
            ++L+ LDE TS +D +T      +++++       ILC  H+   +L   +DR+L L++G
Sbjct: 1418 RILI-LDEATSSVDYETDGKIQARIVEEFGH--CTILCIAHRLKTILT--YDRILVLEKG 1472

 Score = 34.7 bits (78), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 98/228 (42%), Gaps = 45/228 (19%)

Query: 949  VKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDL 1008
            +K G    ++G  G GKT+LL+  A    M  ++G + ++G      +P           
Sbjct: 656  IKKGEFIIMVGPIGTGKTSLLNAFA--GFMNKVSGRIQINGDLLLCGYP----------- 702

Query: 1009 HLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAI-------VGVPG 1061
             ++ A+V++++ F +   +A         KY +EVI V  +K   D +       +G  G
Sbjct: 703  WIQNASVKDNIIFGSPYNKA---------KY-DEVIRVCSLKSDLDILPAGDLTEIGERG 752

Query: 1062 EGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTA---WSTCQLMKKLASRGQAIL 1118
              L+  Q+ R+ +   +  +  + +F D+  S +DS+        C L   L      IL
Sbjct: 753  ITLSGGQKARINLARSVYKQKDIYLF-DDVLSAVDSRVGKHIMDECFL--GLLKDKTRIL 809

Query: 1119 CTIHQPSALLMQEFDRLLFLQEGGQ----TVYFGELGKGCKTMINYFE 1162
             T HQ S  L++   R++ L   G     TV   EL +   T++N  +
Sbjct: 810  AT-HQLS--LLERASRVIVLGNDGSFDIGTV--EELKQRSSTLVNLLQ 852

>CAGL0L06402g 718726..723333 highly similar to sp|P39109 Saccharomyces
            cerevisiae YDR135c YCF1 or sp|P14772 Saccharomyces
            cerevisiae YLL015w BPT1, hypothetical start
          Length = 1535

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 98/207 (47%), Gaps = 17/207 (8%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSI 1000
            +L +++  +KP     ++G +GAGK++L   LA    +   +G + +DG   ++     +
Sbjct: 1310 VLKDINLEIKPREKIGIVGRTGAGKSSL--TLALFRIIEATSGGILIDGVHINEIGLHDL 1367

Query: 1001 GYCQQ---QDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIV 1057
             +      QD  +   T+RE++  +     AD     E     E +     M++  D ++
Sbjct: 1368 RHHLSIIPQDSQVFEGTIRENIDPTNQFTDADIWRALELSHLKEHI-----MQMGGDGLM 1422

Query: 1058 GVPGEG---LNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRG 1114
             +  EG   L+V QR+ + +   L    K+LV LDE T+ +D +T     Q   + + + 
Sbjct: 1423 TMMTEGGSNLSVGQRQLMCLARALLVPSKVLV-LDEATAAVDVETD-KVIQETIRTSFKD 1480

Query: 1115 QAILCTIHQPSALLMQEFDRLLFLQEG 1141
            + IL   H+ + ++  + DR++ L +G
Sbjct: 1481 RTILTIAHRINTIM--DNDRIIVLDKG 1505

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 76/184 (41%), Gaps = 29/184 (15%)

Query: 920  QAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMG 979
             A F WK        K   +  L N++   K G L+ ++G  G+GK+  L  L       
Sbjct: 650  NATFLWKR-------KPEYKVALKNINYQAKKGELSCIVGKVGSGKSAFLQSLL------ 696

Query: 980  LITGDVFVDGRPRDQSFPR---SIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEK 1036
               GD+F     R + F     S+ Y  Q    +   TVR+++ F     + D    E+ 
Sbjct: 697  ---GDLF-----RVKGFATIHGSVAYVSQVAW-IMNGTVRDNVLFG---HKYDPEFYEKT 744

Query: 1037 DKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLD 1096
             K     I++  +      +VG  G  L+  Q+ RL++   + A+    + LD+P + +D
Sbjct: 745  IKACALTIDLATLVDGDQTLVGEKGISLSGGQKARLSLARAVYARADTYL-LDDPLAAVD 803

Query: 1097 SQTA 1100
               +
Sbjct: 804  EHVS 807

>AGR047W [4357] [Homologous to ScYDR135C (YCF1) - SH]
            complement(802685..807163) [4479 bp, 1492 aa]
          Length = 1492

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 104/224 (46%), Gaps = 29/224 (12%)

Query: 930  YDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDG 989
            Y    + G   IL  ++  +KP     ++G +GAGK++L   L+    +    G + +DG
Sbjct: 1255 YSTRYRPGLDLILRGINLHIKPHERVGIVGRTGAGKSSL--ALSLFRIIEAAEGHISIDG 1312

Query: 990  RPRDQSFPRSIGYCQQQDLHLKTATV-RESLRFSAYLRQADDVSIEEKDKYVEEVIEVLE 1048
             P D     +IG     DL  K + + ++S  F   +R   D + +  D   E++ + LE
Sbjct: 1313 VPID-----TIGLT---DLRKKLSIIPQDSQVFEGTVRDNIDPTKQYTD---EQIWKALE 1361

Query: 1049 MKLYADAIVGVPGEGLN-----------VEQRKRLTIGVELAAKPKLLVFLDEPTSGLDS 1097
            +   AD + G+  +GL+           V QR+ + +   L    ++LV LDE T+ +D 
Sbjct: 1362 LSHLADHVKGMGSDGLDTPLTEGGKNLSVGQRQLMCLARALLIPFRILV-LDEATAAIDV 1420

Query: 1098 QTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEG 1141
            +T     Q   + +   + IL   H+ + ++  + D+++ L +G
Sbjct: 1421 ETD-KVIQDTIRSSFNDRTILTIAHRINTIM--DSDKIVVLDKG 1461

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 70/160 (43%), Gaps = 18/160 (11%)

Query: 942  LDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPR-SI 1000
            L N++   K   LT +IG  G+GK+ L+  +          GD+F   R    +  R ++
Sbjct: 628  LKNINFRAKKSELTCIIGKVGSGKSALIQAM---------LGDLF---RVNGSAVVRGNV 675

Query: 1001 GYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVP 1060
             Y  Q    +   TVR+++ F     + D    ++  K     +++  +    +  VG  
Sbjct: 676  AYVSQVAW-IMNGTVRDNILFG---HKYDAKFYQQTIKACALTVDLSILPDGDNTFVGEK 731

Query: 1061 GEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTA 1100
            G  L+  Q+ RL++   + A+    + LD+P + +D   A
Sbjct: 732  GISLSGGQKARLSLARAVYARADTYL-LDDPLAAVDEHVA 770

>CAGL0C03289g 328799..333745 similar to sp|P32386 Saccharomyces
            cerevisiae YLL048c YBT1 yeast bile transporter,
            hypothetical start
          Length = 1648

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 97/216 (44%), Gaps = 30/216 (13%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDG-RPRDQ----- 994
            +L N+D     G L  ++GA+G+GKT++L  L     M L  G + V    PR +     
Sbjct: 723  VLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGE--MQLSEGKIIVPSLSPRHEYQSQA 780

Query: 995  -SFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYA 1053
                 SI YC Q    L   TVR ++ F+A   QA         +Y + V+E   +K   
Sbjct: 781  GVINDSIAYCSQAAWLLND-TVRNNILFNAPFDQA---------RY-DAVVEACSLKRDF 829

Query: 1054 DAI-------VGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTA-WSTCQ 1105
              +       +G  G  L+  Q++R+++   L +    L+ LD+  S +DS TA W   +
Sbjct: 830  QILKAGDSTEIGEKGITLSGGQKQRVSLARALYSSAGHLL-LDDCLSAVDSHTALWIYDK 888

Query: 1106 LMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEG 1141
             +      G+  +   H   AL M+  D ++ +++G
Sbjct: 889  CISGPLMEGRTCILVTHNI-ALTMKNADFVVMIEDG 923

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 46/219 (21%), Positives = 97/219 (44%), Gaps = 26/219 (11%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDG----RPRDQSF 996
            ++ +V   ++P     ++G +GAGK+T++  L         TG + +DG        +  
Sbjct: 1388 VIKDVTFTIEPLEKVGIVGRTGAGKSTIITALFRFLEAD--TGSIKLDGVNIANIDLKRL 1445

Query: 997  PRSIGYCQQQDLHLKTATVRESLR----------FSAYLRQADDVSIEEKDKYVEEV--- 1043
             RSI     QD  L   ++R +L           F+A L++ + VS EE +    E+   
Sbjct: 1446 RRSITII-PQDPTLFAGSIRSNLDPYDEYSDEEIFTA-LKRVNLVSTEEMEASTSEIQSN 1503

Query: 1044 -IEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWS 1102
              + +   L  ++ +   G   +  QR+ + +   L   PK ++ LDE T+ +D  +   
Sbjct: 1504 SSKNVNKFLNLESEIAEGGSNFSQGQRQLMCLARSLLRMPK-VILLDEATASIDYNSDAK 1562

Query: 1103 TCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEG 1141
              + +++       +L   H+  +++  ++D++L +  G
Sbjct: 1563 IQETIRQ-EFNNSTVLTIAHRLRSIV--DYDKILVMDAG 1598

>KLLA0E00462g complement(39173..44125) similar to sp|P32386
            Saccharomyces cerevisiae YLL048c YBT1 yeast bile
            transporter, start by similarity
          Length = 1650

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 104/242 (42%), Gaps = 38/242 (15%)

Query: 915  ELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAE 974
            +L    A F W         KN +   L N+    K G L  ++G +G+GKT+LL  L  
Sbjct: 698  KLGLQNATFTWD--------KNNQDFKLKNLTIDFKIGKLNVIVGPTGSGKTSLLMGLLG 749

Query: 975  RTTMGLITGDVFVDG-RPRDQ------SFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQ 1027
               M L+ G VFV    PR++          SI YC Q    L   TVR ++ F+A   +
Sbjct: 750  E--MELLNGKVFVPSLNPREELVVEADGMTNSIAYCSQAAWLLND-TVRNNILFNAPYNE 806

Query: 1028 ADDVSIEEKDKYVEEVIEVLEMKLYADAI-------VGVPGEGLNVEQRKRLTIGVELAA 1080
                     ++Y   VI    +K   + +       +G  G  L+  Q++R+++   L +
Sbjct: 807  ---------NRY-NAVISACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSLYS 856

Query: 1081 KPKLLVFLDEPTSGLDSQTA-WSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQ 1139
              + L+ LD+  S +DS TA W     +      G+  +   H   AL ++  D ++ ++
Sbjct: 857  SSRHLL-LDDCLSAVDSHTALWIYENCITGPLMEGRTCVLVSHN-VALTLKNADWVIIME 914

Query: 1140 EG 1141
             G
Sbjct: 915  NG 916

>Scas_622.9
          Length = 1657

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 92/205 (44%), Gaps = 26/205 (12%)

Query: 950  KPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDG-RPRDQ------SFPRSIGY 1002
            KPG L  +IG +G+GKT+LL  LA    M L  G++ V    PR            SI Y
Sbjct: 737  KPGALNVVIGPTGSGKTSLL--LALLGEMCLEKGEIIVPALNPRQDLVIDKFGLTNSIAY 794

Query: 1003 CQQQDLHLKTATVRESLRF-SAYLRQADDVSIE----EKDKYVEEVIEVLEMKLYADAIV 1057
            C Q    L   TVR ++ F S Y  +  +  I+     +D  + +  ++ E        +
Sbjct: 795  CSQAA-WLLNETVRNNILFNSPYNEERYNAVIDACGLRRDLKILKASDMTE--------I 845

Query: 1058 GVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTA-WSTCQLMKKLASRGQA 1116
            G  G  L+  Q++R+++   L +  K  V LD+  S +DS TA W     +      G+ 
Sbjct: 846  GEKGITLSGGQKQRVSLARALYSNSK-HVLLDDCLSAVDSHTALWIYDNCITGPLMSGRT 904

Query: 1117 ILCTIHQPSALLMQEFDRLLFLQEG 1141
             +   H   AL ++  + ++ L+ G
Sbjct: 905  CILVSHNI-ALTLKNAELVVILENG 928

 Score = 38.1 bits (87), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 94/219 (42%), Gaps = 26/219 (11%)

Query: 940  RILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAE--RTTMGLITGDVFVDGRPRDQSFP 997
            +++ NV   V+P T   ++G +GAGK+T++  +        G I  D             
Sbjct: 1401 KVIKNVSFVVEPKTKIGIVGRTGAGKSTIITAMFRFLNPESGYIKIDDVNIASINLTKLR 1460

Query: 998  RSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMK------- 1050
            RSI     QD  L T T++  L    Y    DD +I E  K V  V E  E++       
Sbjct: 1461 RSITII-PQDPTLFTGTIK--LNLDPYNEFTDD-AIFEALKRVNLVTEE-ELQNNGTQTG 1515

Query: 1051 --------LYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWS 1102
                    L  +  +   G  L+  QR+ + +   L   PK ++ LDE T+ +D  +   
Sbjct: 1516 TSENANKFLNLENEITEGGSNLSHGQRQLVCLARSLLRNPK-IILLDEATASIDYASDAK 1574

Query: 1103 TCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEG 1141
              + ++K  S+   IL   H+  +++  ++D+++ +  G
Sbjct: 1575 IQETIRKEFSQS-TILTIAHRLRSVI--DYDKIIVMDAG 1610

>YDR135C (YCF1) [981] chr4 complement(722998..727545) Vacuolar
            glutathione S-conjugate transporter, member of the
            ATP-binding cassette (ABC) superfamily [4548 bp, 1515 aa]
          Length = 1515

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 99/210 (47%), Gaps = 23/210 (10%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSI 1000
            +L +++  +KP     ++G +GAGK++L   LA    +    G++ +D    ++     I
Sbjct: 1288 VLKHINIHIKPNEKVGIVGRTGAGKSSL--TLALFRMIEASEGNIVIDNIAINE-----I 1340

Query: 1001 GYCQQQDLHLKTATV-RESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYA------ 1053
            G     DL  K + + ++S  F   +R+  D   +  D+ +   +E+  +K +       
Sbjct: 1341 GL---YDLRHKLSIIPQDSQVFEGTVRENIDPINQYTDEAIWRALELSHLKEHVLSMSND 1397

Query: 1054 --DAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLA 1111
              DA +   G  L+V QR+ L +   +    K+LV LDE T+ +D +T     Q   + A
Sbjct: 1398 GLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILV-LDEATAAVDVETD-KVVQETIRTA 1455

Query: 1112 SRGQAILCTIHQPSALLMQEFDRLLFLQEG 1141
             + + IL   H+ + ++  + DR++ L  G
Sbjct: 1456 FKDRTILTIAHRLNTIM--DSDRIIVLDNG 1483

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 73/165 (44%), Gaps = 28/165 (16%)

Query: 942  LDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPR--- 998
            L N++   K G LT ++G  G+GKT LL C+          GD+F     R + F     
Sbjct: 646  LKNINFQAKKGNLTCIVGKVGSGKTALLSCM---------LGDLF-----RVKGFATVHG 691

Query: 999  SIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADA--- 1055
            S+ Y  Q    +   TV+E++ F            E  +K ++     +++ +  D    
Sbjct: 692  SVAYVSQVP-WIMNGTVKENILF------GHRYDAEFYEKTIKACALTIDLAILMDGDKT 744

Query: 1056 IVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTA 1100
            +VG  G  L+  Q+ RL++   + A+    + LD+P + +D   A
Sbjct: 745  LVGEKGISLSGGQKARLSLARAVYARADTYL-LDDPLAAVDEHVA 788

>CAGL0E03982g 378205..383184 similar to sp|P32386 Saccharomyces
            cerevisiae YLL048c YBT1 yeast bile transporter, start by
            similarity
          Length = 1659

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 102/247 (41%), Gaps = 36/247 (14%)

Query: 912  DDIELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDC 971
            D  +L+   A   W N   D  +K+        +D   K G L  +IG +G+GKT+LL  
Sbjct: 709  DGNKLAFENATIAWSNNNQDFKLKD--------LDINFKIGKLNVVIGPTGSGKTSLL-- 758

Query: 972  LAERTTMGLITGDVFV---DGRPR----DQSFPRSIGYCQQQDLHLKTATVRESLRFSAY 1024
            LA    M L++G + V   D R            SI YC Q    L        L +S Y
Sbjct: 759  LALLGEMQLLSGRIVVPSLDARHEMLIDSDGMTNSIAYCSQSAWLLNDTVRNNILFYSPY 818

Query: 1025 LRQADDVSIEEKDKYVEEVIEV-----LEMKLYADAI-VGVPGEGLNVEQRKRLTIGVEL 1078
                       +D+Y E +I        E+    D   +G  G  L+  Q++R+++   L
Sbjct: 819  ----------NEDRYKEVIIACGLKRDFELFDAGDQTEIGEKGITLSGGQKQRISLARAL 868

Query: 1079 AAKPKLLVFLDEPTSGLDSQT-AWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLF 1137
             +  + L+ LD+  S +DS T AW     +      G+  +   H   AL ++  + ++ 
Sbjct: 869  YSNCRHLL-LDDCLSAVDSHTAAWIYDNCITGPLMEGRTCVLVSHNI-ALTLKNAELVVM 926

Query: 1138 LQEGGQT 1144
            L+ G  T
Sbjct: 927  LENGRIT 933

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 98/219 (44%), Gaps = 24/219 (10%)

Query: 940  RILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRD----QS 995
            R++  V   ++P  +  ++G +GAGK+T++  L     +   TG + +DG        Q+
Sbjct: 1401 RVIKEVSFDIEPHNMVGIVGRTGAGKSTIITALFR--FLEPETGSIKIDGIDITSIDLQT 1458

Query: 996  FPRSIGYCQQQDLHLKTATVRESLR-FSAY-----LRQADDVSIEEKDKYVEEVIEVLEM 1049
              RSI     QD  L T T+R +L  F  Y      R    V++ + D+   +  +   +
Sbjct: 1459 LRRSITII-PQDPTLFTGTIRSNLDPFGKYPDEEIFRVLHRVNLIDDDEMTAQSSDNNSL 1517

Query: 1050 K-------LYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWS 1102
                    L  +  +   G  L+  Q++ + +   L   PK ++ LDE T+ +D  +   
Sbjct: 1518 SSDNVNKFLNLENEITEGGNNLSQGQKQLMCLARALLRNPK-VILLDEATASIDYASDAK 1576

Query: 1103 TCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEG 1141
              Q ++ +  +   +L   H+  +++  ++D++L +  G
Sbjct: 1577 IQQTIRNVFDKS-TVLTIAHRLRSVI--DYDKILVMDAG 1612

>Sklu_2316.1 YKL209C, Contig c2316 84-4016 reverse complement
          Length = 1310

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 88/205 (42%), Gaps = 30/205 (14%)

Query: 949  VKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDG---RPRDQSFPRSIGYCQQ 1005
            V  G   A++G SG+GK+TL   L       +  G + +DG      D +  R+I    +
Sbjct: 1099 VFSGETIAVVGESGSGKSTL--TLLISALYEVPNGSIEIDGIDINRWDTNKLRTIISVVE 1156

Query: 1006 QDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLN 1065
            Q       TV E+L +    R               +V E L +    D +  +P EGL+
Sbjct: 1157 QKPQFFDGTVGENLLYGISGRVTQI-----------QVKEALCLAGVQDFVFSLP-EGLD 1204

Query: 1066 VE---------QRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQA 1116
                       Q +RL+I   +  KPK+L FLDE TS LD+    +   L+KK       
Sbjct: 1205 TRIDTSLISGGQAQRLSIARAMLRKPKIL-FLDECTSALDTSNTHAIANLIKKHFCGITT 1263

Query: 1117 ILCTIHQPSALLMQEFDRLLFLQEG 1141
            I+ T ++    +M+  +R+  LQ G
Sbjct: 1264 IVITHNEQ---MMRACERIAVLQNG 1285

>AGL346W [3966] [Homologous to ScYGR281W (YOR1) - SH]
            complement(61232..65434) [4203 bp, 1400 aa]
          Length = 1400

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 94/199 (47%), Gaps = 29/199 (14%)

Query: 949  VKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDL 1008
            +K G    +IGA G GKT+LL+ +A    M   TG V V+G         S+ +C     
Sbjct: 558  IKKGEFIIVIGAIGTGKTSLLNAVA--GYMKKTTGSVHVNG---------SLLFCGVP-- 604

Query: 1009 HLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYA---DAIVGVPGEGLN 1065
             ++ AT+R+++ F +   Q         D+ V       + K++       VG  G  L+
Sbjct: 605  WIQNATIRDNIIFGSSFDQT------RYDEVVNACALEADFKIFPAGDKTEVGERGITLS 658

Query: 1066 VEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQ--LMKKLASRGQAILCTIHQ 1123
              Q+ R+++   +     + +F D+  S +D+  A    Q  L+ +L +R + IL T HQ
Sbjct: 659  GGQKARISLARAIYKDRDIYLF-DDIISAVDANVAAHITQKCLLDRLQNRTR-ILAT-HQ 715

Query: 1124 PSALLMQEFDRLLFLQEGG 1142
             +  L+QE  R++FL + G
Sbjct: 716  LA--LVQEASRVIFLGQDG 732

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 85/198 (42%), Gaps = 13/198 (6%)

Query: 949  VKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDG---RPRDQSFPRSIGYCQQ 1005
            V+ G    + G +GAGKT++   L   +   L +G + +DG           RS      
Sbjct: 1169 VRAGEKIGICGRTGAGKTSVTTALYRLSE--LESGSIKIDGVDIATLGLHDLRSALSIIP 1226

Query: 1006 QDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLN 1065
            QD  L   TVR++L   A        S   +   V   +     K + D  V   G   +
Sbjct: 1227 QDPLLFRGTVRKNLDPFAEHTDGTLWSALVRSGVVPAGVVPTSHKFHLDQEVDEGGANFS 1286

Query: 1066 VEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLAS--RGQAILCTIHQ 1123
            + +R+ L +   L    ++L+ LDE TS +D  T     ++  ++A+  R   +LC  H+
Sbjct: 1287 LGERQLLALARALVRSTRILI-LDEATSSVDYAT---DARVQARIAAEFRQATVLCVAHR 1342

Query: 1124 PSALLMQEFDRLLFLQEG 1141
               ++   +DR+L L +G
Sbjct: 1343 LRTII--SYDRILVLDQG 1358

>Kwal_34.15770
          Length = 1436

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 107/244 (43%), Gaps = 31/244 (12%)

Query: 912  DDIELSKSQ-----AIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKT 966
            D I +S+ +     A F W     D  +KN             + G L  +IG +G+GKT
Sbjct: 466  DQITVSRKRIGFENATFSWDRKNPDFKLKNMSIEF--------RLGKLNVVIGPTGSGKT 517

Query: 967  TLLDCLAERTTMGLITGDVF---VDGRP----RDQSFPRSIGYCQQQDLHLKTATVRESL 1019
            +LL  L     M L+ G V+   +D R      +     SI YC Q    L   TV+ ++
Sbjct: 518  SLLMGLLGE--MDLLEGKVYAPCLDPREDLIVENDGMTNSIAYCSQGAWLLND-TVKNNI 574

Query: 1020 RFSAYLRQAD-DVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVEL 1078
             FS+   +A  D  +E     ++   E+L      +  +G  G  L+  Q++R+++   L
Sbjct: 575  LFSSPFNEARYDAVVEACG--LKRDFEILSAGDQTE--IGEKGITLSGGQKQRVSLARAL 630

Query: 1079 AAKPKLLVFLDEPTSGLDSQTA-WSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLF 1137
             +  + L+ LD+  S +DS TA W     +      G+  +   H   AL ++  D ++F
Sbjct: 631  YSSSRHLL-LDDCLSAVDSHTALWIYENCITGPLMEGRTCILVSHN-VALTLKNADWVVF 688

Query: 1138 LQEG 1141
            ++ G
Sbjct: 689  MENG 692

>YLL048C (YBT1) [3375] chr12 complement(41279..46264) Protein with
            similarity to mammalian ATP-dependent bile acid
            transporter, member of the ATP-binding cassette (ABC)
            superfamily [4986 bp, 1661 aa]
          Length = 1661

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 77/158 (48%), Gaps = 14/158 (8%)

Query: 950  KPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDG-RPRDQSF------PRSIGY 1002
            K G L  +IG +G+GKT+LL  +A    M L+ G V V    PR +          SI Y
Sbjct: 720  KTGKLNVVIGPTGSGKTSLL--MALLGEMYLLNGKVVVPALEPRQELIVDANGTTNSIAY 777

Query: 1003 CQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGE 1062
            C Q    L   TV+ ++ F++   +A   ++ E    ++   E+L+     +  +G  G 
Sbjct: 778  CSQAAWLLND-TVKNNILFNSPFNEARYKAVVEACG-LKRDFEILKAGDLTE--IGEKGI 833

Query: 1063 GLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTA 1100
             L+  Q++R+++   L +  +  V LD+  S +DS TA
Sbjct: 834  TLSGGQKQRVSLARALYSNAR-HVLLDDCLSAVDSHTA 870

>Scas_455.1
          Length = 925

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 80/164 (48%), Gaps = 16/164 (9%)

Query: 944  NVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDG-RPR------DQSF 996
            N+D   K G L  +IG +G+GKT+LL  +A    M ++ G++ V    PR      +   
Sbjct: 734  NID--FKIGKLNVVIGPTGSGKTSLL--MALLGEMKIMEGEIIVPSLDPREDLVVDENGT 789

Query: 997  PRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAI 1056
              SI YC Q    L   TVR ++ F++   +A   S+ E      +  E+L+     +  
Sbjct: 790  TNSIAYCSQAAWLLND-TVRNNILFNSPYNEARYTSVIEACGLKRD-FEILKAGDMTE-- 845

Query: 1057 VGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTA 1100
            +G  G  L+  Q++R+++   + +  +  + LD+  S +DS TA
Sbjct: 846  IGEKGITLSGGQKQRVSLARAMYSNSR-HILLDDCLSAVDSHTA 888

>Kwal_33.15561
          Length = 1297

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 96/210 (45%), Gaps = 24/210 (11%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQ----SF 996
            +  N+   V  G +  LIG SG+GK+TL   L     +    G + +DG   +Q    + 
Sbjct: 1076 VYKNLSLKVDRGEIVGLIGTSGSGKSTLWSLLTRLYPVE--NGSISIDGTDINQWDRKAL 1133

Query: 997  PRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAI 1056
               I   +Q+ L   + ++ E+L +   +R+  D   EE    V E++  L M  + ++ 
Sbjct: 1134 RSCIAVVEQKPLFF-SGSIIENLTY-GLMRKVSD---EE----VNELLLTLGMLEFVNST 1184

Query: 1057 VG-----VPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLA 1111
                   +  + L+  Q +RL I   L  KP+LLV LDE TS LD++ ++   + +K   
Sbjct: 1185 PKRLHSVIDTQLLSGGQVQRLAIVRALLRKPQLLV-LDECTSALDARHSFIMSEFVKHHL 1243

Query: 1112 SRGQAILCTIHQPSALLMQEFDRLLFLQEG 1141
                 ++ T    S  +M+   R+L   +G
Sbjct: 1244 YHTTTLVVT---HSEQMMRSCHRILTFNKG 1270

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 108/236 (45%), Gaps = 18/236 (7%)

Query: 920  QAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAE--RTT 977
            QA   ++N+ +  P ++ K  ++ N++  V  G  T ++G SG+GK+T+ + L +  R  
Sbjct: 357  QAQISFENVSFAYPSRS-KHPVIKNLNLKVPGGRFTFIVGKSGSGKSTISNLLLKLYRPC 415

Query: 978  MGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEE-- 1035
             GLI  +         Q   RSI   +Q    L   +++ +++ ++     DD  + +  
Sbjct: 416  SGLIKVNDVDIREINQQDLFRSITLVEQNS-PLFEDSIKNNIQLTSD-EHRDDGRLSQAC 473

Query: 1036 KDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGL 1095
            +   +E VI  L   L  D I+G  G  L+  +++R+ +         +L+ LDE    L
Sbjct: 474  QAAMLEGVIRDLAKGL--DTIIGSSGVDLSGGEQQRVALARAFVRDSPILI-LDE---AL 527

Query: 1096 DSQTAWSTCQLMKKLA--SRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGE 1149
             +Q       LM+ +    +G+  +   H+ + +L  +F   + L E G  +  G+
Sbjct: 528  SAQDRMHKDLLMEAIRFWRKGRTTIILTHELNDILEDDF---VLLMEDGNVIERGQ 580

>KLLA0B14256g 1248654..1252469 similar to sp|P12866 Saccharomyces
            cerevisiae YKL209c STE6 ATP-binding cassette transporter
            protein, hypothetical start
          Length = 1271

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 91/193 (47%), Gaps = 18/193 (9%)

Query: 955  TALIGASGAGKTTLLDCLAERTTMGLITGDVFVDG----RPRDQSFPRSIGYCQQQDLHL 1010
              ++G SG+GK+TL           + +G V++ G    +  + +  R+I   +Q+    
Sbjct: 1064 VGIVGESGSGKSTLSL--LLTRLYPVPSGKVYIGGIDINKWDEYALRRTISIVEQKPKFF 1121

Query: 1011 KTATVRESLRFSAYLRQADDVSIEEKDKYVE--EVIEVLEMKLYADAIVGVPGEGLNVEQ 1068
               TVRE+L +    R   +  +    K V+    ++ L   L      G+   G    Q
Sbjct: 1122 D-GTVRENLVY-GLKRNVSNSELRSVLKSVDLLSFVQTLPNDLNTRVHDGLMSGG----Q 1175

Query: 1069 RKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALL 1128
             +RL+I   L  +PK+++ LDE TS LD+  +++  +L++ +      I+ T    S  L
Sbjct: 1176 AQRLSIARTLLRQPKIII-LDECTSALDAANSFAIAELIRTVLKNVTVIVIT---HSEQL 1231

Query: 1129 MQEFDRLLFLQEG 1141
            MQ  DR+L L++G
Sbjct: 1232 MQICDRVLVLKKG 1244

 Score = 34.7 bits (78), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 54/119 (45%), Gaps = 17/119 (14%)

Query: 288  RNRIKGVDRDTFAKHMTEVAMATYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGS 347
            R+ +K VD  +F +           L +  +T+V +  +   SGG+ +R+SIA   +   
Sbjct: 1143 RSVLKSVDLLSFVQT----------LPNDLNTRVHDGLM---SGGQAQRLSIARTLLRQP 1189

Query: 348  KFQCWDNATRGLDSATALEFIKALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDG 406
            K    D  T  LD+A +    + ++   T+ K+   + I   S+    + D+V VL  G
Sbjct: 1190 KIIILDECTSALDAANSFAIAELIR---TVLKNVTVIVITH-SEQLMQICDRVLVLKKG 1244

>YKL209C (STE6) [3066] chr11 complement(42424..46296) Membrane
            transporter responsible for export of a factor mating
            pheromone, member of ATP-binding cassette (ABC)
            superfamily of membrane transporters [3873 bp, 1290 aa]
          Length = 1290

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 94/206 (45%), Gaps = 38/206 (18%)

Query: 952  GTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQ----SFPRSIGYCQQQD 1007
            G    +IG SG GK+TL+  L +     +  G + +DG   +     S  + I   +Q+ 
Sbjct: 1080 GQTLGIIGESGTGKSTLVLLLTKLYNCEV--GKIKIDGTDVNDWNLTSLRKEISVVEQKP 1137

Query: 1008 LHLKTATVRESLRFSAYLRQADDVSIEEKD--KYVEEVIEVLEMKLYADAIVGVPGEGLN 1065
            L L   T+R++L    Y  Q + + IE  D  KYV             D ++  P +GL+
Sbjct: 1138 L-LFNGTIRDNL---TYGLQDEILEIEMYDALKYVG----------IHDFVISSP-QGLD 1182

Query: 1066 VE---------QRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRG-Q 1115
                       Q +RL I   L  K K+L+ LDE TS LDS ++     ++ ++  +G  
Sbjct: 1183 TRIDTTLLSGGQAQRLCIARALLRKSKILI-LDECTSALDSVSS----SIINEIVKKGPP 1237

Query: 1116 AILCTIHQPSALLMQEFDRLLFLQEG 1141
            A+L  +   S  +M+  + +  L++G
Sbjct: 1238 ALLTMVITHSEQMMRSCNSIAVLKDG 1263

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 97/222 (43%), Gaps = 24/222 (10%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDG---RPRDQSFP 997
            +L NV      G  T ++G SG+GK+TL + L  R   G   G + ++G   +  DQ   
Sbjct: 374  VLKNVSLNFSAGQFTFIVGKSGSGKSTLSNLLL-RFYDGY-NGSISINGHNIQTIDQKLL 431

Query: 998  RSIGYCQQQDLHLKTATVRESLRFSAY--LRQADDVSIEEKDKYVEEVIE-------VLE 1048
                   +Q   L   T+R+++   +   +R A D S  E    +++  +       +L+
Sbjct: 432  IENITVVEQRCTLFNDTLRKNILLGSTDSVRNA-DCSTNENRHLIKDACQMALLDRFILD 490

Query: 1049 MKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMK 1108
            +    + ++G  G  L+  Q++R+ I         +L FLDE  S LD         LMK
Sbjct: 491  LPDGLETLIGTGGVTLSGGQQQRVAIARAFIRDTPIL-FLDEAVSALD---IVHRNLLMK 546

Query: 1109 KLA--SRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFG 1148
             +    +G+  +   H+ S +   E D  L+L + G+ V  G
Sbjct: 547  AIRHWRKGKTTIILTHELSQI---ESDDYLYLMKEGEVVESG 585

>YLL015W (BPT1) [3404] chr12 (116431..121110) Membrane transporter of
            the ATP-binding cassette (ABC) superfamily, mediates
            transport of glutathione conjugates into the vacuole
            [4680 bp, 1559 aa]
          Length = 1559

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 101/220 (45%), Gaps = 33/220 (15%)

Query: 942  LDNVDGW-VKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPR-- 998
            L N+D +  K G L  ++G  GAGK+T L           I G +      RD   P+  
Sbjct: 654  LKNIDHFEAKRGDLVCVVGRVGAGKSTFLKA---------ILGQLPCMSGSRDSIPPKLI 704

Query: 999  ----SIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYAD 1054
                S+ YC Q+   +  A+VRE++ F     Q      +  D  ++    + ++K+  D
Sbjct: 705  IRSSSVAYCSQES-WIMNASVRENILFGHKFDQ------DYYDLTIKACQLLPDLKILPD 757

Query: 1055 A---IVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQ--LMKK 1109
                +VG  G  L+  Q+ RL++   + ++  + + LD+  S +D++ + +  +  L+ K
Sbjct: 758  GDETLVGEKGISLSGGQKARLSLARAVYSRADIYL-LDDILSAVDAEVSKNIIEYVLIGK 816

Query: 1110 LA-SRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFG 1148
             A  + + I+ T +  S L   +  ++++  E G+ V  G
Sbjct: 817  TALLKNKTIILTTNTVSIL---KHSQMIYALENGEIVEQG 853

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 98/228 (42%), Gaps = 41/228 (17%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCL---------AERTTMGLITGDVFVDGR- 990
            +L+N++  ++P     ++G +GAGK+TL   L                 I+     D R 
Sbjct: 1318 VLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIDISDIGLFDLRS 1377

Query: 991  -----PRD-QSFPRSIG-----YCQQQDLHLKTATVRESLR--FSAYLR---QADDVSIE 1034
                 P+D Q+F  ++      + +  +  LK A  +  L+      L    + DD +  
Sbjct: 1378 HLAIIPQDAQAFEGTVKTNLDPFNRYSEDELKRAVEQAHLKPHLEKMLHSKPRGDDSN-- 1435

Query: 1035 EKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSG 1094
            E+D  V +++         D  +   G  L+V QR+ L +   L  + K+LV LDE T+ 
Sbjct: 1436 EEDGNVNDIL---------DVKINENGSNLSVGQRQLLCLARALLNRSKILV-LDEATAS 1485

Query: 1095 LDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGG 1142
            +D +T     Q   +   + + IL   H+   +L  + D+++ L +G 
Sbjct: 1486 VDMETD-KIIQDTIRREFKDRTILTIAHRIDTVL--DSDKIIVLDQGS 1530

>YGR281W (YOR1) [2226] chr7 (1052829..1057262) Oligomycin-resistance
            factor, member of the ATP-binding cassette (ABC)
            superfamily [4434 bp, 1477 aa]
          Length = 1477

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 98/230 (42%), Gaps = 27/230 (11%)

Query: 931  DIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGR 990
            D   + G   +L N++  +K G    + G +GAGK+T++  L       L  G + +D  
Sbjct: 1219 DFAYRPGLPIVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNE--LTAGKILIDNV 1276

Query: 991  PRDQ----SFPRSIGYCQQQDLHLKTATVRESLR----------FSAYLRQA----DDVS 1032
               Q       R +     QD  L   T+R++L           + A +R      DD+ 
Sbjct: 1277 DISQLGLFDLRRKLAII-PQDPVLFRGTIRKNLDPFNERTDDELWDALVRGGAIAKDDLP 1335

Query: 1033 IEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPT 1092
              +  K  E        K + D  V   G   ++ +R+ L +   L  + K+L+ LDE T
Sbjct: 1336 EVKLQKPDENGTHGKMHKFHLDQAVEEEGSNFSLGERQLLALTRALVRQSKILI-LDEAT 1394

Query: 1093 SGLDSQTAWST-CQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEG 1141
            S +D +T      +++++       ILC  H+   ++   +DR+L L++G
Sbjct: 1395 SSVDYETDGKIQTRIVEEFGD--CTILCIAHRLKTIV--NYDRILVLEKG 1440

>AFR432W [3624] [Homologous to ScYKL209C (STE6) - SH]
            complement(1213217..1217071) [3855 bp, 1284 aa]
          Length = 1284

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 93/218 (42%), Gaps = 36/218 (16%)

Query: 940  RILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLI---TGDVFVDGRPR---D 993
            +I  N +  +  GT  A++G SG+GK+TL   +      GL       +F+DG      +
Sbjct: 1062 QIYKNFNLRINQGTKVAIVGESGSGKSTLFYLIC-----GLYPVKPASLFIDGTDICNWE 1116

Query: 994  QSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYA 1053
             S  R I    +Q       T+RE+L +       D+           E+ EVL      
Sbjct: 1117 MSALRKIIAVVEQKPRFFNGTIRENLVYGLEGTITDN-----------EIYEVLAEVRII 1165

Query: 1054 DAIVGVPGEGLNVE---------QRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTC 1104
            + +  +P EGL            Q +RL+I   L  +P LL+ LDE TS LD+  A +  
Sbjct: 1166 NFVRSLP-EGLETRVDTNLVSGGQLQRLSIVRALLRRPTLLI-LDECTSALDAANANAIA 1223

Query: 1105 QLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGG 1142
             +++        I+ T    S  +M+  DR++ L+ G 
Sbjct: 1224 NVVRNSLHDITVIVIT---HSKQMMKMCDRIVVLKNGA 1258

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 98/222 (44%), Gaps = 30/222 (13%)

Query: 940  RILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTT--MGLITGDVFVDGRPRDQSFP 997
            + LD V    +P  +T ++G SG+GK+TL + L +  +   G+IT +   + R  D+S+ 
Sbjct: 375  KALDGVSLTFRPNQITFIVGKSGSGKSTLGNLLLKFYSDYEGIITVNS-TNLRGIDRSWL 433

Query: 998  RSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIV 1057
                   +Q   L   T+ E++  SA          +  +K    V    +M L    + 
Sbjct: 434  LQNITLVEQSCTLFNGTLFENITLSA----------KPVNKTAGAVKRACQMALLEKLVF 483

Query: 1058 GVPGEGLNVE-----------QRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQL 1106
             +P EGL+ +           Q++R+ +   +     +L+ LDE  S LD        ++
Sbjct: 484  DLP-EGLHTKVGSGGISMSGGQQQRVALARAILRDAPVLI-LDEAISALDIIHRDLLMEV 541

Query: 1107 MKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFG 1148
            ++   +    I+ T H+ S +L  ++   L++ E GQ +  G
Sbjct: 542  IRSWRADKTTIILT-HELSHVLDDDY---LYMMEHGQVIEQG 579

>CAGL0K00363g complement(37452..41135) similar to sp|P12866
            Saccharomyces cerevisiae YKL209c STE6, hypothetical start
          Length = 1227

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 95/217 (43%), Gaps = 34/217 (15%)

Query: 939  RRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLA-----ERTTMGLITGDVFVDGRPRD 993
            ++ L N++  +    +  ++G SG+GK+TL++ +         ++ + + D+    +   
Sbjct: 1007 KKTLTNINMQLYSNQIYGIVGKSGSGKSTLINLICGLYSLSEGSINICSCDI---NKWST 1063

Query: 994  QSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYA 1053
            +   +++   QQ  + L+  T+R +L +       D           E ++ VLE     
Sbjct: 1064 KELHKTVALLQQNPV-LQFDTIRNNLLYGLTETVGD-----------EHLLNVLEYVGLK 1111

Query: 1054 DAIVGVPGEGLNVE---------QRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTC 1104
              I+ +   GL+ +         Q +RL +  E+   PK+L+ LDE TS LD  +A    
Sbjct: 1112 SFIISL-NNGLDSKLDDSLLSGGQSQRLCMAREMLRNPKVLI-LDECTSALDVTSAKKIN 1169

Query: 1105 QLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEG 1141
             +   + SR  A +  I       ++  D++ FL +G
Sbjct: 1170 DI---IGSRSLAPVTIIVSHQKETIKLCDKIFFLVDG 1203

 Score = 37.7 bits (86), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 80/179 (44%), Gaps = 10/179 (5%)

Query: 922  IFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLA---ERTTM 978
            +F+  + CY    +    ++ D ++  +KP  +T +IG SG+GK+TL D +    +    
Sbjct: 353  VFNNVSFCYP---ERKTDKVFDKMNFIIKPNKMTYVIGPSGSGKSTLFDLILLHYDNYHG 409

Query: 979  GLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRES-LRFSAYLRQADDVSIEEKD 1037
             ++ GD  +D R  +++          Q   L   T+R + L  S +      + +E   
Sbjct: 410  SIMLGD--LDIRSINRNIILENITLVSQTPTLFNDTIRNNILACSNWTNLPSKLEMECIC 467

Query: 1038 KYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLD 1096
            K+      + E+    D  +G  G  L+  Q +++ +    A    +L+ LDEP S +D
Sbjct: 468  KFALLENLIAELPDGLDTRIGSGGIKLSGGQAQKVALARAFARNTSILL-LDEPLSAVD 525

>AFR683C [3876] [Homologous to ScYLR188W (MDL1) - SH]
            (1697345..1699378) [2034 bp, 677 aa]
          Length = 677

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 54/248 (21%), Positives = 102/248 (41%), Gaps = 26/248 (10%)

Query: 912  DDIELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDC 971
            D + L+     F+  N  Y  P +    ++   +D  + PG    ++G SG GK+T+   
Sbjct: 419  DPVSLTGKTIAFNSVNFAY--PTRP-HHQVFAGMDLSICPGEHVCIVGPSGGGKSTVASL 475

Query: 972  LAERTTMGLITGDVFVDGRP----RDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQ 1027
            L        I+G + + G          + R +G  QQ+ + L  A++ E++ ++  L  
Sbjct: 476  LLR--FYDPISGSITIGGEDIRLFNLSKYRRMMGIVQQEPV-LFNASILENITYALPLHL 532

Query: 1028 ADD-------VSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAA 1080
              D       + +     +V    E L+        VG  G  L+  Q++R+ +      
Sbjct: 533  TKDPARIDRALRLSNCSAFVGSFPEGLQTA------VGPRGTQLSGGQKQRVALARAFLQ 586

Query: 1081 KPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQE 1140
             P +L+ LDE TS LDS++       + +     +  +   H+ S +  Q   R++ L +
Sbjct: 587  DPAILI-LDEATSALDSKSEDIVASTLLQRCQEAKITISIAHRKSTI--QHSTRVIVLDK 643

Query: 1141 GGQTVYFG 1148
             G  +  G
Sbjct: 644  LGHVLETG 651

>Scas_695.24
          Length = 1288

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 105/234 (44%), Gaps = 24/234 (10%)

Query: 917  SKSQAIFHWKNLCYDIPIKNGKRRILD-NVDGWVKPGTLTALIGASGAGKTTLLDCLAER 975
            SKS  +   +NL +  P +       D N++      T+  L+G SG+GK+TL+  L + 
Sbjct: 1043 SKSNPLIKIQNLTFAYPSETNVNVYEDLNLEMHASEKTI-GLVGESGSGKSTLMYLLTKL 1101

Query: 976  TTMGLITGDVFVDGRPRD----QSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDV 1031
              +      +++DG   +     +    I   +Q+   L   TVRE+L   +Y    D +
Sbjct: 1102 YQVA--PHSIYLDGTDVNDWGLMNLRTQISVVEQKP-TLFDGTVRENL---SYGISTDIL 1155

Query: 1032 SIEEKD--KYVE--EVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVF 1087
             +E  D  KYV   E +E L   L       +   G    Q +R+ I   L  KPK+L+ 
Sbjct: 1156 DMELFDMLKYVGIYEFVESLPFGLDTRIDTKLLSGG----QAQRICIARALLRKPKILI- 1210

Query: 1088 LDEPTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEG 1141
            LDE TS LD+ +A     ++K   +   A+L  +   S  +M+  + +  L+ G
Sbjct: 1211 LDECTSALDALSANIIIDIVK---NGPPALLTIVITHSEKMMRACNTIAVLKNG 1261

>Kwal_56.22747
          Length = 1538

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 106/246 (43%), Gaps = 44/246 (17%)

Query: 919  SQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTM 978
            SQ +  +KN  Y    +     +L ++D  +KP     ++G +GAGK+TL   LA    +
Sbjct: 1285 SQGLIRFKN--YSTRYRANLDPVLRHLDLEIKPQEKIGIVGRTGAGKSTL--SLALFRIL 1340

Query: 979  GLITGDVFVDGR-----------------PRD-QSFPRSIG-----YCQQQDLHLKTATV 1015
                G + +DG                  P+D Q+F  ++      + Q  D  +  A  
Sbjct: 1341 EPSEGTIDIDGVDISKIGLKDLRSNLSIIPQDAQAFEGTVRTNLDPFEQYSDEEIWKALE 1400

Query: 1016 RESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIG 1075
               L+        DD   E+K+       ++L+ K+  +      G  L+V QR+ L + 
Sbjct: 1401 LSHLKPHILKMAKDDADPEKKE-------DLLQTKISEN------GSNLSVGQRQLLCLS 1447

Query: 1076 VELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRL 1135
              L  + ++LV LDE T+ +DS+T     Q   +   + + IL   H+   ++  + D++
Sbjct: 1448 RALLNRSRILV-LDEATAAVDSETD-RLIQETIRAEFKDRTILTIAHRIDTVM--DSDKI 1503

Query: 1136 LFLQEG 1141
            + L +G
Sbjct: 1504 MVLDKG 1509

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 74/162 (45%), Gaps = 15/162 (9%)

Query: 942  LDNVDGW-VKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSI 1000
            L N+DG+ V  G L  ++G  GAGK+T L  L  +        +      P       S+
Sbjct: 643  LKNIDGFQVFKGQLVCVVGRVGAGKSTFLQALLGQLP---CISNSPSHASPTVHFRANSV 699

Query: 1001 GYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADA---IV 1057
              C QQ   +  A+V++++ F     +A   +  E  + V       ++++ AD    +V
Sbjct: 700  ALCSQQS-WIMNASVKDNVLFGHRFDEATYKATLEACQLVP------DLEILADGDETLV 752

Query: 1058 GVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQT 1099
            G  G  L+  Q+ RL++   + ++  + + LD+  S +D++ 
Sbjct: 753  GEKGISLSGGQKARLSLARAVYSRSDVYL-LDDILSAVDAEV 793

>YHL035C (YHL035C) [2251] chr8 complement(27976..32754) Member of the
            ATP-binding cassette (ABC) superfamily [4779 bp, 1592 aa]
          Length = 1592

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 102/225 (45%), Gaps = 39/225 (17%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQ----SF 996
            ++ NV   V P +   ++G +GAGK+T++  L     +  ITG + +DG+   +    + 
Sbjct: 1339 VIRNVSFKVDPQSKIGIVGRTGAGKSTIITALFR--LLEPITGCIKIDGQDISKIDLVTL 1396

Query: 997  PRSIGYCQQQDLHLKTATVRESL---------RFSAYLRQADDVSIEEKDKYVEEVIEVL 1047
             RSI     QD  L   T++ ++         +    L Q + +S  E     EEV+   
Sbjct: 1397 RRSITII-PQDPILFAGTIKSNVDPYDEYDEKKIFKALSQVNLISSHE----FEEVLNSE 1451

Query: 1048 E---------MKLYADAIVGVPGEGLNVEQ--RKRLTIGVELAAKPKLLVFLDEPTSGLD 1096
            E         + L+ +   G    GLN+ Q  R+ L I   L  +PK ++ LDE TS +D
Sbjct: 1452 ERFNSTHNKFLNLHTEIAEG----GLNLSQGERQLLFIARSLLREPK-IILLDEATSSID 1506

Query: 1097 SQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEG 1141
              +      +++   ++   IL   H+  +++  ++DR++ +  G
Sbjct: 1507 YDSDHLIQGIIRSEFNKS-TILTIAHRLRSVI--DYDRIIVMDAG 1548

>KLLA0D04059g complement(338422..343128) similar to sp|P14772
            Saccharomyces cerevisiae YLL015w BPT1, start by
            similarity
          Length = 1568

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 100/239 (41%), Gaps = 33/239 (13%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQ----SF 996
            +L ++D  +K      ++G +GAGK+TL   LA    +    G + +DG           
Sbjct: 1331 VLKDIDLRIKHQEKIGVVGRTGAGKSTL--TLALFRILEPFEGKITIDGIDISTLGLYDL 1388

Query: 997  PRSIGYCQQQDLHLKTATVRESLRFSAYLRQAD-----DVSIEEKDKYVEEVIEVL---E 1048
             RS+     QD      TVR +L    + R  D      + +     ++E ++  L   E
Sbjct: 1389 RRSLSII-PQDAQAFEGTVRSNL--DPFNRHTDAEIWKALELSHLKPHIERIVSELPDDE 1445

Query: 1049 MKL--YADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQL 1106
             K     D  +   G  L++ QR+ L +   L    K+L+ LDE T+ +D +T     Q 
Sbjct: 1446 NKPTDLLDTQISDNGNNLSMGQRQLLCLSRALLNPSKILI-LDEATAAVDRETD-KIIQE 1503

Query: 1107 MKKLASRGQAILCTIHQPSALL------------MQEFDRLLFLQEGGQTVYFGELGKG 1153
              + A + + IL   H+   +L            ++EFD    L +  +++++G   KG
Sbjct: 1504 TIRTAFKDRTILTIAHRIDTVLDSDKIMVLDKGEVKEFDTPDNLLKNKESLFYGLCEKG 1562

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 95/200 (47%), Gaps = 15/200 (7%)

Query: 950  KPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLH 1009
            K   LT ++G  G+GK+T L  +  +  +  ++ D     +P+      ++ YC QQ   
Sbjct: 651  KKAQLTCIVGRVGSGKSTFLQAILGQ--LPCVSSDSASGVKPKVVIRADNLAYCPQQP-W 707

Query: 1010 LKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYAD-AIVGVPGEGLNVEQ 1068
            +  A++++++ F     +A    + +K     +++  LE+    D  +VG  G  L+  Q
Sbjct: 708  IMNASLKDNILFGYKYDEA----MYKKTIKACQLLPDLEILPDGDQTLVGEKGISLSGGQ 763

Query: 1069 RKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLM---KKLASRGQAILCTIHQPS 1125
            + RL++   + ++  L + LD+  S +DS    S    +   +K   + + ++ T +  +
Sbjct: 764  KARLSLARAVYSRADLYL-LDDVLSAVDSHVCKSIIDDVLDRQKGLLKNKTVILTTNAVN 822

Query: 1126 ALLMQEFDRLLFLQEGGQTV 1145
             L+  +   +++L + G+ V
Sbjct: 823  VLVHSD---MIYLLKNGKIV 839

>Scas_552.4
          Length = 720

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 95/222 (42%), Gaps = 26/222 (11%)

Query: 937  GKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAE--RTTMGLITGDVFVDGRPRDQ 994
            G  R++ NV   V P     ++G +GAGK+T++  L        G I  D          
Sbjct: 463  GLPRVIKNVTFTVAPKAKIGIVGRTGAGKSTIITALFRFLDPETGYIKIDNIDITSINLN 522

Query: 995  SFPRSIGYCQQQDLHLKTATVRESL----------RFSAYLR---QADDVS--IEEKDKY 1039
               RSI     QD  L T T++ +L           F+A  R     +DVS  IE +   
Sbjct: 523  KLRRSINII-PQDPTLFTGTIKSNLDPYGEYSDEDMFTALRRVNLVPEDVSSNIETESIS 581

Query: 1040 VEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQT 1099
             + V + L +    +  +   G  L+  QR+ + +   L   PK+++ LDE T+ +D  +
Sbjct: 582  SQNVNKFLNL----NNEISEGGSNLSQGQRQLVCLARSLLRSPKIML-LDEATASIDYNS 636

Query: 1100 AWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEG 1141
                 + ++K       IL   H+  +++  ++D++L +  G
Sbjct: 637  DAKIQETIRK-EFNSSTILTIAHRLRSVI--DYDKILVMDAG 675

>CAGL0E03355g complement(307242..311849) similar to sp|P14772
            Saccharomyces cerevisiae YLL015w BPT1, hypothetical start
          Length = 1535

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 102/234 (43%), Gaps = 41/234 (17%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSI 1000
            +L +++  + PG    ++G +GAGK+TL   +A    +    G + +D          SI
Sbjct: 1292 VLKHINLVISPGEKIGVVGRTGAGKSTL--SMALFRLLEPTAGTISIDNID-----ITSI 1344

Query: 1001 GYCQQQDLHLKTATV-RESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAI--- 1056
            G    +DL    A + +++  F   +R   D   +  D  +   IE+  +K + + I   
Sbjct: 1345 GL---RDLRSHIAIIPQDAQAFEGTIRSNLDPFEKFSDDDLWHAIELSHLKFHLETIAKE 1401

Query: 1057 ----------------VGVP----GEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLD 1096
                            + +P    G  L+V Q++ L +   L  K K+LV LDE T+ +D
Sbjct: 1402 INDDSEYSDRSRLESPLDIPVREAGSNLSVGQKQLLCLARALLNKSKILV-LDEATASVD 1460

Query: 1097 SQTAWSTCQLMKK-LASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGE 1149
             +T     + ++K  A R   IL   H+   +   + DR++ L +GG+   F +
Sbjct: 1461 VETDKIIQETIRKEFADR--TILTIAHRLDTVF--DSDRIIVL-DGGEVKEFDK 1509

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 95/198 (47%), Gaps = 24/198 (12%)

Query: 916  LSKSQAIFHWK---NLCYDIPIKNGKRRI----------LDNVDGWVKP-GTLTALIGAS 961
            L  + A F W+   NL  D   KNG+  +          L ++D +  P  +L  ++G  
Sbjct: 597  LKINNATFLWRSKENLHKDD--KNGENDVEARIESSQIALKSIDNFEVPKSSLICVVGRV 654

Query: 962  GAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRF 1021
            GAGK+T+L C+  +  +  I+G+      P+ Q    ++ YC Q+   +  A+V++++ F
Sbjct: 655  GAGKSTILKCILGQ--LPCISGNN-DHLSPQFQINATTVAYCPQEA-WIMNASVKDNILF 710

Query: 1022 SAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAK 1081
                 + D+   +   K  + + ++  +    + +VG  G  L+  Q+ RL++   + ++
Sbjct: 711  G---HKYDEAFYKATIKACQLLPDIKVLPDGDETMVGEKGIVLSGGQKTRLSLARAVYSR 767

Query: 1082 PKLLVFLDEPTSGLDSQT 1099
              L + LD+  S +D++ 
Sbjct: 768  ADLYL-LDDILSAVDTEV 784

>Scas_707.8
          Length = 294

 Score = 37.4 bits (85), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 75/155 (48%), Gaps = 21/155 (13%)

Query: 953  TLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKT 1012
            T T ++GA+GAGK+TLL  LA +     + G + V+G   D   P S+   Q  D   KT
Sbjct: 34   TRTLVVGANGAGKSTLLKLLAGKHLC--LNGKILVNG--LDPFSPLSM--YQDND---KT 84

Query: 1013 ATVRESLRFSAYL-RQADDVSIEEKDKYVEEVIEVLEMKLYAD---AIVGVPGEGLNVE- 1067
                +  + + YL  +   +SI  +D  V E++E + +  Y D    ++ +    +N   
Sbjct: 85   TAEDKDWQVTTYLGTEWCHMSIINRDIGVLELLESIGLAHYRDRGNKLIEILDININWRM 144

Query: 1068 ------QRKRLTIGVELAAKPKLLVFLDEPTSGLD 1096
                  Q++R+ + + L  KP  ++ LDE T  LD
Sbjct: 145  HRLSDGQKRRVQLAMGL-LKPWRVLLLDEVTVDLD 178

>YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative
            ortholog of human Rnase L inhibitor (RLI) of the
            interferon-regulated 2-5A pathway, putative ortholog of
            C. elegans Y39E4B.1, member of the non-transporter group
            in the ATP-binding cassette (ABC) superfamily [1827 bp,
            608 aa]
          Length = 608

 Score = 37.7 bits (86), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 87/194 (44%), Gaps = 26/194 (13%)

Query: 950  KPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQ-SFPRSIGYCQQQDL 1008
            +PG +  L+G +G GK+T L  LA +    L        GR  D   +   I Y +  +L
Sbjct: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152

Query: 1009 -HLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMK--------------LYA 1053
             +  T  + + ++     +  D++    K   V++V E+L+++              L  
Sbjct: 153  QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGP-VQKVGELLKLRMEKSPEDVKRYIKILQL 211

Query: 1054 DAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASR 1113
            + ++    E L+  + +R  IG+    +  + +F DEP+S LD +   +  Q+++ L + 
Sbjct: 212  ENVLKRDIEKLSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAAQIIRSLLAP 270

Query: 1114 GQAILCTIHQPSAL 1127
             + ++C  H  S L
Sbjct: 271  TKYVICVEHDLSVL 284

>YKR104W (NFT1) [3355] chr11 (656472..657392) Member of the
            ATP-binding cassette (ABC) superfamily [921 bp, 306 aa]
          Length = 306

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 99/224 (44%), Gaps = 31/224 (13%)

Query: 940  RILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFP-- 997
            + LDNV   VK GT   ++G +GAGK++++  +   +      G + +D +   +  P  
Sbjct: 48   KALDNVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWE--NGTITIDNKDI-KHIPLE 104

Query: 998  --RSIGYCQQQDLHLKTATVRESL----RFS-----------AYLRQADDVSI---EEKD 1037
              R+   C  QD  L   TVR +L    R+S             + + D++ +   +E+ 
Sbjct: 105  RLRNSISCIPQDPTLFDGTVRSNLDPFDRYSDVQIYGVLSKVGLIEECDELCLIFEQEQP 164

Query: 1038 KYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDS 1097
             +    +    + L  + +V   G  L+  QR+ L +   +     ++  +DE T+ +D 
Sbjct: 165  NFSSHKLRNRFIDL--NTVVKSGGSNLSQGQRQLLCLARSMLGARNIM-LIDEATASID- 220

Query: 1098 QTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEG 1141
              + +  Q   +   +   IL   H+  +++  ++D++L ++ G
Sbjct: 221  YISDAKIQKTIRETMKNTTILTIAHRLRSVI--DYDKILVMEMG 262

>KLLA0A10857g complement(941784..944042) highly similar to sp|P43535
            Saccharomyces cerevisiae YFR009w GCN20 positive effector
            of GCN2P, start by similarity
          Length = 752

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 83/203 (40%), Gaps = 41/203 (20%)

Query: 929  CYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAER------------- 975
             +D+ + +G+R IL N    +  G    L+G +G GK+TLL  L+ R             
Sbjct: 203  TFDLYVGDGQR-ILSNAQLTLSYGRRYGLVGQNGIGKSTLLKALSRRELNVPKHISVLHV 261

Query: 976  ----------TTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYL 1025
                          ++  DV+   R +  S    I    Q+  +L+     ESL      
Sbjct: 262  EQEIRGDETKALQSVLDADVW---RKQLLSEESKINERLQEIENLRKEFNEESLEVKKLD 318

Query: 1026 RQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQ------------RKRLT 1073
             +  D+  E  ++  E++I++   K  A A   + G G + E             R RL+
Sbjct: 319  NERTDLE-EHLEQISEKLIDMESDKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLS 377

Query: 1074 IGVELAAKPKLLVFLDEPTSGLD 1096
            +   L  +P LL+ LDEP++ LD
Sbjct: 378  LARALFCQPDLLL-LDEPSNMLD 399

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 90/213 (42%), Gaps = 37/213 (17%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAE--RTTMGLITGDVFVDGRPRDQSFPR 998
            +L +V+  V+  +  +L+GA+G GKTTLL  + E  R T G      FV   PR      
Sbjct: 547  LLTDVNLDVQMDSRISLVGANGCGKTTLLKVMMEQLRPTKG------FVSRNPR-----L 595

Query: 999  SIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVG 1058
             IGY  Q   H+ +  + +S          D +S     K  EE        L A  I G
Sbjct: 596  RIGYFTQH--HVDSMDLNQS--------AVDWMSTAFPGKTDEEY----RRHLGAFGISG 641

Query: 1059 VPG----EGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRG 1114
              G    + L+  Q+ R+         P +LV LDEP++ LD+    +   L+  L S  
Sbjct: 642  SLGIQRMQLLSGGQKSRVAFAALCLNNPHILV-LDEPSNHLDTAGLDA---LVDALKSFN 697

Query: 1115 QAILCTIHQPSALLMQEFDRLLFLQEGGQTVYF 1147
              +L   H  S  ++      +++ EGG+   F
Sbjct: 698  GGVLMVSHDIS--VINSVCNEIWVSEGGKVQRF 728

>AEL032W [2474] [Homologous to ScYFR009W (GCN20) - SH]
            complement(572196..574457) [2262 bp, 753 aa]
          Length = 753

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 82/191 (42%), Gaps = 31/191 (16%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSI 1000
            +L +V+  V+  +  AL+GA+G GKTTLL  + E+  +  ITG V  + R R       I
Sbjct: 548  LLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQ--LRPITGHVSRNPRLR-------I 598

Query: 1001 GYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVP 1060
            GY  Q   H+ +  +  S          D +S     K  EE        L A  I G  
Sbjct: 599  GYFTQH--HIDSMDLNAS--------AVDWMSKTFPGKTDEEY----RRHLGAFGITGSL 644

Query: 1061 G----EGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQA 1116
            G    + L+  Q+ R+         P +L+ LDEP++ LD+    +  Q +K  +     
Sbjct: 645  GLQKMQLLSGGQKSRVAFAALCLNSPHILI-LDEPSNHLDTAGLDALVQALKNFSG---G 700

Query: 1117 ILCTIHQPSAL 1127
            +L   H  S +
Sbjct: 701  VLMVSHDISVI 711

>Kwal_33.13308
          Length = 706

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 101/236 (42%), Gaps = 24/236 (10%)

Query: 924  HWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITG 983
             ++N+ +  P ++ +  I +N+   +  G    ++G SG GK+T+   L     +   TG
Sbjct: 441  EFQNVKFAYPTRH-QHTIFENLTFRINAGEHVCIVGPSGGGKSTVASLLLRFYDVD--TG 497

Query: 984  DVFVDGRP----RDQSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKY 1039
             + + G+       + + R +G  QQ+ + L   T+ +++ +S         S+   +  
Sbjct: 498  AITIGGQSIASFNLRKYRRMLGVVQQEPM-LFNGTILDNIVYSV------PQSLLNDENR 550

Query: 1040 VEEVIEVLEMKLYADA-------IVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPT 1092
            V   I       +  +       +VG  G  L+  Q++R+ +          L+ LDE T
Sbjct: 551  VARAIGQANCSAFLSSFPDGLQTLVGPRGTQLSGGQKQRIALARAFLLD-PDLLILDEAT 609

Query: 1093 SGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFG 1148
            S LDS++     + +   ++RG+  +   H+ S +  Q   R++ L   G  V  G
Sbjct: 610  SALDSRSEEVVARALYSRSTRGKTTISIAHRVSTI--QHSSRVIVLGRSGYVVETG 663

>Sklu_1870.3 YFL028C, Contig c1870 3336-4133
          Length = 265

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 69/148 (46%), Gaps = 14/148 (9%)

Query: 953  TLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRP--RDQSFPRSIGYCQQQDLHL 1010
            T T ++G++GAGK+TLL  L+ +     + G + V+G       S  +    CQ    +L
Sbjct: 33   TRTLVVGSNGAGKSTLLKLLSGKHLC--LNGRILVNGLDPFSPTSMQKDAEDCQITT-YL 89

Query: 1011 KTATVRESL--RFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQ 1068
             T     S+  R    L   + +  E   +  EE+I +L++ L         G+    ++
Sbjct: 90   GTEWCHMSIINRDIGILELLNSIGFEHYRERGEELISILDIDLEWRMHRLSDGQ----KR 145

Query: 1069 RKRLTIGVELAAKPKLLVFLDEPTSGLD 1096
            R +LT+G+    KP  ++ LDE T  LD
Sbjct: 146  RVQLTMGL---LKPWKVLLLDEVTVDLD 170

>Scas_636.14
          Length = 608

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 90/209 (43%), Gaps = 24/209 (11%)

Query: 205 PGELLVVLGRPGAGCTTLLKSIS----VNTHGFKISPD--TIITYNGFSNKEIKNHYRGE 258
           PG++L ++G  G G +T LK ++     N   F   P+   II Y  F   E++N++   
Sbjct: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKY--FRGSELQNYFTKM 159

Query: 259 VVYNAESDIHIPHLTVFQTLYTVAR-LKTPRNRIKGVDRDTFAKHMTEVA--MATYGLSH 315
           +  N ++ I        Q +  + R +K P  ++  + +    K    V   + T  L H
Sbjct: 160 LEDNIKAIIKP------QYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEH 213

Query: 316 TADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQA 375
             + ++G      +SGGE +R +I    +  +    +D  +  LD    L   + ++   
Sbjct: 214 VLNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLL 268

Query: 376 TITKSAATVAIYQCSKDAYDLFDKVCVLY 404
           T TK    V  +  S   Y L D VC++Y
Sbjct: 269 TPTKYVIAVE-HDLSVLDY-LSDFVCIIY 295

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 86/194 (44%), Gaps = 26/194 (13%)

Query: 950  KPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRD-QSFPRSIGYCQQQDL 1008
            +PG +  L+G +G GK+T L  LA +    L        GR  D   +   I Y +  +L
Sbjct: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152

Query: 1009 -HLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADA------------ 1055
             +  T  + ++++     +  D++    K   V++V E+L++++  D+            
Sbjct: 153  QNYFTKMLEDNIKAIIKPQYVDNIPRAIKGP-VQKVGELLKLRMEKDSETVKGYIKTLQL 211

Query: 1056 --IVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASR 1113
              ++      L+  + +R  IG+       + +F DEP+S LD +   +  Q+++ L + 
Sbjct: 212  EHVLNREIGKLSGGELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIRDLLTP 270

Query: 1114 GQAILCTIHQPSAL 1127
             + ++   H  S L
Sbjct: 271  TKYVIAVEHDLSVL 284

>Scas_706.21
          Length = 1304

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (65%), Gaps = 5/41 (12%)

Query: 950 KPGTLTALIGASGAGKTTLLDCLAERTTMGL---ITGDVFV 987
           KP  LT ++G++G+GKTT+++CL   TT  L     G VFV
Sbjct: 27  KP--LTLIVGSNGSGKTTIIECLKYATTGDLPPNSKGGVFV 65

>Scas_618.3
          Length = 793

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 65/151 (43%), Gaps = 38/151 (25%)

Query: 956  ALIGASGAGKTTLLDCLAE--RTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQ---DLHL 1010
            AL+GA+G GKTTLL  + E  R T G ++     +GR R       IGY  Q     + L
Sbjct: 603  ALVGANGCGKTTLLKVMMEELRPTKGFVSR----NGRLR-------IGYFTQHHVDSMDL 651

Query: 1011 KTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPG----EGLNV 1066
             T+ V        ++ +A          Y  +  E     L +  I G  G    E L+ 
Sbjct: 652  TTSAV-------DWMSKA----------YPGKTDEEYRHHLGSFGITGTLGLQKMELLSG 694

Query: 1067 EQRKRLTIGVELAAKPKLLVFLDEPTSGLDS 1097
             Q+ R+         P +LV LDEP++ LD+
Sbjct: 695  GQKSRVAFAALCLNNPHILV-LDEPSNHLDT 724

>KLLA0C17556g complement(1544404..1546227) highly similar to
            sgd|S0002498 Saccharomyces cerevisiae YDR091c RLI1, start
            by similarity
          Length = 607

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 85/194 (43%), Gaps = 26/194 (13%)

Query: 950  KPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRD-QSFPRSIGYCQQQDL 1008
            +PG +  L+G +G GK+T L  LA +    L        GR  D   +   I Y +  +L
Sbjct: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFEDPPEWQEIIKYFRGSEL 152

Query: 1009 -HLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKL---------YADA--- 1055
             +  T  + + ++     +  D++    K   V++V E+L+++L         Y D    
Sbjct: 153  QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGP-VQKVGELLKLRLEKSKDDAKRYIDILQL 211

Query: 1056 --IVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASR 1113
              ++      L+  + +R  IG+    +  + +F DEP+S LD +   +   +++ L + 
Sbjct: 212  KNVLNREVSALSGGELQRFAIGMSCVQEADVYMF-DEPSSYLDVKQRLNAALIIRSLLNP 270

Query: 1114 GQAILCTIHQPSAL 1127
               ++C  H  S L
Sbjct: 271  TTYVICVEHDLSVL 284

>KLLA0F22451g 2098204..2099559 similar to sp|P33895 Saccharomyces
           cerevisiae YOL069w NUF2 spindle pole body protein
           singleton, start by similarity
          Length = 451

 Score = 33.9 bits (76), Expect = 1.1,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 47/97 (48%), Gaps = 6/97 (6%)

Query: 421 FQRMGYVCPERQTTADYLTSITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQL 480
           F  M    P+   T   L+++ + + R +++ M      + +T + +NQ   + ++Y  L
Sbjct: 104 FNMMDLYKPDSLRTRRLLSAVVNYA-RFREERMFDCDKFMSKTEFLLNQLRSKFDDYNYL 162

Query: 481 QVQVNKHLDTDSSQQRE-----QIKNAHIAKQSKRAR 512
           Q Q+NKH +    ++ E     Q +N H+ +Q  R +
Sbjct: 163 QQQINKHRNEIELREGETFETLQQQNKHLDQQISRLK 199

>KLLA0A01452g 130078..131901 highly similar to sp|P40024 Saccharomyces
            cerevisiae YER036c, start by similarity
          Length = 607

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 70/171 (40%), Gaps = 32/171 (18%)

Query: 936  NGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQS 995
            N +  + +++D  V   +  AL+G +G GK+TLL  +  + T           GR    S
Sbjct: 402  NSENNLYEHLDFGVDMDSRIALVGPNGVGKSTLLKIMTGQLTTQ--------SGRVSRHS 453

Query: 996  FPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADA 1055
              +   Y Q     L     + +L F           + +K  +V +  +    +L    
Sbjct: 454  HVKLGVYSQHSQDQLDL--TKSALEF-----------VRDKYPHVSQDFQYWRGQL---G 497

Query: 1056 IVGVPGEGLNVE-------QRKRLTIGVELAAKPKLLVFLDEPTSGLDSQT 1099
              G+ GEG  V+       QR R+   +    +P +L  LDEPT+GLD  T
Sbjct: 498  RYGLTGEGQTVQMGTLSEGQRSRVVFALLALEQPNVL-LLDEPTNGLDIPT 547

>CAGL0G08041g complement(758811..760634) highly similar to tr|Q03195
           Saccharomyces cerevisiae YDR091c, start by similarity
          Length = 607

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 90/209 (43%), Gaps = 24/209 (11%)

Query: 205 PGELLVVLGRPGAGCTTLLKSIS----VNTHGFKISPD--TIITYNGFSNKEIKNHYRGE 258
           PG++L ++G  G G +T LK ++     N   F   P+   II Y  F   E++N++   
Sbjct: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKY--FRGSELQNYFTKM 159

Query: 259 VVYNAESDIHIPHLTVFQTLYTVAR-LKTPRNRIKGVDRDTFAKHMTEVA--MATYGLSH 315
           +    E DI    +   Q +  + R +K P  ++  + +    K    V   + T  L H
Sbjct: 160 L----EDDIK--AIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDH 213

Query: 316 TADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQA 375
             + ++G      +SGGE +R +IA   +  +    +D  +  LD    L    AL  ++
Sbjct: 214 LLNREIG-----LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLN--AALIIRS 266

Query: 376 TITKSAATVAIYQCSKDAYDLFDKVCVLY 404
            +  S   +A+         L D VC+LY
Sbjct: 267 LLEPSKYVIAVEHDLSVLDYLSDFVCILY 295

>AFL113C [3082] [Homologous to ScYPL217C (BMS1) - SH]
           (223522..227013) [3492 bp, 1163 aa]
          Length = 1163

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 954 LTALIGASGAGKTTLLDCLAER---TTMGLITGDV-FVDGRPRDQSF 996
           + A++G  G GKTTL+  L  R   TT+G I G +  V G+ R  +F
Sbjct: 71  IVAVVGPPGTGKTTLIKSLVRRLTKTTLGEINGPITVVSGKRRRLTF 117

>CAGL0J07788g complement(757051..760968) similar to sp|P12753
           Saccharomyces cerevisiae YNL250w RAD50 DNA repair
           protein, start by similarity
          Length = 1305

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 5/41 (12%)

Query: 950 KPGTLTALIGASGAGKTTLLDCLAERTTMGL---ITGDVFV 987
           KP  LT ++G +G+GKTT+++CL   TT  L     G VFV
Sbjct: 27  KP--LTLIVGMNGSGKTTIIECLKYATTGDLPPNSKGGVFV 65

>CAGL0M05753g complement(610837..612543) similar to sp|P53166
            Saccharomyces cerevisiae YGL064c, hypothetical start
          Length = 568

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 45/93 (48%), Gaps = 7/93 (7%)

Query: 1045 EVLE-MKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWST 1103
            ++LE +K   D ++  P + L++ QR R+    +L  K    V LDE  + LD      T
Sbjct: 252  QLLENLKSRTDILITTPSKLLSL-QRVRMISRADLILKRIEFVVLDEADTLLDKSWLEDT 310

Query: 1104 CQLMKKLASRGQAILCTIHQPSALLMQEFDRLL 1136
             + +K ++     +LC     SA +  EFDR +
Sbjct: 311  HKALKAMSDVNHLVLC-----SATIPNEFDRTM 338

>Kwal_14.1242
          Length = 269

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 82/185 (44%), Gaps = 24/185 (12%)

Query: 926  KNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDV 985
            K L Y  P  + +   L +++  V   T T +IG++GAGK+TLL  L+ +     ++G++
Sbjct: 8    KGLTYKFP--HNEEASLWDINIEVPWNTRTLIIGSNGAGKSTLLKLLSGKHL--CLSGEI 63

Query: 986  FVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLRFS------AYLRQADDVSIEEKDKY 1039
             V+G   D   P S+   +  +  + T    E    S        L   D +  +   + 
Sbjct: 64   KVNG--LDPFSPHSMHQNEADNCQITTYLGTEWCHMSIINRDIGVLELLDSIGFQSLRER 121

Query: 1040 VEEVIEVLEMKLYADAIVGVPGEGLNVE------------QRKRLTIGVELAAKPKLLVF 1087
             +++I++L++ +         G+   V+                +T+ +++ A+ +LL F
Sbjct: 122  GQKLIDILDVNVNWRMHRLSDGQKRRVQLTMGLLKPWRLLLLDEVTVDLDVRARSRLLSF 181

Query: 1088 LDEPT 1092
            L+E T
Sbjct: 182  LEEET 186

>Kwal_34.16240
          Length = 752

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 26/38 (68%)

Query: 938 KRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAER 975
           K+ +L +V+  V+  +  AL+GA+G GKTTLL  L E+
Sbjct: 544 KQLLLKDVNLDVQMDSRIALVGANGCGKTTLLKILMEQ 581

>YOR341W (RPA190) [5120] chr15 (960982..965976) RNA polymerase I
            largest subunit [4995 bp, 1664 aa]
          Length = 1664

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 60/166 (36%), Gaps = 43/166 (25%)

Query: 177  RLFHRTHGKSEDNDSGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKIS 236
            +LF  + G +E        LK M   INPGE + ++     G                  
Sbjct: 1153 KLFKSSDGVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVG-----------------E 1195

Query: 237  PDTIITYNGFSNKEIKNHYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPR------NR 290
            P T +T N F       H+ G    N    + IP L     +   A +KTP+      N 
Sbjct: 1196 PSTQMTLNTF-------HFAGHGAANVT--LGIPRLREI-VMTASAAIKTPQMTLPIWND 1245

Query: 291  IKGVDRDTFAKHMTEVAMA----------TYGLSHTADTKVGNDFV 326
            +     DTF K +++V ++          T G S+TA       +V
Sbjct: 1246 VSDEQADTFCKSISKVLLSEVIDKVIVTETTGTSNTAGGNAARSYV 1291

>AFR637W [3829] [Homologous to ScYNL250W (RAD50) - SH]
           complement(1598692..1602582) [3891 bp, 1296 aa]
          Length = 1296

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%), Gaps = 2/31 (6%)

Query: 950 KPGTLTALIGASGAGKTTLLDCLAERTTMGL 980
           KP  LT ++GA+G GKTT+++CL   TT  L
Sbjct: 27  KP--LTLIVGANGCGKTTIIECLKYATTGDL 55

>Scas_712.29
          Length = 610

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 75/180 (41%), Gaps = 38/180 (21%)

Query: 936  NGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVF-VDGRPRDQ 994
            N +  + +N+D  V   +  AL+G +G GK+TLL          ++TG++    GR    
Sbjct: 405  NPENNLYENLDFGVDMDSRIALVGPNGVGKSTLLK---------IMTGELTPQSGRVSRH 455

Query: 995  SFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKY--VEEVIEVLEMKLY 1052
            +  +   Y Q     L     + +L F              +DKY  + +  +    +L 
Sbjct: 456  THVKLGVYSQHSQDQLDL--TKSALEFV-------------RDKYPNISQDFQYWRGQL- 499

Query: 1053 ADAIVGVPGEGLNVE-------QRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQ 1105
                 G+ GEG  V+       QR R+   +    +P +L  LDEPT+GLD  T  S  +
Sbjct: 500  --GRYGLTGEGQTVQMGTLSEGQRSRVVFALLALEQPNVL-LLDEPTNGLDIPTIDSLAE 556

>YNL250W (RAD50) [4357] chr14 (175409..179347) Coiled-coil protein
           involved in recombinational DNA repair, required for
           resection at double-stranded breaks and for DNA repair
           during vegetative growth, involved in telomere addition
           and telomere rapid deletion [3939 bp, 1312 aa]
          Length = 1312

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 5/41 (12%)

Query: 950 KPGTLTALIGASGAGKTTLLDCLAERTTMGL---ITGDVFV 987
           KP  LT ++G +G+GKTT+++CL   TT  L     G VF+
Sbjct: 27  KP--LTLIVGMNGSGKTTIIECLKYATTGDLPPNSKGGVFI 65

>KLLA0C02915g 261280..265170 similar to sp|P12753 Saccharomyces
           cerevisiae YNL250w RAD50 DNA repair protein, start by
           similarity
          Length = 1296

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%), Gaps = 2/31 (6%)

Query: 950 KPGTLTALIGASGAGKTTLLDCLAERTTMGL 980
           KP  LT ++G +G+GKTT+++CL   TT  L
Sbjct: 27  KP--LTLIVGTNGSGKTTIIECLKYATTGDL 55

>Kwal_33.13526
          Length = 1298

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 23/31 (74%), Gaps = 2/31 (6%)

Query: 950 KPGTLTALIGASGAGKTTLLDCLAERTTMGL 980
           KP  LT ++G++G+GKTT+++CL   TT  L
Sbjct: 27  KP--LTLIVGSNGSGKTTIIECLKYATTGDL 55

>ACL072C [977] [Homologous to ScYLL048C (YBT1) - SH; ScYHL035C - SH]
            (224562..229445) [4884 bp, 1627 aa]
          Length = 1627

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 89/217 (41%), Gaps = 34/217 (15%)

Query: 942  LDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDG-RPRD------Q 994
            L N+D     G L    G +G GK++    L     M L  G ++V    PR+       
Sbjct: 690  LRNIDIEFMIGKLNVAFGPTGTGKSS--LLLGLLGEMTLQEGKIYVPSLDPREDLVIQAD 747

Query: 995  SFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYAD 1054
                SI YC Q    L   T R ++ F++             ++   +V+E   +K   +
Sbjct: 748  GLTNSIAYCSQSAWLLND-TARSNILFNS----------PYNEQRYNDVLEACGLKKDFE 796

Query: 1055 AI-------VGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTA---WSTC 1104
             +       +G  G  L+  Q++R+++   L +  + L+ LD+  S +DS TA   +  C
Sbjct: 797  ILSGGDLTQIGEKGMTLSGGQKQRISLARALYSSARHLL-LDDCLSAVDSHTALLIYENC 855

Query: 1105 QLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEG 1141
             +   +  R   +   +    AL M+  D ++ L+ G
Sbjct: 856  IIGPLMEGRTCVL---VSHNVALTMRNADWVVILENG 889

>CAGL0K12474g 1217183..1218067 similar to sp|P43569 Saccharomyces
            cerevisiae YFL028c CAF16 ATP-binding cassette transporter
            family member, start by similarity
          Length = 294

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 77/174 (44%), Gaps = 30/174 (17%)

Query: 942  LDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGR----------- 990
            ++N++  V   T T ++GA+GAGK+TLL  L+ +     +TG++ V+G            
Sbjct: 23   VENINLKVPWNTRTLVVGANGAGKSTLLKLLSGKHLC--LTGNIKVNGLDPFSPLSMTTS 80

Query: 991  ------PRDQSFPRSIGYCQQQDLHLKTATVRESL--RFSAYLRQADDVSIEEKDKYVEE 1042
                    D  F    G CQ    +L T     S+  R    L   D +  +   +  + 
Sbjct: 81   IDNTLIENDDGFGNK-GECQVS-TYLGTEWCHMSIINRDIGVLELLDSIGYQFFKQRGDR 138

Query: 1043 VIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLD 1096
            +I++L++       V      L+  Q++R+ + + L  KP  ++ LDE T  LD
Sbjct: 139  LIDILDID------VNWRMHRLSDGQKRRVQLAMGL-LKPWRVLLLDEVTVDLD 185

>YDR061W (YDR061W) [912] chr4 (574159..575778) Member of the
            non-transporter group in the ATP-binding cassette
            superfamily [1620 bp, 539 aa]
          Length = 539

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 78/182 (42%), Gaps = 35/182 (19%)

Query: 941  ILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSI 1000
            +L+N+   V+PG+   + G +G+GK+TLL  L               + R  D   PR  
Sbjct: 321  VLENLHWKVQPGSKWHIRGDNGSGKSTLLSLLTAEHPQSW-------NSRVIDNGVPRRT 373

Query: 1001 GYCQQQDLH--------------LKTATVRESLRFS---AYLRQADDVSI---EEKDKYV 1040
            G     DL+              LK A  R ++R S    Y   + +  +   +  DK  
Sbjct: 374  GKTNYFDLNSKIGMSSPELHAIFLKNAGGRLNIRESVATGYHEASSNNYLPIWKRLDKNS 433

Query: 1041 EEVIEV----LEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLD 1096
            +E++ +      +   AD+++    E L+V  +K +     L   P++L+ LDE  SG++
Sbjct: 434  QEIVNMYLKYFGLDKDADSVL---FEQLSVSDQKLVLFVRSLIKMPQILI-LDEAFSGME 489

Query: 1097 SQ 1098
             +
Sbjct: 490  VE 491

>Kwal_26.8730
          Length = 831

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 75/171 (43%), Gaps = 26/171 (15%)

Query: 951  PGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHL 1010
            PG+   ++G +G+GKT++   +AE   +    G + V          R +    Q+   +
Sbjct: 600  PGSSMLILGPNGSGKTSIQRIIAEIWPIYNKNGLLSVPAE-------RELICIPQKPYFI 652

Query: 1011 KTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVL-EMKL-----------YADAIVG 1058
            +  T RE + +     Q  D+   +K     E++ VL E+KL           Y DA V 
Sbjct: 653  QGGTFREQIIYPMSADQYFDLGYRDK-----ELVHVLKEVKLEYLLKRDKGWRYLDA-VA 706

Query: 1059 VPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKK 1109
               + L+  +R+R+     +  KPK +V LDE T+ + +        ++K+
Sbjct: 707  EWKDVLSGGERQRMNFARIMFHKPKFVV-LDEATNAISADMEDYLFNMLKR 756

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 47,979,161
Number of extensions: 2018910
Number of successful extensions: 6643
Number of sequences better than 10.0: 145
Number of HSP's gapped: 6368
Number of HSP's successfully gapped: 305
Length of query: 1536
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1421
Effective length of database: 12,615,039
Effective search space: 17925970419
Effective search space used: 17925970419
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)