Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR327C (SNC2)115984287e-56
CAGL0G06358g113943592e-45
Scas_663.25112733532e-44
ADR355C109713444e-43
KLLA0A03883g110693374e-42
YAL030W (SNC1)117743314e-41
CAGL0E05258g108723245e-40
Kwal_26.705474512591e-30
Kwal_56.23743162621339e-11
AGR054C248741306e-10
YLR093C (NYV1)253761281e-09
Scas_564.4*237681272e-09
CAGL0C00429g234571173e-08
KLLA0F19448g231671174e-08
Kwal_47.1712120059962e-05
Sklu_2258.720059944e-05
AER109W20059936e-05
Scas_571.120059929e-05
YKL196C (YKT6)20059929e-05
CAGL0D03498g20559902e-04
KLLA0D02684g20059840.001
CAGL0C03179g21556740.025
YLR268W (SEC22)21463621.2
Scas_659.11*21556611.5
Kwal_56.2323315056601.7
ADL007C13567591.9
CAGL0H02739g46540584.4
CAGL0L06908g43948575.8
Scas_623.544648576.0
YDL084W (SUB2)44648567.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR327C
         (114 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR327C (SNC2) [5108] chr15 complement(930729..931076) Synaptobr...   169   7e-56
CAGL0G06358g complement(612827..613168) no similarity, hypotheti...   142   2e-45
Scas_663.25                                                           140   2e-44
ADR355C [2096] [Homologous to ScYOR327C (SNC2) - SH; ScYAL030W (...   137   4e-43
KLLA0A03883g join(344642..344725,344850..345098) similar to sp|P...   134   4e-42
YAL030W (SNC1) [38] chr1 (87289..87390,87504..87755) Synaptobrev...   132   4e-41
CAGL0E05258g complement(511027..511353) highly similar to sp|P33...   129   5e-40
Kwal_26.7054                                                          104   1e-30
Kwal_56.23743                                                          56   9e-11
AGR054C [4364] [Homologous to ScYLR093C (NYV1) - SH] (815110..81...    55   6e-10
YLR093C (NYV1) [3508] chr12 complement(326514..327259,327401..32...    54   1e-09
Scas_564.4*                                                            54   2e-09
CAGL0C00429g 43086..43790 similar to tr|Q12255 Saccharomyces cer...    50   3e-08
KLLA0F19448g complement(1799571..1800266) similar to sgd|S000408...    50   4e-08
Kwal_47.17121                                                          42   2e-05
Sklu_2258.7 YKL196C, Contig c2258 11983-12585 reverse complement       41   4e-05
AER109W [2614] [Homologous to ScYKL196C (YKT6) - SH] complement(...    40   6e-05
Scas_571.1                                                             40   9e-05
YKL196C (YKT6) [3076] chr11 complement(74937..75539) Synaptobrev...    40   9e-05
CAGL0D03498g complement(357058..357675) highly similar to sp|P36...    39   2e-04
KLLA0D02684g complement(228564..229166) highly similar to sp|P36...    37   0.001
CAGL0C03179g complement(310371..311018) highly similar to sp|P22...    33   0.025
YLR268W (SEC22) [3662] chr12 (680202..680846) Synaptobrevin (v-S...    28   1.2  
Scas_659.11*                                                           28   1.5  
Kwal_56.23233                                                          28   1.7  
ADL007C [1735] [Homologous to ScYIL004C (BET1) - SH] (696699..69...    27   1.9  
CAGL0H02739g 248511..249908 highly similar to sp|P10507 Saccharo...    27   4.4  
CAGL0L06908g complement(777557..778876) highly similar to sp|Q07...    27   5.8  
Scas_623.5                                                             27   6.0  
YDL084W (SUB2) [784] chr4 (305237..306577) Essential pre-mRNA sp...    26   7.0  

>YOR327C (SNC2) [5108] chr15 complement(930729..931076)
           Synaptobrevin (v-SNARE) homolog present on post-Golgi
           vesicles [348 bp, 115 aa]
          Length = 115

 Score =  169 bits (428), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 82/98 (83%), Positives = 82/98 (83%)

Query: 17  NSGANPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRG 76
           NSGANPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRG
Sbjct: 17  NSGANPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRG 76

Query: 77  ANRVRKQMWWKDLKMRMCLFXXXXXXXXXXXXXXXXHF 114
           ANRVRKQMWWKDLKMRMCLF                HF
Sbjct: 77  ANRVRKQMWWKDLKMRMCLFLVVIILLVVIIVPIVVHF 114

>CAGL0G06358g complement(612827..613168) no similarity, hypothetical
           start
          Length = 113

 Score =  142 bits (359), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 73/94 (77%)

Query: 21  NPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRV 80
           N  SQ+K AAL+ EIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRV
Sbjct: 19  NEQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRV 78

Query: 81  RKQMWWKDLKMRMCLFXXXXXXXXXXXXXXXXHF 114
           RKQMW+KDLKM+ CLF                HF
Sbjct: 79  RKQMWYKDLKMKFCLFVVIICLLVAIVVPIAVHF 112

>Scas_663.25
          Length = 112

 Score =  140 bits (353), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 69/73 (94%)

Query: 22 PNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVR 81
          P SQ+K AAL+ EIDDTVGIMRDNINKVAERGERLTSIEDKADNLA+SAQGFKRGANRVR
Sbjct: 19 PESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVR 78

Query: 82 KQMWWKDLKMRMC 94
          KQMWWKDLKMR C
Sbjct: 79 KQMWWKDLKMRAC 91

>ADR355C [2096] [Homologous to ScYOR327C (SNC2) - SH; ScYAL030W
          (SNC1) - SH] (1333349..1333597,1333672..1333752) [330
          bp, 109 aa]
          Length = 109

 Score =  137 bits (344), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 69/71 (97%)

Query: 24 SQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQ 83
          SQ+K AAL+ EIDDTVGIMRDNINKVAERGERLTSI+DKADNLA+SAQGFKRGANRVRKQ
Sbjct: 18 SQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQ 77

Query: 84 MWWKDLKMRMC 94
          MWWKDLKMR+C
Sbjct: 78 MWWKDLKMRLC 88

>KLLA0A03883g join(344642..344725,344850..345098) similar to
          sp|P33328 Saccharomyces cerevisiae YOR327c SNC2
          synaptobrevin (v-SNARE) homolog present on post-Golgi
          vesicles or sp|P31109 Saccharomyces cerevisiae YAL030w
          SNC1 synaptic vesicle-associated membrane protein,
          start by similarity
          Length = 110

 Score =  134 bits (337), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%)

Query: 26 NKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMW 85
          +KTAAL+ EIDDTV IMRDNINKVAERGERLTSI+DKADNLA+SAQGFKRGANRVRKQMW
Sbjct: 21 SKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMW 80

Query: 86 WKDLKMRMC 94
          WKDLKMRMC
Sbjct: 81 WKDLKMRMC 89

>YAL030W (SNC1) [38] chr1 (87289..87390,87504..87755)
          Synaptobrevin (v-SNARE) homolog present on post-Golgi
          vesicles [354 bp, 117 aa]
          Length = 117

 Score =  132 bits (331), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 62/74 (83%), Positives = 69/74 (93%)

Query: 21 NPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRV 80
          N  S+++TA L+ EIDDTVGIMRDNINKVAERGERLTSIEDKADNLA+SAQGFKRGANRV
Sbjct: 22 NVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRV 81

Query: 81 RKQMWWKDLKMRMC 94
          RK MW+KDLKM+MC
Sbjct: 82 RKAMWYKDLKMKMC 95

>CAGL0E05258g complement(511027..511353) highly similar to
          sp|P33328 Saccharomyces cerevisiae YOR327c SNC2, start
          by similarity
          Length = 108

 Score =  129 bits (324), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 61/72 (84%), Positives = 68/72 (94%)

Query: 25 QNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQM 84
          Q+K AAL+ EIDDTV IMR+NINKVAERGE LTSI+DKADNLA+SAQGFKRGANRVR+QM
Sbjct: 18 QSKAAALKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLAMSAQGFKRGANRVRRQM 77

Query: 85 WWKDLKMRMCLF 96
          W+KDLKMRMCLF
Sbjct: 78 WYKDLKMRMCLF 89

>Kwal_26.7054
          Length = 74

 Score =  104 bits (259), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 50/51 (98%), Positives = 51/51 (100%)

Query: 42 MRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWWKDLKMR 92
          MRDNINKVAERGERLTSIEDKADNLA+SAQGFKRGANRVRKQMWWKDLKMR
Sbjct: 1  MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMR 51

>Kwal_56.23743
          Length = 162

 Score = 55.8 bits (133), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%)

Query: 30  ALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWWKDL 89
           A  Q++ D + +M DNI+K  +R ER++ + D+   L  S+  FKR A R++ +MWW+++
Sbjct: 79  ATEQDLQDIIHLMNDNIDKFLQRQERVSLLVDRTSKLNQSSYNFKRKAVRIKTKMWWQNV 138

Query: 90  KM 91
           K+
Sbjct: 139 KL 140

>AGR054C [4364] [Homologous to ScYLR093C (NYV1) - SH]
           (815110..815795,815928..815988) [747 bp, 248 aa]
          Length = 248

 Score = 54.7 bits (130), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 3/74 (4%)

Query: 18  SGANPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGA 77
           S  +P S N T    Q++   V +M DNI+K  +R ER++ + D+   L  S+  F+R A
Sbjct: 157 SYHDPTSSNAT---DQDLQTIVSVMNDNIDKFLQRQERISLLVDQTSQLNQSSFNFQRKA 213

Query: 78  NRVRKQMWWKDLKM 91
            R++++MWW ++K 
Sbjct: 214 VRIKRKMWWNNIKF 227

>YLR093C (NYV1) [3508] chr12
           complement(326514..327259,327401..327416) Synaptobrevin
           (v-SNARE) homolog involved in vacuolar vesicle fusion
           [762 bp, 253 aa]
          Length = 253

 Score = 53.9 bits (128), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 19  GANPNSQNKTA----ALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFK 74
            +N N QN  +    A   +I D + IM DNI+K  ER ER++ + DK   L  S+  F+
Sbjct: 155 SSNGNGQNTISDIGDATEDQIKDVIQIMNDNIDKFLERQERVSLLVDKTSQLNSSSNKFR 214

Query: 75  RGANRVRKQMWWKDLK 90
           R A  +++ MWW+ +K
Sbjct: 215 RKAVNIKEIMWWQKVK 230

>Scas_564.4*
          Length = 237

 Score = 53.5 bits (127), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 43/68 (63%)

Query: 23  NSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRK 82
           N  ++ A+   ++ D V IM +NI+K  ER ER++ + DK   L  ++  FK+ A R+++
Sbjct: 147 NENSEGASTENDLQDVVNIMNNNIDKFLERQERISLLVDKTSQLNDNSHNFKKKAVRIKE 206

Query: 83  QMWWKDLK 90
           +MWW+ +K
Sbjct: 207 RMWWQRMK 214

>CAGL0C00429g 43086..43790 similar to tr|Q12255 Saccharomyces
           cerevisiae YLR093c, hypothetical start
          Length = 234

 Score = 49.7 bits (117), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 40/57 (70%)

Query: 34  EIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWWKDLK 90
           ++ + + IM DNI+K  ER ER++ + DK  +L  +++ FKR A +++++MWW+ +K
Sbjct: 155 DMQEVIQIMNDNIDKFLERQERVSLLVDKTSHLNSNSRSFKRKAIKLKERMWWRRMK 211

>KLLA0F19448g complement(1799571..1800266) similar to sgd|S0004083
           Saccharomyces cerevisiae YLR093c NYV1 v-SNARE, vacuolar,
           start by similarity
          Length = 231

 Score = 49.7 bits (117), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 42/67 (62%)

Query: 25  QNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQM 84
           Q   A+  +E+ + + IM DNI+K  +R ER++ + D  + L  ++  F+R ++++ ++M
Sbjct: 144 QQTAASTEEELQNIIAIMNDNIDKFLQRQERISLLVDNTNQLNENSFKFQRKSSKIMRKM 203

Query: 85  WWKDLKM 91
           WW ++K 
Sbjct: 204 WWNNVKF 210

>Kwal_47.17121
          Length = 200

 Score = 41.6 bits (96), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 38/59 (64%)

Query: 21  NPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANR 79
           +P+  +    ++QE+D+T  ++   I  V +RGERL ++ DK+++L+ S++ F + A +
Sbjct: 134 DPSQADSIMRVQQELDETKIVLHKTIESVLQRGERLDNLVDKSESLSASSRMFYKQAKK 192

>Sklu_2258.7 YKL196C, Contig c2258 11983-12585 reverse complement
          Length = 200

 Score = 40.8 bits (94), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 38/59 (64%)

Query: 21  NPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANR 79
           +P+  +    ++QE+D+T  ++   I  V +RGE+L ++ DK+++L+ S++ F + A +
Sbjct: 134 DPSQADSIMKVQQELDETKIVLHKTIESVLQRGEKLDNLVDKSESLSASSRMFYKQAKK 192

>AER109W [2614] [Homologous to ScYKL196C (YKT6) - SH]
           complement(841793..842395) [603 bp, 200 aa]
          Length = 200

 Score = 40.4 bits (93), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 38/59 (64%)

Query: 21  NPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANR 79
           +P+  +    ++QE+D+T  ++   I  V +RGE+L ++ DK+++L+ S++ F + A +
Sbjct: 134 DPSQADSIMRVQQELDETKIVLHKTIESVLQRGEKLDNLVDKSESLSASSRMFYKQAKK 192

>Scas_571.1
          Length = 200

 Score = 40.0 bits (92), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 37/59 (62%)

Query: 21  NPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANR 79
           +P+  +    ++QE+D+T  ++   I  V +RGE+L ++ DK+++L  S++ F + A +
Sbjct: 134 DPSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKK 192

>YKL196C (YKT6) [3076] chr11 complement(74937..75539) Synaptobrevin
           (v-SNARE) homolog with similarity to Sec22p, Snc1p, and
           Snc2p, essential for endoplasmic reticulum-Golgi
           transport [603 bp, 200 aa]
          Length = 200

 Score = 40.0 bits (92), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 37/59 (62%)

Query: 21  NPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANR 79
           +P+  +    ++QE+D+T  ++   I  V +RGE+L ++ DK+++L  S++ F + A +
Sbjct: 134 DPSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKK 192

>CAGL0D03498g complement(357058..357675) highly similar to sp|P36015
           Saccharomyces cerevisiae YKL196c YKT6, start by
           similarity
          Length = 205

 Score = 39.3 bits (90), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 36/59 (61%)

Query: 21  NPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANR 79
           +P   +    ++QE+D+T  ++   I  V +RGE+L ++ DK+++L  S++ F + A +
Sbjct: 139 DPAQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKK 197

>KLLA0D02684g complement(228564..229166) highly similar to sp|P36015
           Saccharomyces cerevisiae YKL196c YKT6 SNARE protein for
           Endoplasmic Reticulum-Golgi transport singleton, start
           by similarity
          Length = 200

 Score = 37.0 bits (84), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 37/59 (62%)

Query: 21  NPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANR 79
           +P+  +    ++QE+D+T   +   I  V +RGE+L ++ DK+++L+ +++ F + A +
Sbjct: 134 DPSQADAIMRVQQELDETKITLHKTIENVLQRGEKLDNLVDKSESLSAASRMFYKQAKK 192

>CAGL0C03179g complement(310371..311018) highly similar to sp|P22214
           Saccharomyces cerevisiae YLR268w SEC22, start by
           similarity
          Length = 215

 Score = 33.1 bits (74), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 32/56 (57%)

Query: 25  QNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRV 80
           Q+    L QE+     IM  NI  +  RG+ L  ++D +++L IS++ +++ A ++
Sbjct: 131 QDNLDQLNQELVGVKQIMSKNIEDLLYRGDSLEKMDDMSNSLKISSKKYRKSAQKI 186

>YLR268W (SEC22) [3662] chr12 (680202..680846) Synaptobrevin
           (v-SNARE) homolog involved in fusion of ER-to-Golgi
           transport vesicles, recognized by putative target
           t-SNARE (Sed5p) [645 bp, 214 aa]
          Length = 214

 Score = 28.5 bits (62), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 32/63 (50%)

Query: 18  SGANPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGA 77
           S ++   Q+    L QE+     IM  NI  +  RG+ L  + D + +L  +++ +++ A
Sbjct: 123 SYSDKKVQDNLDQLNQELVGVKQIMSKNIEDLLYRGDSLDKMSDMSSSLKETSKRYRKSA 182

Query: 78  NRV 80
            ++
Sbjct: 183 QKI 185

>Scas_659.11*
          Length = 215

 Score = 28.1 bits (61), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 29/56 (51%)

Query: 25  QNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRV 80
           Q+    L QE+     IM  NI  +  RG+ L  + D + +L  S++ +++ A ++
Sbjct: 130 QDNLDQLNQELVGVQEIMSKNIEDLLYRGDSLEKMSDLSASLKESSKRYRKSAQKI 185

>Kwal_56.23233
          Length = 150

 Score = 27.7 bits (60), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 28/56 (50%)

Query: 25  QNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRV 80
           QN    L Q++     IM  NI  +  RG+ L  + D + +L   ++ ++R A ++
Sbjct: 66  QNNLDQLNQDLAGVKQIMTKNIEDLLYRGDSLDKMSDLSASLKQDSRKYRRSAQKI 121

>ADL007C [1735] [Homologous to ScYIL004C (BET1) - SH]
          (696699..697106) [408 bp, 135 aa]
          Length = 135

 Score = 27.3 bits (59), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 4/67 (5%)

Query: 20 ANPN---SQNKTAALRQEIDDTVGIMRDNINKVAERGERL-TSIEDKADNLAISAQGFKR 75
          +NP+   SQ+  A L  + D  VG+MR+ I  +    ER+   I   +  L      F  
Sbjct: 33 SNPSIDYSQSTLAQLESQSDADVGVMREKIMALKTLSERMGEEIRGSSKTLDSLGSTFDA 92

Query: 76 GANRVRK 82
           AN++++
Sbjct: 93 TANKLKR 99

>CAGL0H02739g 248511..249908 highly similar to sp|P10507
           Saccharomyces cerevisiae YLR163c MAS1, start by
           similarity
          Length = 465

 Score = 26.9 bits (58), Expect = 4.4,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 29  AALRQEIDDTVGIMRDNINKVAERGERLTSIE--DKADNL 66
           AAL   +DDT  I+ D   ++   G+RL+  E  +K DN+
Sbjct: 385 AALLLSLDDTTAILEDIGRQIVTTGKRLSPEEVFEKVDNI 424

>CAGL0L06908g complement(777557..778876) highly similar to sp|Q07478
           Saccharomyces cerevisiae YDL084w SUB2, start by
           similarity
          Length = 439

 Score = 26.6 bits (57), Expect = 5.8,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 24/48 (50%)

Query: 48  KVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWWKDLKMRMCL 95
           K   R   LT + + ++  AI+  G  +   R+ +   +KD + R+C+
Sbjct: 307 KSTSRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICV 354

>Scas_623.5
          Length = 446

 Score = 26.6 bits (57), Expect = 6.0,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 24/48 (50%)

Query: 48  KVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWWKDLKMRMCL 95
           K   R   LT + + ++  AI+  G  +   R+ +   +KD + R+C+
Sbjct: 314 KSTNRANELTKLLNDSNFPAITVHGHMKQEERIARYKAFKDFEKRICV 361

>YDL084W (SUB2) [784] chr4 (305237..306577) Essential pre-mRNA
           splicing factor, required for nuclear export of mRNA and
           for expression of lacZ fusions in yeast, involved in
           silencing at telomeres and ribosomal DNA, member of the
           DexD/H box family of RNA-dependent ATPases [1341 bp, 446
           aa]
          Length = 446

 Score = 26.2 bits (56), Expect = 7.0,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 24/48 (50%)

Query: 48  KVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWWKDLKMRMCL 95
           K   R   LT + + ++  AI+  G  +   R+ +   +KD + R+C+
Sbjct: 314 KSTTRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICV 361

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.130    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,422,032
Number of extensions: 77150
Number of successful extensions: 331
Number of sequences better than 10.0: 36
Number of HSP's gapped: 331
Number of HSP's successfully gapped: 36
Length of query: 114
Length of database: 16,596,109
Length adjustment: 84
Effective length of query: 30
Effective length of database: 13,688,197
Effective search space: 410645910
Effective search space used: 410645910
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)