Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR326W (MYO2)1574154679760.0
CAGL0F00671g1566155261550.0
Scas_663.261567155959530.0
Kwal_26.70551555155154360.0
ADR354W1558155052330.0
KLLA0A03905g1550154750810.0
Sklu_2164.51350137248370.0
YAL029C (MYO4)1471151235670.0
Scas_592.13*141997933880.0
CAGL0G06336g141897329060.0
Scas_688.22187675513451e-156
ACR068W180578313141e-153
YHR023W (MYO1)192882912761e-147
KLLA0E11572g184878712721e-147
Kwal_23.5534190782412691e-146
CAGL0J00693g188475112101e-138
KLLA0B12562g126075211621e-135
Kwal_26.7587125073511511e-134
Scas_721.119123273111421e-133
CAGL0K07590g125276311401e-132
YMR109W (MYO5)121973511181e-129
CAGL0K03487g121776211171e-129
YKL129C (MYO3)127175611051e-127
AEL306C129277110861e-125
ABR111C78973900.025
Kwal_55.21515567131732.6
YDR303C (RSC3)88539733.0
Sklu_1723.1443112705.1
YNL062C (GCD10)47867705.5
CAGL0D02750g12436666.0
AFR603C95657706.4
YIL151C1118123706.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR326W
         (1546 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,...  3076   0.0  
CAGL0F00671g complement(73893..78593) highly similar to sp|P1952...  2375   0.0  
Scas_663.26                                                          2297   0.0  
Kwal_26.7055                                                         2098   0.0  
ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (...  2020   0.0  
KLLA0A03905g complement(345818..350470) similar to sp|P19524 Sac...  1961   0.0  
Sklu_2164.5 YOR326W, Contig c2164 5497-9549                          1867   0.0  
YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy c...  1378   0.0  
Scas_592.13*                                                         1309   0.0  
CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces c...  1123   0.0  
Scas_688.22                                                           522   e-156
ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH] complement(...   510   e-153
YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain (...   496   e-147
KLLA0E11572g complement(1018972..1024518) similar to sp|P08964 S...   494   e-147
Kwal_23.5534                                                          493   e-146
CAGL0J00693g complement(61246..66900) similar to sp|P08964 Sacch...   470   e-138
KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439 S...   452   e-135
Kwal_26.7587                                                          447   e-134
Scas_721.119                                                          444   e-133
CAGL0K07590g 748352..752110 highly similar to sp|P36006 Saccharo...   443   e-132
YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may ...   435   e-129
CAGL0K03487g 322030..325683 highly similar to sp|Q04439 Saccharo...   434   e-129
YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin ty...   430   e-127
AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C (...   422   e-125
ABR111C [703] [Homologous to ScYPR090W - SH; ScYPR089W - SH] (59...    39   0.025
Kwal_55.21515                                                          33   2.6  
YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Componen...    33   3.0  
Sklu_1723.1 YHR011W, Contig c1723 448-1779 reverse complement          32   5.1  
YNL062C (GCD10) [4528] chr14 complement(508774..510210) RNA-bind...    32   5.5  
CAGL0D02750g 288647..289021 no similarity, hypothetical start          30   6.0  
AFR603C [3795] [Homologous to ScYOL090W (MSH2) - SH] (1524851..1...    32   6.4  
YIL151C (YIL151C) [2526] chr9 complement(57338..60694) Protein o...    32   6.4  

>YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,
            class V, involved in polarized growth, secretion and
            cytokinesis, required for mitochondrial distribution into
            growing bud [4725 bp, 1574 aa]
          Length = 1574

 Score = 3076 bits (7976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1495/1546 (96%), Positives = 1495/1546 (96%)

Query: 1    MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSL 60
            MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSL
Sbjct: 1    MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  TQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180
            TQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  TQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD 240
            FASVEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD
Sbjct: 181  FASVEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD 240

Query: 241  TSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQG 300
            TSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQG
Sbjct: 241  TSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQG 300

Query: 301  GDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSA 360
            GDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSA
Sbjct: 301  GDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSA 360

Query: 361  DEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALF 420
            DEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALF
Sbjct: 361  DEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALF 420

Query: 421  DWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480
            DWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV
Sbjct: 421  DWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480

Query: 481  FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ 540
            FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ
Sbjct: 481  FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ 540

Query: 541  TLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET 600
            TLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET
Sbjct: 541  TLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET 600

Query: 601  LINIXXXXXXXXXXXXXXXXXXXXQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINS 660
            LINI                    QAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINS
Sbjct: 601  LINILEGLEKAAKKLEEAKKLELEQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINS 660

Query: 661  TNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYI 720
            TNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYI
Sbjct: 661  TNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYI 720

Query: 721  LIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKLR 780
            LIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKLR
Sbjct: 721  LIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKLR 780

Query: 781  SNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCATLLQ 840
            SNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCATLLQ
Sbjct: 781  SNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCATLLQ 840

Query: 841  AAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEPRSRF 900
            AAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEPRSRF
Sbjct: 841  AAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEPRSRF 900

Query: 901  LRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLASKVKE 960
            LRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLASKVKE
Sbjct: 901  LRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLASKVKE 960

Query: 961  NKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQKSKDMELQKTIENNLQSTEQT 1020
            NKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQKSKDMELQKTIENNLQSTEQT
Sbjct: 961  NKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQKSKDMELQKTIENNLQSTEQT 1020

Query: 1021 LKDAQLELEDMVKQHDXXXXXXXXXXXXXXXXXXXXVEYQTLNGDLQNEVKSLKEEIARL 1080
            LKDAQLELEDMVKQHD                    VEYQTLNGDLQNEVKSLKEEIARL
Sbjct: 1021 LKDAQLELEDMVKQHDELKEESKKQLEELEQTKKTLVEYQTLNGDLQNEVKSLKEEIARL 1080

Query: 1081 QTAMSLGTVTTSVLPQTPLKDVMGGGASNFNNMMLENSDLSPNDLNLKSRSTPSSGNNHI 1140
            QTAMSLGTVTTSVLPQTPLKDVMGGGASNFNNMMLENSDLSPNDLNLKSRSTPSSGNNHI
Sbjct: 1081 QTAMSLGTVTTSVLPQTPLKDVMGGGASNFNNMMLENSDLSPNDLNLKSRSTPSSGNNHI 1140

Query: 1141 DSLSVDRENGVNATQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQLSKRDVVY 1200
            DSLSVDRENGVNATQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQLSKRDVVY
Sbjct: 1141 DSLSVDRENGVNATQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQLSKRDVVY 1200

Query: 1201 PARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWLANVRELYS 1260
            PARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWLANVRELYS
Sbjct: 1201 PARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWLANVRELYS 1260

Query: 1261 FVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYNIWXXXXXXXXXXX 1320
            FVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYNIW           
Sbjct: 1261 FVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYNIWLKKLQKQLQKK 1320

Query: 1321 AINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYWCMKSFHIENEVFH 1380
            AINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYWCMKSFHIENEVFH
Sbjct: 1321 AINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYWCMKSFHIENEVFH 1380

Query: 1381 AVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLTDGTECLQHLI 1440
            AVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLTDGTECLQHLI
Sbjct: 1381 AVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLTDGTECLQHLI 1440

Query: 1441 QTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADYESPIPQEILRYVADIVK 1500
            QTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADYESPIPQEILRYVADIVK
Sbjct: 1441 QTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADYESPIPQEILRYVADIVK 1500

Query: 1501 KEAALSSSGNDSKGHEHSSSIFITPETGPFTDPFSLIKTRKFDQVE 1546
            KEAALSSSGNDSKGHEHSSSIFITPETGPFTDPFSLIKTRKFDQVE
Sbjct: 1501 KEAALSSSGNDSKGHEHSSSIFITPETGPFTDPFSLIKTRKFDQVE 1546

>CAGL0F00671g complement(73893..78593) highly similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 or sp|P32492
            Saccharomyces cerevisiae YAL029c MYO4, start by
            similarity
          Length = 1566

 Score = 2375 bits (6155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1162/1552 (74%), Positives = 1308/1552 (84%), Gaps = 21/1552 (1%)

Query: 1    MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSL 60
            MSFEVGTRCWYP KELGWIGAEV KN+  DG YH+EL LED + V+++TKDL ++ D+SL
Sbjct: 1    MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDLTDESDESL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  TQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180
            +QDMIQAYAGK+RGE+EPHLFAIAEEAYRLMK++K+NQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD 240
            FASVEEENS TVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD
Sbjct: 181  FASVEEENSMTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD 240

Query: 241  TSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQG 300
            TSIIGA+IRTYLLERSRLVYQP  ERNYHIFYQ+MAGL  + K ELHL  A DY+YMNQG
Sbjct: 241  TSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYMNQG 300

Query: 301  GDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSA 360
            GD KI G+DD +EY  TVDALTLVGI+ ETQ  IFKILAALLHIGNIEIKKTRNDASLS+
Sbjct: 301  GDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDASLSS 360

Query: 361  DEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALF 420
            DE NLK+ACELLGID++NFAKW+TKKQIITRSEKIVSNLNYSQALVA+DSVAKFIYSALF
Sbjct: 361  DEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYSALF 420

Query: 421  DWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480
            DWLVENINTVLCNPAV D+++SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV
Sbjct: 421  DWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480

Query: 481  FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ 540
            FKLEQEEYVKE+IEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ
Sbjct: 481  FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ 540

Query: 541  TLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET 600
            TLDK PTNKVFSKPRFGQTKF+VSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET
Sbjct: 541  TLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET 600

Query: 601  LINIXXXXXXXXXXXXXXXXXXXXQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINS 660
            LINI                    ++   KPGP+RTV RKPTLGSMFKQSLIELM TI S
Sbjct: 601  LINI-LDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTIRS 659

Query: 661  TNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYI 720
            TN HYIRCIKPN DKEAW+FDNLMVLSQLRACGVLETIRISCAGFPSRWTF EF+LRYYI
Sbjct: 660  TNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYI 719

Query: 721  LIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKLR 780
            L+P  +W  IF KK+ TE+D+I +   IL  TVK+K KYQIGNTKIFFKAGMLA+LEKLR
Sbjct: 720  LLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAFLEKLR 779

Query: 781  SNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCATLLQ 840
            S+KMH S V+IQK IRAKYYR+++L+I  AI  LQ  +KG + R  ++ E K   AT +Q
Sbjct: 780  SDKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNKAATEIQ 839

Query: 841  AAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEPRSRF 900
            +  RG+  R+ + S++ +I  +Q K+RKEL ++  + +HE +AAV IQSKVR+F+PR  F
Sbjct: 840  SLLRGYRRRSQILSIISSIRCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSFKPRKAF 899

Query: 901  LRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLASKVKE 960
            L  ++ TVVVQSLIRRR AQ+KLKQLKADAKSVNHLKEVSYKLENKV+ELTQNLA+KVKE
Sbjct: 900  LEDRRKTVVVQSLIRRRFAQKKLKQLKADAKSVNHLKEVSYKLENKVVELTQNLAAKVKE 959

Query: 961  NKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQKSKDMELQKTIENNLQSTEQT 1020
            NK ++ R+ ELQ  +EESA LQE L+ +K +H  ++  QK    E  K IE  L +    
Sbjct: 960  NKSLSARVVELQTSLEESALLQEELKQIKSKHDAELLEQKDVFAEKGKQIEEELNAANLQ 1019

Query: 1021 LKDAQLELEDMVKQHDXXXXXXXXXXXXXXXXXXXXVEYQTLNGDLQNEVKSLKEEIARL 1080
            +++ + +L D+ ++++                    +E QT N DLQNEV SLKEE++RL
Sbjct: 1020 VEEYKSKLLDLTQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNEVNSLKEELSRL 1079

Query: 1081 QTAMSLGTVTTSVLPQTPLKDV-MGGGASNFNNMMLENSDLSP-NDLNLK---SRSTPSS 1135
            QT +SLGTVT +VLPQTP KD+ M    +N        +D+ P ++LN++   S+   S 
Sbjct: 1080 QTQISLGTVTANVLPQTPSKDIHMQRNVTN-------GTDIGPGSELNVRPVNSKDAGSV 1132

Query: 1136 GNNHIDSLSVDRENGVNA-TQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQLS 1194
             N  +DS + D     NA TQINEEL+RLLED E+LN EIT+GLLK FEVP AGV +QLS
Sbjct: 1133 SNMGMDSYASDS----NALTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLS 1188

Query: 1195 KRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWLAN 1254
            +RDVVYPARILII+LSEMWRFGLTKQSE FLAQVLTTIQKVVT LKGNDLIP+G FWLAN
Sbjct: 1189 RRDVVYPARILIIILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLAN 1248

Query: 1255 VRELYSFVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYNIWXXXXX 1314
            VRELYSFVVFA +SILTEE+FK+GMTD+EYKEYVSLVTELK+DFE+LSYNIYNIW     
Sbjct: 1249 VRELYSFVVFAQHSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQ 1308

Query: 1315 XXXXXXAINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYWCMKSFHI 1374
                  A+NAVV+SE+LPGFSAG++ G LNKIF++ EEYTMDDILTFFNSIYW MKSF I
Sbjct: 1309 RELQKKAVNAVVLSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKSFQI 1368

Query: 1375 ENEVFHAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLTDGTE 1434
            ENEVFH VVTTLLNYVDAICFN+LIMKRNFLSWKRGLQLNYNVTRLEEWCKTHG+ DGT+
Sbjct: 1369 ENEVFHKVVTTLLNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGVPDGTD 1428

Query: 1435 CLQHLIQTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADYESPIPQEILRY 1494
            CLQHLIQT+KLLQVRKY+IEDIDILRGIC SLTPAQLQKLI+QYQVADYESPIPQEIL+Y
Sbjct: 1429 CLQHLIQTSKLLQVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADYESPIPQEILKY 1488

Query: 1495 VADIVKKEAALSSSGNDSKGHEHSSSIFITPETGPFTDPFSLIKTRKFDQVE 1546
            VADIVK EA+LS+S   SK   HS+ IFITPETGPF DPF+ I+T KFDQVE
Sbjct: 1489 VADIVKSEASLSAS---SKAPTHSNDIFITPETGPFNDPFADIETHKFDQVE 1537

>Scas_663.26
          Length = 1567

 Score = 2297 bits (5953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1123/1559 (72%), Positives = 1288/1559 (82%), Gaps = 33/1559 (2%)

Query: 1    MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSL 60
            MSFEVGTRCWYP KE GWIGAEV KN+  DG Y +EL LED+E+V+V+TKDL N+KD SL
Sbjct: 1    MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKDLTNEKDPSL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILE+TEDLT+LSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDR+DQLY
Sbjct: 61   PLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLY 120

Query: 121  TQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180
            +QDMIQAY+GKRRGE+EPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVEEENSAT---VQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237
            FAS +EENS+    +QH  EMSETE++ILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF
Sbjct: 181  FASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240

Query: 238  DKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYM 297
            DK+T+IIGA++RTYLLERSRLVYQP  ERNYHIFYQ++AGLP   K+ELHLT A DYFYM
Sbjct: 241  DKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYM 300

Query: 298  NQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDAS 357
            NQGG+ +I GIDD  EY IT+ ALTLVG+  ETQ  IFKILAALLHIGNIEIKKTRND+S
Sbjct: 301  NQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSS 360

Query: 358  LSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYS 417
            LS+DEPNLK+ACELLG+D  NFAKW+TKKQI+TRSEKIVSNLNYSQALVA+DSVAKFIYS
Sbjct: 361  LSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIYS 420

Query: 418  ALFDWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477
            ALFDWLV NINTVLCNPAV DQI SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 421  ALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480

Query: 478  QHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 537
            QHVFKLEQEEY+KEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK
Sbjct: 481  QHVFKLEQEEYIKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540

Query: 538  LYQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAST 597
            LYQTLDK PTNKVFSKPRFGQTKF+VSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKA+T
Sbjct: 541  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATT 600

Query: 598  NETLINIXXXXXXXXXXXXXXXXXXXXQAGS--KKPGPIRTVNRKPTLGSMFKQSLIELM 655
            N+TL  I                    Q     KKP PIR V RKPTLGSMFK SLIELM
Sbjct: 601  NDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLSLIELM 660

Query: 656  NTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFV 715
             TINSTNVHYIRCIKPN +KEAW+FDNLMVLSQLRACGVLETIRISCAGFPSRWTF EF+
Sbjct: 661  QTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFI 720

Query: 716  LRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAY 775
            LRYYILIP  +W  IF+K + TE+D+I++ K IL ATV+DK KYQIGNTKIFFKAGMLAY
Sbjct: 721  LRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKAGMLAY 780

Query: 776  LEKLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNC 835
             EKLRS KM+++IV+IQK IR+KYYRKQY+ +  ++  L    KG +IRQRV  E++ + 
Sbjct: 781  FEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYELEQHA 840

Query: 836  ATLLQAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFE 895
            ATL+Q  YRG+S R+ +  V+ +I  LQ +IR+EL+QR+++ ++E NAA++IQS++R F 
Sbjct: 841  ATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSRIRAFV 900

Query: 896  PRSRFLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLA 955
            PR  +   ++DT+VVQSLIRRR AQR  K+LKADAKSV+HLKEVSYKLENKVI+LTQNLA
Sbjct: 901  PRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQLTQNLA 960

Query: 956  SKVKENKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQKSKDMELQKTIENNLQ 1015
            +KVKEN+++++R++ELQ  +   ++LQ+ LE  K E+   + +QK   +   K++++ L 
Sbjct: 961  AKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSLKDQLI 1020

Query: 1016 STEQTLKDAQLELEDMVKQHDXXXXXXXXXXXXXXXXXXXXVEYQTLNGDLQNEVKSLKE 1075
               + ++  + EL  +  ++                      E +T N DL +E+KSLKE
Sbjct: 1021 KANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEIKSLKE 1080

Query: 1076 EIARLQTAMSLGTVT--TSVLPQTPLKD-VMGGGASNFNNMMLENSDLSPNDLNLKSRST 1132
            E+A LQT+++LGTVT  T+++P TP ++  M  G     +M     ++SPN L    +S 
Sbjct: 1081 ELAHLQTSIALGTVTTNTNIVPHTPSRENRMPSG-----HMRAAEENISPNQL----KSI 1131

Query: 1133 PS-SGNNHID----SLSVDRENGVNATQINEELYRLLEDTEILNQEITEGLLKGFEVPDA 1187
            PS +  +H+      +  D  N    TQINEELYRLLE T++LN EITEGLLKGF+VPDA
Sbjct: 1132 PSDTAADHVSVNGYGMDDDIINTNTLTQINEELYRLLEGTDVLNNEITEGLLKGFQVPDA 1191

Query: 1188 GVAIQLSKRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPS 1247
            GVAIQLS+RDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVT LKG DLIPS
Sbjct: 1192 GVAIQLSRRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGIDLIPS 1251

Query: 1248 GVFWLANVRELYSFVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYN 1307
            G FWLANVRELYSFVVFA +SILTEE+FK GM DEEY EYVSLVTELK+DFE+LSYNIYN
Sbjct: 1252 GAFWLANVRELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLSYNIYN 1311

Query: 1308 IWXXXXXXXXXXXAINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYW 1367
            IW           AINAVV+SESLPGF+A E++GFLNKIF + EEYTMDDILTFFN+I+W
Sbjct: 1312 IWLKKLQKDLQKKAINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTFFNNIFW 1371

Query: 1368 CMKSFHIENEVFHAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTH 1427
            CMKSFHIENEVF  V+ TLLNYVD ICFN+LIMKRNFLSWKRGLQLNYNVTRLEEWCKTH
Sbjct: 1372 CMKSFHIENEVFRTVIITLLNYVDTICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTH 1431

Query: 1428 GLTDGTECLQHLIQTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADYESPI 1487
            GL DG + LQHLIQTAKLLQ+RKYTIEDID++RGIC SL+PAQLQKLISQY VADYESPI
Sbjct: 1432 GLPDGAQYLQHLIQTAKLLQLRKYTIEDIDMVRGICSSLSPAQLQKLISQYHVADYESPI 1491

Query: 1488 PQEILRYVADIVKKEAALSSSGNDSKGHEHSSSIFITPETGPFTDPFSLIKTRKFDQVE 1546
            PQ+IL+YVADIVKKE+  +S+ ND         IF+ PETGPF DPF  +KTRKFDQVE
Sbjct: 1492 PQDILKYVADIVKKES--TSAHND---------IFLHPETGPFNDPFVAVKTRKFDQVE 1539

>Kwal_26.7055
          Length = 1555

 Score = 2098 bits (5436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1026/1551 (66%), Positives = 1237/1551 (79%), Gaps = 33/1551 (2%)

Query: 1    MSFEVGTRCWYPHKELGWIGAEVIK-NEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQS 59
            MSFEVGTRCWYP K+ GW+G+EV K ++  +GK+ LEL+LE+ E V ++T+ LN  +++ 
Sbjct: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPEEGKFLLELKLENGETVEIETETLNESQNEK 60

Query: 60   LPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQL 119
            LPLLRNPPILEA EDLTSLSYLNEPAVLHAIK RY QLNIYTYSGIVLIATNPFDRV+QL
Sbjct: 61   LPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQL 120

Query: 120  YTQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMR 179
            Y+QDMIQAYAG+RRGELEPHLFAIA+EAYRLMK+DKQNQTIVVSGESGAGKTVSAKYIMR
Sbjct: 121  YSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMR 180

Query: 180  YFASVEEENS--ATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237
            YFASVE+ N+  A+  H ++MSETE++ILATNPIMEAFGNAKT+RNDNSSRFGKYLEILF
Sbjct: 181  YFASVEQANADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILF 240

Query: 238  DKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYM 297
            D+ TSIIGARIRTYLLERSRLV+QP +ERNYHIFYQL+ GL    KEELHLT   DY Y+
Sbjct: 241  DESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYL 300

Query: 298  NQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDAS 357
             QGGD +I G+DDA EY++TVDAL +VG +++TQHQ+FKILAALLHIGNIE+KKTRNDAS
Sbjct: 301  RQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDAS 360

Query: 358  LSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYS 417
            LS+DEPNLK+AC+LLGIDA  F+KW+TKKQI TRSEKIVSNL+++QALVA+DSVAKFI+S
Sbjct: 361  LSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIFS 420

Query: 418  ALFDWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477
            ALFDWLVENINTVLCNP V+DQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 421  ALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480

Query: 478  QHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 537
            QHVFKLEQEEYV E+IEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK
Sbjct: 481  QHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540

Query: 538  LYQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAST 597
            LYQTLDK PTN VFSKPRFGQTKF+VSHYALDVAYDV GFIEKNRDTVSDGHLEVLKAS 
Sbjct: 541  LYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASK 600

Query: 598  NETLINIXXXXXXXXXXXXXXXXXXXXQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNT 657
            N+TL++I                    Q  +KKPGP R V +KPTLGSMFKQSLIELMNT
Sbjct: 601  NDTLLSI------LDTIDKNAAALAEKQDANKKPGPARMV-KKPTLGSMFKQSLIELMNT 653

Query: 658  INSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLR 717
            I+STNVHYIRCIKPN +KEAW+FDNLMVLSQLRACGVLETIRISCAGFPSRWT+ EFVLR
Sbjct: 654  IDSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLR 713

Query: 718  YYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLE 777
            Y+ILIP + W  IF   E +E+DI ++ K IL ATV D +KYQ+GNTKIFFKAGMLAYLE
Sbjct: 714  YHILIPSDNWTKIF-TSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLE 772

Query: 778  KLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCAT 837
            KLRS KMHNS V+IQKKI+  YYRKQYL I  AI  +Q  I G   RQ V+ E K   A 
Sbjct: 773  KLRSTKMHNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAI 832

Query: 838  LLQAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEPR 897
             LQ  +RG   R N    L +I  +Q  +RK++ Q+++ ++ +  AAVTIQ K+R F PR
Sbjct: 833  SLQTIFRGVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPR 892

Query: 898  SRFLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLASK 957
              +  T+  +V +QSL+RR+ AQ++LKQLKADAKSVNHL+EVSYKLENKVI+LTQ+LA K
Sbjct: 893  QSYNATRGSSVKIQSLVRRKLAQKQLKQLKADAKSVNHLQEVSYKLENKVIQLTQSLAEK 952

Query: 958  VKENKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQK-SKDMEL-QKTIENNLQ 1015
            VKEN++MT +I++LQ  + ESA ++  L+  K +H  D+  QK S D EL  K IE  L 
Sbjct: 953  VKENRDMTAKIQDLQKSLNESANIKSLLDAQKDDHSRDLQEQKTSHDAELANKKIE--LD 1010

Query: 1016 STEQTLKDAQLELEDMVKQHDXXXXXXXXXXXXXXXXXXXXVEYQTLNGDLQNEVKSLKE 1075
            + +  ++ A+ E+ED++ Q +                     + +T N DL+NEVKSLK+
Sbjct: 1011 NAKAEVEAAKKEIEDLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKSLKD 1070

Query: 1076 EIARLQTAMSLGTVTTSVLPQTPLKDVMGGGASNFNNMMLENSDLSPNDLNLKSRSTPSS 1135
            EI RLQT++  G  + ++L  TP K       S+        +D SP  LN+ S      
Sbjct: 1071 EINRLQTSIRSGANSNTILAHTPTKSRRFSAHSSL-------TDASPRQLNVISM----- 1118

Query: 1136 GNNHIDSLSVDRENGVNATQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQLSK 1195
             NN ++  +  R      +QIN+ELY++LEDT+ LN EI EGLLKGF++P+ GVA +L++
Sbjct: 1119 -NNGMEDDA--RSTASALSQINDELYKILEDTKSLNIEIVEGLLKGFKIPETGVAAELTR 1175

Query: 1196 RDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWLANV 1255
            ++V+YPARI+IIVLS+MWR GLTKQSESFLA+ ++TIQK+V+ LKG+D+I  G FWL NV
Sbjct: 1176 KEVLYPARIMIIVLSDMWRLGLTKQSESFLAEAMSTIQKLVSGLKGDDMICHGAFWLTNV 1235

Query: 1256 RELYSFVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYNIWXXXXXX 1315
            RELYSFVVFA  SIL ++++ +G+ ++EYKEY++LVTELKDDFE+LSYNIYNIW      
Sbjct: 1236 RELYSFVVFAQESILNDDSYNSGLNEDEYKEYMTLVTELKDDFESLSYNIYNIWLKKLQK 1295

Query: 1316 XXXXXAINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYWCMKSFHIE 1375
                 A++AVV+S+SLPGF A E+S FL K+F+ +  Y MDDILTFFN+IYW MK++H+E
Sbjct: 1296 DLEKKAVSAVVMSQSLPGFIANESSQFLPKLFSQSNYYKMDDILTFFNNIYWSMKTYHVE 1355

Query: 1376 NEVFHAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLTDGTEC 1435
             EVF  V+ TLL YVD+ICFN+LIM+RNFLSWKRGLQLNYNVTRLEEWCK+H + +GT+C
Sbjct: 1356 QEVFREVIITLLRYVDSICFNDLIMRRNFLSWKRGLQLNYNVTRLEEWCKSHHIPEGTDC 1415

Query: 1436 LQHLIQTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADYESPIPQEILRYV 1495
            LQH++Q +KLLQ++K  ++DIDI+  IC SL PAQ+QKLI+QY VADYE PIPQEIL +V
Sbjct: 1416 LQHMLQASKLLQLKKANLDDIDIIWEICSSLKPAQIQKLITQYAVADYEVPIPQEILTFV 1475

Query: 1496 ADIVKKEAALSSSGNDSKGHEHSSSIFITPETGPFTDPFSLIKTRKFDQVE 1546
            A+ VK E++LSS+G   K   HS  IF+  E GPF DPF+LI+TR+F ++E
Sbjct: 1476 ANRVKSESSLSSNG---KSQTHSIDIFLPVENGPFKDPFNLIETRRFGKIE 1523

>ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (MYO4)
            - SH] complement(1328357..1333033) [4677 bp, 1558 aa]
          Length = 1558

 Score = 2020 bits (5233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 987/1550 (63%), Positives = 1195/1550 (77%), Gaps = 30/1550 (1%)

Query: 1    MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSL 60
            MS+EVGTRCWYP KE GWIG E+ K+     KY L+L LE+ E+V +    +     + L
Sbjct: 1    MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVEEGSCEEL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILEATEDLTSLSYLNEPAVLHAIK RY+QLNIYTYSGIVLIATNPFDRVDQLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  TQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180
            +QDMIQAYAG+RRGELEPHLFAIAEEAY LMKN KQNQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVEEEN---SATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237
            FA+VE+ N   S    H +EMSETE+KILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF
Sbjct: 181  FATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240

Query: 238  DKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYM 297
            DKD SIIGARIRTYLLERSRLV+QPP ERNYHIFYQL+AGLP +TK+EL L    +Y YM
Sbjct: 241  DKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYM 300

Query: 298  NQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDAS 357
            NQGG ++I G+DD +EY IT  AL+LV IT+ TQ  +FK+LAALLHIGNI++KKTRNDAS
Sbjct: 301  NQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDAS 360

Query: 358  LSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYS 417
            +SA +P+L++ACELLGIDAYNFAKW+TKKQI TRSEKIVSNLNY QA+VA+DSVAKFIYS
Sbjct: 361  VSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIYS 420

Query: 418  ALFDWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477
            ALFDWLVENIN VLCNPAV ++I+SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 421  ALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480

Query: 478  QHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 537
            QHVFKLEQEEYVKEEI+WSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE+WTQK
Sbjct: 481  QHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK 540

Query: 538  LYQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAST 597
            LYQTLDK PTN VFSKPRFGQTKF+VSHYA DVAYDVEGFIEKNRDTVSDGHLEVLK ST
Sbjct: 541  LYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGST 600

Query: 598  NETLINIXXXXXXXXXXXXXXXXXXXXQAGSKKPGP-IRTVNRKPTLGSMFKQSLIELMN 656
            NETL+ I                        KKPGP  RTVNRKPTLGS+FKQSL+ELM+
Sbjct: 601  NETLLAILETIDRNAAKLAEKLE------SQKKPGPTTRTVNRKPTLGSLFKQSLVELMS 654

Query: 657  TINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVL 716
            TINSTNVHYIRCIKPN +KEAW+FDNLMVLSQLRACGVLETIRISCAGFP+RWT++EF L
Sbjct: 655  TINSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFAL 714

Query: 717  RYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYL 776
            RY+IL+P   W  IF    TTEE+I  + K ILD TV DK KYQ+GNTKIFFKAGMLA+L
Sbjct: 715  RYHILVPSTNWTKIFATG-TTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFL 773

Query: 777  EKLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCA 836
            EK R++K+++S  MIQKKI+  YYR++YL+I+ AIK   +  KG ++R R++ E K   A
Sbjct: 774  EKKRTDKLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAA 833

Query: 837  TLLQAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEP 896
              +Q+ YRG  IR +   +L +I   Q  +R+ L +++L+   E +AA+TIQ  +R F+P
Sbjct: 834  ITIQSLYRGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFKP 893

Query: 897  RSRFLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLAS 956
            R+ ++  ++ T+VVQSL+RRR A+RKL+ LK +AKSV+HLKEVSYKLENKVIELT++LA+
Sbjct: 894  RTSYITNRRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESLAA 953

Query: 957  KVKENKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQKSKDMELQKTIENNLQS 1016
            KVKENK++  RIKELQ+ + ESA ++E L+  ++E+   ID QK       + +   L  
Sbjct: 954  KVKENKDLNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTL 1013

Query: 1017 TEQTLKDAQLELEDMVKQHDXXXXXXXXXXXXXXXXXXXXVEYQTLNGDLQNEVKSLKEE 1076
              + + DA+ E++ +  + +                     + +T N DL NEV SLKEE
Sbjct: 1014 AMKEVDDARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEE 1073

Query: 1077 IARLQTAMSLGTVTTSVLPQTPLKDVMGGGASNFNNMMLENSDLSPNDLNLKSRSTPSSG 1136
            IARL  A+     T ++ P    +     G  N           SP   N+ S    ++G
Sbjct: 1074 IARLHNAIRNAPATGTLSPTRSKRISSYSGLDNIG---------SPKQWNVVSL---NNG 1121

Query: 1137 NNHIDSLSVDRENGVNATQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQLSKR 1196
                ++ S+  +     +QIN+ELY+LL D   L  EI EGLLK  ++P  G A  L+++
Sbjct: 1122 LMEEETRSIMSQ----LSQINDELYKLLNDDRPLTSEIVEGLLKSGKIPQPGFAANLTRK 1177

Query: 1197 DVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWLANVR 1256
            +V+YPAR+LII+LS+MWR GLT+QSE FLA+VL+TIQ +VT LKG+++I +G FWL NVR
Sbjct: 1178 EVLYPARVLIIILSDMWRLGLTEQSERFLAEVLSTIQTLVTNLKGDNVIINGAFWLTNVR 1237

Query: 1257 ELYSFVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYNIWXXXXXXX 1316
            ELYSF ++A +SIL +  +   + ++EYK+YV+LV+ LKDDFE+LSYNIYNIW       
Sbjct: 1238 ELYSFAIYAHDSILNDNAYIKDLNEDEYKQYVTLVSVLKDDFESLSYNIYNIWLKKLQKE 1297

Query: 1317 XXXXAINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYWCMKSFHIEN 1376
                A++AVV+S+SLPGF   E+S FL KIF+++  Y MDDILTFFN+IYW MK++H+E 
Sbjct: 1298 LEKRAVSAVVMSQSLPGFIVPESSAFLPKIFSSSSSYKMDDILTFFNTIYWSMKAYHVET 1357

Query: 1377 EVFHAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLTDGTECL 1436
            EV+  V+ +LL YVDAICFN+LIMKRNFLSWKRGLQLNYNVTRLEEWCK H + +G++CL
Sbjct: 1358 EVYREVIMSLLRYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKVHHIPEGSDCL 1417

Query: 1437 QHLIQTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADYESPIPQEILRYVA 1496
            +H++Q +KLLQ++K  +EDI+I+  IC SL PAQ+QKLISQY  ADYE PIPQEIL +VA
Sbjct: 1418 EHMLQASKLLQLKKANMEDINIIWEICSSLKPAQIQKLISQYSAADYEVPIPQEILSFVA 1477

Query: 1497 DIVKKEAALSSSGNDSKGHEHSSSIFITPETGPFTDPFSLIKTRKFDQVE 1546
            D VKKE+ALS   ND K   HSS IF+   TG F DPFS I+ R+ +++E
Sbjct: 1478 DRVKKESALS---NDGKSASHSSDIFLPVATGSFADPFSQIEPREINKIE 1524

>KLLA0A03905g complement(345818..350470) similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 myosin heavy chain,
            start by similarity
          Length = 1550

 Score = 1961 bits (5081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 967/1547 (62%), Positives = 1179/1547 (76%), Gaps = 28/1547 (1%)

Query: 1    MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSL 60
            M +EVGTRCWYP K+ GWIGAEV K+      Y+LEL LED + V +    L+  K+ SL
Sbjct: 1    MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLDETKEPSL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILE TEDLTSLSYLNEPAVLHAIK RY+QLNIYTYSGIVLIATNPFDRVDQLY
Sbjct: 61   PLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  TQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180
            +Q+MIQAYAGK RGELEPHLFAIAEEAYRLMK   QNQTI+VSGESGAGKTVSAKYIMRY
Sbjct: 121  SQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD 240
            FASVEE N     H +EMSETE+KILATNPIMEAFGNAKT RNDNSSRFGKYLEILFD D
Sbjct: 181  FASVEENNEENAHHNLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILFDDD 240

Query: 241  TSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQG 300
            TSIIGAR+RTYLLERSRLV+QP  ERNYHIFYQ+++GL    K +L LTD  DY YMNQG
Sbjct: 241  TSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYMNQG 300

Query: 301  GDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSA 360
            GD+ I G+DDA EY  TV+AL+LVGI+K+TQ Q+FKILAALLHIGNIE+KK RNDASLS+
Sbjct: 301  GDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDASLSS 360

Query: 361  DEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALF 420
            DEPNL++A +LLGIDA++FAKWVTKKQI+TRSEKIVS+L Y QA+V++DSVAKFIYSALF
Sbjct: 361  DEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYSALF 420

Query: 421  DWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480
            DWLV+NINTVLCNP V  +I +FIGVLDIYGFEHF+KNSFEQFCINYANEKLQQEFNQHV
Sbjct: 421  DWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFNQHV 480

Query: 481  FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ 540
            FKLEQEEYVKE+IEWSFIEFNDNQPCIDLIENK+GILSLLDEESRLPAG+DE WT KLY+
Sbjct: 481  FKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGWTHKLYE 540

Query: 541  TLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET 600
            TL+K PTN+VFSKPRFGQT+FIVSHYALDV YDV+GFIEKNRDTVSDGHLEVLKAS NET
Sbjct: 541  TLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASNNET 600

Query: 601  LINIXXXXXXXXXXXXXXXXXXXXQAGSKKPGPI-RTVNRKPTLGSMFKQSLIELMNTIN 659
            L++I                    Q   KKPGP  R + RKPTLGSMFKQSLI+LM TIN
Sbjct: 601  LLSI--LETVDKNAEKLAEKQAQKQESQKKPGPASRKIVRKPTLGSMFKQSLIDLMETIN 658

Query: 660  STNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYY 719
            STNVHYIRCIKPN DKEAW+FDNLMVLSQLRACGVLETIRISCAGFPSRWT+ EF LRY+
Sbjct: 659  STNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRYH 718

Query: 720  ILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKL 779
            IL+P E W  I    + +EED+ ++ K IL  T+ D +KYQ GNTKIFFKAGMLA+LEKL
Sbjct: 719  ILVPSELWSNIL-LSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHLEKL 777

Query: 780  RSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCATLL 839
            R++K+ +S VMIQKKI+  +YRK YL+   AIK LQ N+ G IIR R  +E K N A L+
Sbjct: 778  RTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNNAALLI 837

Query: 840  QAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEPRSR 899
            Q+AYRG S+R NV S++ +I  +Q   RK++  ++L +    +AAVTIQ  VR+F+PR  
Sbjct: 838  QSAYRGISVRDNVSSIIISIIRIQSMARKQITCKELLERRRGDAAVTIQKSVRSFQPRKS 897

Query: 900  FLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLASKVK 959
            FL  KK TVV+QS IR+  AQRKLKQLK++AKSVNHL+EVSYKLENKVIELT++LASKVK
Sbjct: 898  FLHEKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESLASKVK 957

Query: 960  ENKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQKSKDMELQKTIENNLQSTEQ 1019
            ENKE+  R++ LQ  + ES  ++ +LE  K+ H   + +QKS   E    + + L + ++
Sbjct: 958  ENKELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVNDQLIAAKE 1017

Query: 1020 TLKDAQLELEDMVKQHDXXXXXXXXXXXXXXXXXXXXVEYQTLNGDLQNEVKSLKEEIAR 1079
             +  A+ E+++++ +                      +  Q+ N DL+ EV SLKEE+AR
Sbjct: 1018 EIISAKAEVDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFSLKEEVAR 1077

Query: 1080 LQTAMSLGTVTTSVLPQTPLKDVMGGGASNFNNMMLENSDLSPNDLNLKSRSTPSSGNNH 1139
            LQ++M  G      +  TP+K+      S  N+        SP  LN+       S NN+
Sbjct: 1078 LQSSMRSGVYVGGGINATPVKNRRFSANSTLND------GSSPKQLNV------VSINNN 1125

Query: 1140 IDSLSVDRENGVNATQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQLSKRDVV 1199
             ++  V        +QIN+ELY++ ED+  LN EI EGLLKG +VP  GV++ L++++V+
Sbjct: 1126 FNTEDV----SALMSQINDELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTRKEVL 1181

Query: 1200 YPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWLANVRELY 1259
            YP+R+LII+LS+MWR GLT QSE+FLA+VL  IQK+++ LK + +I  G FW  NVREL+
Sbjct: 1182 YPSRVLIIILSDMWRLGLTSQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNVRELH 1241

Query: 1260 SFVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYNIWXXXXXXXXXX 1319
            SFVV+A  SI T+ET+ +GM +EEY  YV+LV ELKDDFEALS+N+YN+W          
Sbjct: 1242 SFVVYAYESITTDETYNSGMNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRKNLEK 1301

Query: 1320 XAINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYWCMKSFHIENEVF 1379
             A+ AVV+S+SLPGF   E S FL K   N+  Y MDD+LTFFN+IYW MKS+ IE EVF
Sbjct: 1302 IAVPAVVVSQSLPGFVVPEPSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKSYDIEMEVF 1361

Query: 1380 HAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLTDGTECLQHL 1439
              V+T LL  +DA+CFN+LI+++NFLSWKRGLQLNYNVTR+EEWCK+H +++ + CLQH+
Sbjct: 1362 EDVITNLLKLLDALCFNDLILRKNFLSWKRGLQLNYNVTRIEEWCKSHHISEVSVCLQHI 1421

Query: 1440 IQTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADYESPIPQEILRYVADIV 1499
            +Q AKLLQ++K  + DIDI+  IC  L P QL++LI+QY VADYE PI  EIL+YVA+ V
Sbjct: 1422 LQAAKLLQLKKRIVADIDIIWDICNCLKPIQLKQLITQYSVADYEEPIAPEILQYVAEKV 1481

Query: 1500 KKEAALSSSGNDSKGHEHSSSIFITPETGPFTDPFSLIKTRKFDQVE 1546
            K + + +  GN+         +F+  + GPF DP+  ++ R F ++E
Sbjct: 1482 KNDTSKAEVGNN--------DVFLPVDNGPFEDPYQKVEVRAFGKIE 1520

>Sklu_2164.5 YOR326W, Contig c2164 5497-9549
          Length = 1350

 Score = 1867 bits (4837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 924/1372 (67%), Positives = 1097/1372 (79%), Gaps = 23/1372 (1%)

Query: 1    MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSL 60
            MS+EVGTRCWYP K+ GWIG E+ K+     K+ LEL LED++IV ++++ L+  KD  L
Sbjct: 1    MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLDETKDDRL 60

Query: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120
            PLLRNPPILEATEDLTSLSYLNEPAVLHAIK RY+QLNIYTYSGIVLIATNPFDRV+QLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLY 120

Query: 121  TQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180
            +QDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASVEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKD 240
            FASVE+ N     H +EMSETE+KILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDK+
Sbjct: 181  FASVEQNNEENAHHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKE 240

Query: 241  TSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQG 300
             SIIGARIRTYLLERSRLV+QP  ERNYHIFYQL+AGL  + K +L LT   DY YMNQG
Sbjct: 241  ISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYMNQG 300

Query: 301  GDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSA 360
            G+ +I GIDDA+EY+ TV+AL+LVGI+K+TQ+Q+FKILAALLHIGN+EIKKTRNDASLS+
Sbjct: 301  GEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDASLSS 360

Query: 361  DEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALF 420
            DEPNL +ACELLGID++NFAKW+TKKQI TRSEKIVSNLNY+QALVA+DSVAKFIYSALF
Sbjct: 361  DEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYSALF 420

Query: 421  DWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480
            +WLV+NINTVLCNP V  +I+SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV
Sbjct: 421  EWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480

Query: 481  FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQ 540
            FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE+WTQKLYQ
Sbjct: 481  FKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQKLYQ 540

Query: 541  TLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNET 600
            TLDK PTN VFSKPRFGQTKF+VSHYALDV+YDVEGFIEKNRDTVSDGHLEVLKASTNET
Sbjct: 541  TLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKASTNET 600

Query: 601  LINIXXXXXXXXXXXXXXXXXXXXQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINS 660
            L++I                    +  +KKPGP R VNRKPTLGS+FKQSLIELM TINS
Sbjct: 601  LLSI------LETLDKHAAKLAEKEQVNKKPGPARMVNRKPTLGSIFKQSLIELMGTINS 654

Query: 661  TNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYI 720
            TNVHYIRCIKPN  KEAW FDNLMVLSQLRACGVLETIRISCAGFPSRWT+ EFVLRY+I
Sbjct: 655  TNVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHI 714

Query: 721  LIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKLR 780
            LIP E W  +F   +TTEEDI  + + IL A V+DK KYQ+GNTKIFFKAGMLAYLEKLR
Sbjct: 715  LIPSEHWSKMF-SSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLR 773

Query: 781  SNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCATLLQ 840
            S+++HNS V+IQKK++A YYRK+YL I  +I+   +  +GF+ RQ+V+ E K   A L+Q
Sbjct: 774  SDRLHNSSVLIQKKVKAVYYRKKYLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAAILIQ 833

Query: 841  AAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEPRSRF 900
            +  R  S R    S+L  IT LQ  +RK+L Q++L Q  + +AAV+IQ K+R FEPR  F
Sbjct: 834  SMVRSTSTRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEPRQSF 893

Query: 901  LRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLASKVKE 960
              T++ TVVVQSL+R++ AQ+KLK LK +AKSVNHLKEVSYKLENKVI+LT++LA KVKE
Sbjct: 894  NTTRRSTVVVQSLVRKKFAQKKLKDLKTEAKSVNHLKEVSYKLENKVIQLTESLAEKVKE 953

Query: 961  NKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQK-SKDMELQKTIENNLQSTEQ 1019
            NK MT RI+ELQ  + ESA ++E L + K EH   +  QK + D++  + ++  L + ++
Sbjct: 954  NKGMTARIQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNE-VQEKLVNAKK 1012

Query: 1020 TLKDAQLELEDMVKQHDXXXXXXXXXXXXXXXXXXXXVEYQTLNGDLQNEVKSLKEEIAR 1079
             +++A+ E+E ++ + D                     E+QT N DL+NEVKSLK+EIAR
Sbjct: 1013 EVEEAKEEIEQLIAKQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKDEIAR 1072

Query: 1080 LQTAMSLGTVTTSVLPQTPLKDVMGGGASNFNNMMLENSDLSPNDLNLKSRSTPSSGNNH 1139
            LQ A+  G  ++++             +S  +         SP  LN+ S    ++G   
Sbjct: 1073 LQAAVRSGVTSSTITSTPTASRRFSAHSSVADGT-------SPRQLNVISM---NNGGIE 1122

Query: 1140 IDSLSVDRENGVNATQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQLSKRDVV 1199
             D+    R      +QIN+ELY+LLEDT+ LN EI EGLLKGF++P+ GVA++L++++V+
Sbjct: 1123 DDA----RSTASALSQINDELYKLLEDTKSLNTEIVEGLLKGFKIPETGVAVELTRKEVL 1178

Query: 1200 YPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWLANVRELY 1259
            YPARILIIVLS+MWR GLTKQSESFLA+VL+TIQK+VT LKG+D+I  G FWL NVRELY
Sbjct: 1179 YPARILIIVLSDMWRLGLTKQSESFLAEVLSTIQKLVTNLKGDDMILHGAFWLTNVRELY 1238

Query: 1260 SFVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYNIWXXXXXXXXXX 1319
            SFVVFA  SIL ++++ NG+ ++EYKEYV+LVTELKDDFE+LSYNIYNIW          
Sbjct: 1239 SFVVFAQESILNDDSYNNGLNEDEYKEYVTLVTELKDDFESLSYNIYNIWLKKLQKDLER 1298

Query: 1320 XAINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYWCMKS 1371
             AI+AVV+S+SLPGF A E+S FL K+F+ +  Y MDDI+TFFN+IYW  ++
Sbjct: 1299 KAISAVVMSQSLPGFIAPESSPFLPKLFSQSSHYKMDDIVTFFNNIYWSRET 1350

>YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy chain,
            class V [4416 bp, 1471 aa]
          Length = 1471

 Score = 1378 bits (3567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 746/1512 (49%), Positives = 983/1512 (65%), Gaps = 102/1512 (6%)

Query: 1    MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQ-S 59
            MSFEVGT+CWYPHKE GWIG EV KN+F +G +HLEL+LED E VS++T    ND D  +
Sbjct: 1    MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPT 60

Query: 60   LPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQL 119
            LP+LRNPPILE+T+DLT+LSYLNEPAVLHAIK+RY    IYTYSGIVLIA NPFD+VD L
Sbjct: 61   LPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHL 120

Query: 120  YTQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMR 179
            Y+++MIQ Y+ KR+ ELEPHLFAIAEEAYR M ++K NQT+VVSGESGAGKTVSAKYIMR
Sbjct: 121  YSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMR 180

Query: 180  YFASVEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDK 239
            YFASV+E N+   + +VEMS+ E +ILATNPIMEAFGNAKTTRNDNSSRFGKYL+ILFD+
Sbjct: 181  YFASVQESNNR--EGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDE 238

Query: 240  DTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQ 299
            +T+I G++IRTYLLE+SRLVYQP  ERNYHIFYQ++ GLP   K+ELHL+   DY Y NQ
Sbjct: 239  NTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQ 298

Query: 300  GGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLS 359
            GG   I GID+A+EYKIT DAL+LVGI  ETQ  IFKILA LLHIGNIE+K TRNDASLS
Sbjct: 299  GGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLS 358

Query: 360  ADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSAL 419
            ++E NL++ACELLGID +NFAKW+ KKQI+TRSEKIV+NLNY+QAL+A+DSVAKFIYS L
Sbjct: 359  SEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTL 418

Query: 420  FDWLVENINTVLCNPAVN--DQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477
            FDWLV+NIN  L +P ++  D + SFIG+LDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 419  FDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFN 478

Query: 478  QHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 537
            QHVFKLEQEEYVKEEIEWSFIEF+DNQPCIDLIENKLGILSLLDEESRLP+GSDESW  K
Sbjct: 479  QHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESWASK 538

Query: 538  LYQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAST 597
            LY   +K P+N+VFSKPRFGQTKFIVSHYA+DV Y+VEGFIEKNRD+VS GHL+V KA+T
Sbjct: 539  LYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATT 598

Query: 598  NETLINIXXXXXXXXXXXXXXXXXXXXQAGSKKPG-PIRTVNRKPTLGSMFKQSLIELMN 656
            N     I                    Q   KK   P R   +KPTLGSMFK+SL ELM 
Sbjct: 599  NPIFKQI------LDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMA 652

Query: 657  TINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVL 716
             INSTNVHYIRCIKPN++K+ W+FDNLMVLSQLRACGVLETIRISCAGFPSRWTF+EFV 
Sbjct: 653  IINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQ 712

Query: 717  RYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYL 776
            RY++L  +  W  I    +  +E I++  + ILDAT+ D +KYQIGNTKIFFKAGMLA+L
Sbjct: 713  RYFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFL 772

Query: 777  EKLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCA 836
            EKLR+NKM+   ++IQKKIRA+YYR QYLQ  ++IK  Q+ I+  ++R RV+ E+K   A
Sbjct: 773  EKLRTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAA 832

Query: 837  TLLQAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEP 896
             LLQ   R    R    + +  I  LQ   +++L    + ++    AAV IQS +R++  
Sbjct: 833  ILLQTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGH 892

Query: 897  RSRFLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLAS 956
            ++ +   K+ +++VQS +R + A+R+   L+ + +  N        L  + IE   +   
Sbjct: 893  KTDYRTLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFKNSF-- 950

Query: 957  KVKENKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQKSKDMELQKTIENNLQS 1016
                       I  L++  +   +L + L+        D+ N  SK  +  +TI N    
Sbjct: 951  -----------ILNLEMLNDSYTRLTQLLQG-------DLSNIPSKQRQEYETIVNGYND 992

Query: 1017 TEQTLKDAQLELEDMVKQHDXXXXXXXXXXXXXXXXXXXXVEYQTLNGD----LQNEVKS 1072
                LK  Q+E+ + + + +                         + G+    L +EVKS
Sbjct: 993  KISKLKTLQVEIMNTLNKKNALKERKKKQSSLIQSHMQSLA---AIKGNKPSRLSDEVKS 1049

Query: 1073 LKEEIARLQTAMSLGTVTTSVLPQTPLKDVMGGGASNFNNMMLENSDLSPNDLNLKSRST 1132
            +K+E+A ++  ++    TT    +     V G G        +    + P  +N+     
Sbjct: 1050 MKQELAFIENVIAQDFTTTYSANKN--DKVKGLG--------IAGQQVKPKLVNV----- 1094

Query: 1133 PSSGNNHIDSLSVDRENGVNATQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQ 1192
                        + RE+G      N +L  LL D      E+TEG LK   V       +
Sbjct: 1095 ------------IRRESG------NPDLLELLMDLNCYTLEVTEGYLKKVNV------TE 1130

Query: 1193 LSKRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWL 1252
            ++  +V+ P  ++  V+S + R GL  QS  F+++VL T++ +V  L  ++ +  G+FWL
Sbjct: 1131 VNGDNVLGPIHVITTVVSSLVRNGLLIQSSKFISKVLLTVESIVMSLPKDETMLGGIFWL 1190

Query: 1253 ANVRELYSFVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYNIWXXX 1312
            +N+  L +F   A    L E    NG  DE+ K  +  + +L+++   +   IY+ W   
Sbjct: 1191 SNLSRLPAFA--ANQKTLYE---ANG-GDEKDKLTLIYLNDLENETLKVFDKIYSTWLVK 1244

Query: 1313 -XXXXXXXXAINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYWCMKS 1371
                      I  +V++E               K+F N+ +     + TF N     +  
Sbjct: 1245 FMKHASAHIEIFDMVLNE---------------KLFKNSGDEKFAKLFTFLNEFDAVLCK 1289

Query: 1372 FHIENEVFHAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLTD 1431
            F + + +   +    L Y++ + FN+LI K   L+WK G +++ N+ RL  W +   + D
Sbjct: 1290 FQVVDSMHTKIFNDTLKYLNVMLFNDLITKCPALNWKYGYEVDRNIERLVSWFEPR-IED 1348

Query: 1432 GTECLQHLIQTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADY-ESPIPQE 1490
                L  +IQ  K+LQ++   + +  +L    Y+L PAQ+Q ++ +Y+ A+  E+ +P E
Sbjct: 1349 VRPNLIQIIQAVKILQLKISNLNEFKLLFDFWYALNPAQIQAILLKYKPANKGEAGVPNE 1408

Query: 1491 ILRYVADIVKKE 1502
            IL Y+A+++K+E
Sbjct: 1409 ILNYLANVIKRE 1420

>Scas_592.13*
          Length = 1419

 Score = 1309 bits (3388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 632/979 (64%), Positives = 770/979 (78%), Gaps = 17/979 (1%)

Query: 1   MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDL--NN---D 55
           MSFEVGTRCWYP+ E GWIG EV KN+F DG YH+EL  E   ++ ++TK L  NN   +
Sbjct: 1   MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN 60

Query: 56  KDQSLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDR 115
             + LP+LRNPPILEAT DLT+LSYLNEPAVLHAIK+RY+Q NIYTYSGIVLIATNPFD+
Sbjct: 61  NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK 120

Query: 116 VDQLYTQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAK 175
           V++LY+ +MIQAYA K R E+ PH+FAIAEEAYR M N+ QNQTI+VSGESGAGKTVSAK
Sbjct: 121 VEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAK 180

Query: 176 YIMRYFASVEEEN---SATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKY 232
           YIMR+FASVEEE+       +HQ EMS+ E KILATNP+MEAFGNAKTTRNDNSSRFGKY
Sbjct: 181 YIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKY 240

Query: 233 LEILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDAS 292
           L+ILFD + +IIG+ I+TYLLERSRLV+QP  ERNYHIFYQ+++GL +  K++L+LT+A 
Sbjct: 241 LQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE 300

Query: 293 DYFYMNQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKT 352
           D+FY+NQGG++ INGIDD+ EY  T+++L+ VGI  E Q QIFKILAALLHIGNIEIKKT
Sbjct: 301 DFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKT 360

Query: 353 RNDASLSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVA 412
           R DA+LS+ +P+L+ ACELLG+D   F+KW+TKKQI TRSEKI+SNL+++QALVA+DSVA
Sbjct: 361 RTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVA 420

Query: 413 KFIYSALFDWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKL 472
           KFIYS+LFDWLV NIN VLC   V++ I+SFIGVLDIYGFEHFE+NSFEQFCINYANEKL
Sbjct: 421 KFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKL 480

Query: 473 QQEFNQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE 532
           QQEFN HVFKLEQEEYVKEEIEWSFIEF+DNQPCIDLIENKLGILSLLDEESRLPAGSDE
Sbjct: 481 QQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSDE 540

Query: 533 SWTQKLYQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEV 592
           SWT KLYQT +K P+N VF KPRFGQ KFI+SHYA+DV Y+V+GFIEKN+DT+S+  LEV
Sbjct: 541 SWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEV 600

Query: 593 LKASTNETLINIXXXXXXXXXXXXXXXXXXXXQAGSKKPGPIRTVNRKPTLGSMFKQSLI 652
           LKA+TN TL  I                    QAG+ +    +T+NRKPTLGS+FK+SL+
Sbjct: 601 LKATTNPTLATI------FEFSEAENKTNITEQAGTIQR---KTINRKPTLGSIFKRSLV 651

Query: 653 ELMNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFE 712
           ELM TINSTNVHYIRCIKPN +KEAW+FDNLMVLSQLRACGVLETI+ISCAGFPSRW FE
Sbjct: 652 ELMETINSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFE 711

Query: 713 EFVLRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGM 772
           EF+ RYY+L P +QW  +    E + ED+++   +IL   +  K KYQIG TKIFFKAG+
Sbjct: 712 EFIQRYYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGV 771

Query: 773 LAYLEKLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMK 832
           LAYLEK+RS+K+    V+IQK IRAKYYR  YLQ   +IK  Q+ I+G   RQRV+ EMK
Sbjct: 772 LAYLEKIRSDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMK 831

Query: 833 VNCATLLQAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVR 892
            + ATLLQ  +R   +R+ VF  L+ I  +Q  IR+ L    +++E E  +A+ IQSK+R
Sbjct: 832 TDAATLLQTLHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIR 891

Query: 893 TFEPRSRFLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQ 952
              P+ R+   K  T+++Q+L+RR+ +Q KLKQLK  A+S   LK  +  ++ ++I   +
Sbjct: 892 ANSPKHRYQTLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGFIE 951

Query: 953 NLASKVKENKEMTERIKEL 971
            L S +KEN   T   K L
Sbjct: 952 ELISNIKENDAKTTEYKSL 970

 Score =  117 bits (292), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 76/321 (23%), Positives = 151/321 (47%), Gaps = 68/321 (21%)

Query: 1182 FEVPDAGVAIQLSKRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKG 1241
            F++P  G   +    +  YP ++LI +++ M +FGL K S S L Q +  +   ++ +  
Sbjct: 1106 FQIPQRG---RTKDCEHFYPVKLLISIVNLMNKFGLRKSSHSILKQTVQDLIGKISSMDA 1162

Query: 1242 NDLIPSGVFWLANVRELYSFVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEAL 1301
               +  G++W+ ++ +        L+S+  E    N + D+ YK      T LK  F  +
Sbjct: 1163 KKCVTFGLYWIISLHK--------LSSLPQEPAVLNKLQDKFYK------TWLKQCFNQM 1208

Query: 1302 SYNIYNIWXXXXXXXXXXXAINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTF 1361
                                +++++I                  +F    E+T+     F
Sbjct: 1209 K------------------TVDSILI------------------LFDTISEFTL-----F 1227

Query: 1362 FNSIYWCMKSFHIENEVFHAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLE 1421
            F              E+   ++T LL +++A  FN+L++K+N LSW  GL+ +  + ++ 
Sbjct: 1228 FQGT----------TELLTNIITALLQHINAKWFNDLLIKQNTLSWTHGLEKDSEIKKVL 1277

Query: 1422 EWCKTHGLTDGTECLQHLIQTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVA 1481
            +WC +H + + TE L+++ Q  KLLQ+R   I D  ++   CY L+  Q+  L+++Y+  
Sbjct: 1278 DWCNSHKIRNSTEYLRNVNQACKLLQLRISNISDFQLVCEFCYDLSSLQMHALLTKYRPT 1337

Query: 1482 DYESPIPQEILRYVADIVKKE 1502
             +E PIP ++L ++++  ++E
Sbjct: 1338 QFEKPIPVDVLNHLSNTARRE 1358

>CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces
           cerevisiae YAL029c MYO4 or sp|P19524 Saccharomyces
           cerevisiae YOR326w MYO2, start by similarity
          Length = 1418

 Score = 1123 bits (2906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/973 (58%), Positives = 720/973 (73%), Gaps = 23/973 (2%)

Query: 1   MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLN-----ND 55
           M+FEVGTRCWYP  E GWI  EV KNE  DGKYHL+  LED  ++ +DT  ++     ++
Sbjct: 1   MTFEVGTRCWYP-SENGWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLSN 59

Query: 56  KDQSLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDR 115
           +   +P+LRNP   E+T+DLT+LSYLNEPAVLHAIK RY    IYTYSGIVL+ATNPF +
Sbjct: 60  EGSPMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFAQ 119

Query: 116 VDQLYTQDMIQAYAG-KRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSA 174
           +++LY+ DMI+ Y+    R EL+PHLFAIA +AY  M +  +NQTIVVSGESGAGKTVSA
Sbjct: 120 MEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVSA 179

Query: 175 KYIMRYFASVEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLE 234
           KYIMRYFAS+++ N+A V    EMS+ E+KILATNPIMEAFGNAKT RNDNSSRFGKYL+
Sbjct: 180 KYIMRYFASLDDNNAAVVS---EMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLQ 236

Query: 235 ILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDY 294
           I+FD   +IIGA+IRTYLLERSRLV+Q   ERNYHIFYQL+AGLPA  KEEL +++   +
Sbjct: 237 IMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNPEQF 296

Query: 295 FYMNQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRN 354
           +Y+NQG D +I+G+DDA+E++ T+ AL+++GI    Q ++FKILA LLHIGNIEIK++  
Sbjct: 297 YYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQSST 356

Query: 355 DASLSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKF 414
            +S+S DEPNLKLACELLG+D Y F+KW+TKK+I TRSEKIV+NL   QALV +DSV+KF
Sbjct: 357 SSSISPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSVSKF 416

Query: 415 IYSALFDWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQ 474
           IYS LFDWLV  INT+L    V+DQ+ SFIGVLDIYGFEHFE NSFEQFCINYANEKLQQ
Sbjct: 417 IYSLLFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEKLQQ 476

Query: 475 EFNQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESW 534
           EFNQHVFKLEQEEYV+E+IEWSFIEFNDNQPCIDLIEN+LGILSLLDEESRLP+G+DESW
Sbjct: 477 EFNQHVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGTDESW 536

Query: 535 TQKLYQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLK 594
           TQKLYQTLDK P N+VFSKP+FGQTKF++SHYA +V YDVEGFIEKNRDTVS+  + VLK
Sbjct: 537 TQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMNVLK 596

Query: 595 ASTNETLINIXXXXXXXXXXXXXXXXXXXXQAGSKKPGPIRTVNRKPTLGSMFKQSLIEL 654
            S N+TLI++                     A   +P   + +N+KPTLG MFK+SL EL
Sbjct: 597 NSQNDTLISLTKPTEETSTPPPQT-------ASISRP---KLINKKPTLGFMFKKSLGEL 646

Query: 655 MNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEF 714
           M  IN+TNVHYIRC+KPN+ K AW+FD+ MVLSQLRACG+LETI+ISCAGFPSRW+F+EF
Sbjct: 647 MEIINNTNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEF 706

Query: 715 VLRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLA 774
           + RYY+L+    W  +    E+  E  I   K IL AT     K QIG TKIFFK+G+LA
Sbjct: 707 IDRYYMLVDTTLWSDV-ASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLA 765

Query: 775 YLEKLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVN 834
            LE LR  KM    + IQKKIRA   R  YL+I   ++ LQN I+  ++R  V  ++K  
Sbjct: 766 ELESLRLKKMKGIAITIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEHQLKTK 825

Query: 835 CATLLQAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTF 894
            A ++QA  R + +R  V   L  I  LQ K R  L QR L++     A++ IQS +R +
Sbjct: 826 LALMMQATLRSYRVRIRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQSYIRGY 885

Query: 895 EPRSRFLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSY-KLENKVIELTQN 953
           + ++++   +K+   +Q+L R   A+  + +L+++++ V  +  V+Y +L + V ++  +
Sbjct: 886 KHKTQYRYFRKNYQAIQALSRSMLARSLMLKLRSESE-VTQINGVTYTELHSIVKDIHDS 944

Query: 954 LASKVKENKEMTE 966
           + S  +  KE+ E
Sbjct: 945 MTSNNQIIKELDE 957

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 76/143 (53%)

Query: 1369 MKSFHIENEVFHAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTHG 1428
            M +  IE  +F  ++ TL+ Y++    N +++K   + ++ G+ L  N+  L E+C+   
Sbjct: 1234 MGTSAIEKSLFGKLIETLIQYLNLNVANHVLIKIPSVDFETGIILEKNLDTLLEYCEELK 1293

Query: 1429 LTDGTECLQHLIQTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADYESPIP 1488
            L++     +   Q +KLLQ+   ++E++ ++   C++L   Q+  L+++ + +  E P+P
Sbjct: 1294 LSNCRNSTRQTSQMSKLLQLSISSVEELRVVCQYCFALNLTQIHALLAKQKASSDEKPMP 1353

Query: 1489 QEILRYVADIVKKEAALSSSGND 1511
              +++ V    ++    +S  +D
Sbjct: 1354 YIVVKKVQSWAQETKKDTSKNSD 1376

>Scas_688.22
          Length = 1876

 Score =  522 bits (1345), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 294/755 (38%), Positives = 452/755 (59%), Gaps = 61/755 (8%)

Query: 65  NPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDM 124
           NP   +  ++++ L++LNE +VLH +++RY    IYTYSG+ L+A NP+  + ++YTQ+ 
Sbjct: 62  NPTSFDKVDNMSELTHLNEASVLHNLEKRYKDDMIYTYSGLFLVAINPYCNI-KIYTQEY 120

Query: 125 IQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASV 184
           I  Y G  + + +PH++AIAEEAY+ +  +KQ+Q+++V+GESGAGKT + K I++Y AS+
Sbjct: 121 INLYNGSSKEDNKPHIYAIAEEAYQKLLTEKQDQSVLVTGESGAGKTENTKKILQYLASI 180

Query: 185 EEENSATVQHQVEMSET----------EQKILATNPIMEAFGNAKTTRNDNSSRFGKYLE 234
               S   +  + +S+           E KIL +NPI+E+FGNA+T RN+NSSRFGK+++
Sbjct: 181 TSNKSKYSEADLLVSQNDNEINQFESFEMKILQSNPILESFGNAQTVRNNNSSRFGKFIK 240

Query: 235 ILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLT--DAS 292
           I FD+   I GA I  YLLE+SR++ Q P ERNYHIFYQL+AGL  Q   +L LT    S
Sbjct: 241 IEFDERGKINGAHIEWYLLEKSRVINQHPEERNYHIFYQLLAGLSLQELRKLELTSKSVS 300

Query: 293 DYFYMNQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKT 352
           DY Y+++   + I G++DA++++  + A T VG T E  + I+++L+ +LHIGN++    
Sbjct: 301 DYKYLSKSNPS-IPGVNDAQDFQDLLKAFTTVGFTHEEVNNIWQVLSIILHIGNVDFTSE 359

Query: 353 RNDASLSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVA 412
           ++  +   ++P+     +LLG+    F   V   +     E +  + N SQA    +S++
Sbjct: 360 KSQQATFKNDPS--TLAKLLGVTEKEFTTAVLTPKTKAGKEWVTQSKNASQARFILNSLS 417

Query: 413 KFIYSALFDWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKL 472
           + +Y  LF ++VE IN  L + ++    +++IG+LDI GFE F+ NSFEQ CINY NEKL
Sbjct: 418 RTLYEKLFSFIVERINNSLDHSSM---TANYIGLLDIAGFEIFKHNSFEQLCINYTNEKL 474

Query: 473 QQEFNQHVFKLEQEEYVKEEIEWSFIEFN-DNQPCIDLIENK---LGILSLLDEESRLPA 528
           QQ FN H+F LEQ EY+KE I+W+F++F  D Q  IDLIENK    G+L LLDEES LP 
Sbjct: 475 QQFFNHHMFVLEQNEYMKENIQWNFVDFGKDLQASIDLIENKSSPTGVLPLLDEESILPN 534

Query: 529 GSDESWTQKLYQTLD-KSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSD 587
            SD+S+  KL  T D KSP    F + +  Q  F++ HYA +V Y++EG++ KN+D +S+
Sbjct: 535 SSDDSFFSKLISTWDQKSPK---FIRSKLPQC-FVLKHYAGEVEYNIEGWLSKNKDPLSE 590

Query: 588 GHLEVLKASTNETLINIXXXXXXXXXXXXXXXXXXXXQAGSKKPGPIRTVNRKPTLGSMF 647
             + +L +STNE + +                          +    RT + +     M 
Sbjct: 591 CMISMLSSSTNEIVTSFFNESNKNV-----------------RGSSFRTASARHREQQML 633

Query: 648 KQSLIELMNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPS 707
                 L+  + +T+ H++RCI PN  K+A  FD  ++L QLR  GVLE IRI+  G+P+
Sbjct: 634 ------LLKQLETTHPHFVRCIIPNNRKKAKDFDRKLILDQLRCNGVLEGIRIAREGYPN 687

Query: 708 RWTFEEFVLRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIF 767
           R  F+EF  RY +L     +   FKK            +++L +   D S Y+IG +K+F
Sbjct: 688 RIFFKEFFQRYRLLSDENHFATGFKKN----------CEILLSSLHLDPSLYKIGTSKLF 737

Query: 768 FKAGMLAYLEKLRSNKMHNSIVMIQKKIRAKYYRK 802
           FKAG+LA LE  +  ++ + ++     +R +  RK
Sbjct: 738 FKAGVLAELETKKDQRIRSIVIRFNSHLRGRIIRK 772

>ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH]
           complement(480141..485558) [5418 bp, 1805 aa]
          Length = 1805

 Score =  510 bits (1314), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 300/783 (38%), Positives = 450/783 (57%), Gaps = 75/783 (9%)

Query: 43  EIVSVDTKDLNNDKDQSLPLLR----------------NPPILEATEDLTSLSYLNEPAV 86
           ++VS  T     +KD+ + L+R                NP   +  +D++ L++LNE +V
Sbjct: 21  QLVSTKTIKNKQNKDEKVCLVRVNGKEREVLEVETAAVNPSTFDKIDDMSELTHLNEASV 80

Query: 87  LHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAGKRRGELEPHLFAIAEE 146
           L+ ++ RY    IYTYSG+ L+A NP+  + ++YTQD +  Y G  + + EPH+FA+AE+
Sbjct: 81  LYNLENRYKDDMIYTYSGLFLVALNPYSNI-KVYTQDYVNLYHGSPKEDNEPHIFAVAEQ 139

Query: 147 AYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSATVQHQVEMSETEQKIL 206
           AYR +   +Q+Q+++V+GESGAGKT + K I++Y AS+  +          +   E+KIL
Sbjct: 140 AYRNLLTQRQDQSVLVTGESGAGKTENTKKILQYLASITSDEKLA---HTNLESFERKIL 196

Query: 207 ATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRTYLLERSRLVYQPPIER 266
             NPI+E+FGNA+T RN+NSSRFGK+++I FD+   I GA I  YLLE+SR++ Q   ER
Sbjct: 197 QANPILESFGNAQTVRNNNSSRFGKFIKIEFDEFGKINGAHIEWYLLEKSRIIQQNIRER 256

Query: 267 NYHIFYQLMAGLPAQTKEELHLTDAS--DYFYMNQGGDTKINGIDDAKEYKITVDALTLV 324
           NYH+FYQL++G+PA   + L L   S  DY Y+ +  +  I G+DDA ++   + A  +V
Sbjct: 257 NYHVFYQLLSGMPAGKLKTLELVSNSITDYAYL-RDSNPSIPGVDDAHDFSSLLSAFNVV 315

Query: 325 GITKETQHQIFKILAALLHIGNIEIKKTRND-ASLSADEPNLKLACELLGIDAYNFAKWV 383
           G  ++  H IF+ +A +LHIGN+E   TR + A++  D   L   C+L+G+D   F   V
Sbjct: 316 GFKEDEIHDIFQCIAIILHIGNVEFTSTRAEQATIKNDVAPL---CKLIGVDEAAFKMAV 372

Query: 384 TKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVENINTVLCNPAVNDQISSF 443
            K +     E +  + N +Q+    +S+++ +Y  LF  +V  IN  L + ++ +   ++
Sbjct: 373 LKPKSKAGKEWVSQSKNAAQSRFILNSLSRSLYEKLFAHIVRRINRSLDHGSMTE---NY 429

Query: 444 IGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFN-D 502
           IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H+F LEQ EYVKE+I+W FI++  D
Sbjct: 430 IGLLDIAGFEIFKDNSFEQLCINYTNEKLQQFFNHHMFVLEQREYVKEDIQWDFIDYGKD 489

Query: 503 NQPCIDLIE---NKLGILSLLDEESRLPAGSDESWTQKLYQTLD-KSPTNKVFSKPRFGQ 558
            +  I+LIE   N  GILS+LDEES LP  +DES+  KL    D KSP    F + +  Q
Sbjct: 490 LEYTIELIEKKNNPAGILSILDEESILPKSTDESFYSKLMSAWDGKSPK---FKRSKLQQ 546

Query: 559 TKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLINIXXXXXXXXXXXXXX 618
             F++ HYA DV Y+V+ ++ KN+D ++D  L +L  S+N+ +                 
Sbjct: 547 C-FVLEHYAADVEYNVKDWLSKNKDPLNDHLLTLLSESSNKLISEFYT------------ 593

Query: 619 XXXXXXQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINSTNVHYIRCIKPNADKEAW 678
                     +  G         T  +  K+ L  L++ ++ST+ H++RCI PN  K+A 
Sbjct: 594 ---------EQSRGHF-----SKTASNRHKEQLTLLLDQLSSTDPHFVRCIVPNTKKKAK 639

Query: 679 QFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILIPHEQWDLIFKKKETTE 738
            FD  ++L QLR  GVLE IRI+  G+P+R  F EF  RY IL    ++    KK     
Sbjct: 640 TFDRKLILDQLRCNGVLEGIRIAREGYPNRIFFREFFQRYKILGADPKFSNNSKKN---- 695

Query: 739 EDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKLRSNKMHNSIVMIQKKIRAK 798
                  + +L     D S Y++GNTK+FFKAG+LA LE  +  K+   +  +   I  K
Sbjct: 696 ------CEYLLSCISLDPSLYKVGNTKLFFKAGVLAQLETQKEEKISGIVTGLNAIIHGK 749

Query: 799 YYR 801
             R
Sbjct: 750 TVR 752

>YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain
           (myosin II), coiled-coil protein involved in septation
           and cell wall organization [5787 bp, 1928 aa]
          Length = 1928

 Score =  496 bits (1276), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 310/829 (37%), Positives = 469/829 (56%), Gaps = 62/829 (7%)

Query: 9   CWYPHKELGWIGAEVIKNEFNDGKY----------HLELQLEDDEIVSVDTKDLNNDKDQ 58
            W P ++  ++  E++  + N  K+          H     E   +V V   D+      
Sbjct: 13  VWIPDEKEVFVKGELMSTDINKNKFTGQEEQIGIVHPLDSTEVSNLVQVRISDV------ 66

Query: 59  SLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQ 118
             P+  NP   +  E+++ L++LNEP+VL+ +++RY    IYTYSG+ L+A NP+  ++ 
Sbjct: 67  -FPV--NPSTFDKVENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNLN- 122

Query: 119 LYTQDMIQAYAGKR------------RGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGES 166
           LY++D I  Y  K               +L PH+FAIAEEAY  + ++ ++Q+I+V+GES
Sbjct: 123 LYSEDHINLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGES 182

Query: 167 GAGKTVSAKYIMRYFASV---EEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRN 223
           GAGKT + K I++Y AS+      N A V     +   E KIL +NPI+E+FGNA+T RN
Sbjct: 183 GAGKTENTKKILQYLASITSGSPSNIAPVSGSSIVESFEMKILQSNPILESFGNAQTVRN 242

Query: 224 DNSSRFGKYLEILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTK 283
           +NSSRFGK+++I F++   I GA I  YLLE+SR+V+Q   ERNYHIFYQL++GL     
Sbjct: 243 NNSSRFGKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSEL 302

Query: 284 EELHLT--DASDYFYMNQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAAL 341
           + L L   +  DY  ++      I GI+D + +K  + AL ++G +K+    IF+++A +
Sbjct: 303 KNLRLKSRNVKDYKILSNSNQDIIPGINDVENFKELLSALNIIGFSKDQIRWIFQVVAII 362

Query: 342 LHIGNIEIKKTRND-ASLSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLN 400
           L IGNIE    R + AS   D   +   C  LG+D  +F   + + +     E +  + N
Sbjct: 363 LLIGNIEFVSDRAEQASFKND---VSAICSNLGVDEKDFQTAILRPRSKAGKEWVSQSKN 419

Query: 401 YSQALVAKDSVAKFIYSALFDWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSF 460
             QA    +++++ +Y  LF ++V+ IN  L + +      ++IG+LDI GFE FE NSF
Sbjct: 420 SQQAKFILNALSRNLYERLFGYIVDMINKNLDHGSA---TLNYIGLLDIAGFEIFENNSF 476

Query: 461 EQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFN-DNQPCIDLIENK---LGI 516
           EQ CINY NEKLQQ FN H+F LEQ EY+KE I+W +I++  D Q  IDLIE+K    G+
Sbjct: 477 EQLCINYTNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGV 536

Query: 517 LSLLDEESRLPAGSDESWTQKLYQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEG 576
           L LLDEE+ LP  +DES+  KL  T D++ +   F + R  +  FI+ HYA DV Y VEG
Sbjct: 537 LPLLDEEAVLPKSTDESFYSKLISTWDQNSSK--FKRSRL-KNGFILKHYAGDVEYTVEG 593

Query: 577 FIEKNRDTVSDGHLEVLKASTNETLINIXXXXXXXXXXXXXXXXXXXXQAGSKKPGPIRT 636
           ++ KN+D ++D  L +L +S N+ +  +                    +   KK     T
Sbjct: 594 WLSKNKDPLNDNLLSLLSSSQNDIISKLFQPEGEKSSSAGVEANISNQEV--KKSARTST 651

Query: 637 VNRKPTLGSMFKQSLIELMNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLE 696
                T  S  ++  I L+N + ST+ H++RCI PN  K+   F+  ++L QLR  GVLE
Sbjct: 652 F---KTTSSRHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLE 708

Query: 697 TIRISCAGFPSRWTFEEFVLRYYILIPHEQWDLIF--KKKETTEEDIISVVKMILDATVK 754
            IR++  G+P+R  F+EF  RY IL P       F  K K +T+++     + +L +   
Sbjct: 709 GIRLAREGYPNRIAFQEFFQRYRILYPENSTTTTFSSKLKASTKQN----CEFLLTSLQL 764

Query: 755 DKSKYQIGNTKIFFKAGMLAYLEKLRSNKMHNSIVMIQKKIRAKYYRKQ 803
           D   Y+IGNTK+FFKAG+LA LEK +  K++N ++ +   IR    RK+
Sbjct: 765 DTKVYKIGNTKLFFKAGVLADLEKQKDVKLNNIMIKLTATIRGYTVRKE 813

>KLLA0E11572g complement(1018972..1024518) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1 myosin-1 isoform
           (type II myosin) heavy chain, start by similarity
          Length = 1848

 Score =  494 bits (1272), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 303/787 (38%), Positives = 456/787 (57%), Gaps = 70/787 (8%)

Query: 44  IVSVDTKDLNNDKDQSLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYS 103
           +VSV+ K+    +D    +  NP   +  +DL+ L++LNE +VL  ++ RY    IYTYS
Sbjct: 40  VVSVNGKETEFSEDDVASV--NPSTFDKVDDLSELTHLNEASVLFNLQNRYQDDLIYTYS 97

Query: 104 GIVLIATNPFDRVDQLYTQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVS 163
           G+ L+A NP+  + ++Y+   I+ Y G  + + +PH+FA+AE+AY+ + + KQ+Q+I+V+
Sbjct: 98  GLFLVAINPYSNI-KIYSNSYIKLYHGSPKEDNKPHIFAVAEQAYQNLLHQKQDQSILVT 156

Query: 164 GESGAGKTVSAKYIMRYFASVEEENSATVQHQVEMSET----EQKILATNPIMEAFGNAK 219
           GESGAGKT + K I++Y AS+      T   ++ +++T    E+KIL +NPI+E+FGNA+
Sbjct: 157 GESGAGKTENTKKILQYLASI------TTDDKILLNQTNESFERKILQSNPILESFGNAQ 210

Query: 220 TTRNDNSSRFGKYLEILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLP 279
           T RN+NSSRFGK+++I FD+   I GA I  YLLE+SR++     ERNYHIFYQ+++G+ 
Sbjct: 211 TVRNNNSSRFGKFIKIDFDEYGKINGAHIEWYLLEKSRVIQAHARERNYHIFYQILSGMS 270

Query: 280 AQTKEELHLTDAS--DYFYMNQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKI 337
            Q    + L   S  DY Y+     + I GIDD + Y+  V A   VG TK+    I K 
Sbjct: 271 KQELRAIGLESNSIVDYQYLRHSNPS-IPGIDDGQNYQELVSAFETVGFTKDDIQSILKC 329

Query: 338 LAALLHIGNIEIKKTRND-ASLSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIV 396
           ++ +LHIGN+E    R++ AS+  D   +K  C+LLG+   +F   V K +     E + 
Sbjct: 330 ISIILHIGNVEFVSERSEQASIKND---IKPLCKLLGVQEDDFKSAVLKPKSKAGKEWVS 386

Query: 397 SNLNYSQALVAKDSVAKFIYSALFDWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFE 456
              N SQA    +S+++ +Y  LF+++V  IN  L + ++ +    FIG+LDI GFE F+
Sbjct: 387 QAKNASQARSILNSLSRSLYEKLFEYIVNQINKSLEHGSMTE---YFIGLLDIAGFEIFK 443

Query: 457 KNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFN-DNQPCIDLIENK-- 513
            NSFEQ CINY NEKLQQ FN H+F LEQ EY KE+I+W+FI++  D Q  IDLIE K  
Sbjct: 444 DNSFEQLCINYTNEKLQQFFNHHMFVLEQNEYQKEDIQWNFIDYGKDLQTTIDLIEQKNS 503

Query: 514 --LGILSLLDEESRLPAGSDESWTQKLYQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVA 571
              GIL +L+EES LP  SD S+  KL  + D   T   F + +     FI+ HYA DV 
Sbjct: 504 SIPGILPILEEESILPKSSDASFYSKLLSSWDNKSTK--FKRSKLDNC-FILKHYAGDVE 560

Query: 572 YDVEGFIEKNRDTVSDGHLEVLKASTNETLINIXXXXXXXXXXXXXXXXXXXXQAGSKKP 631
           Y+V  ++ KN+D +++  L+VL    N  +                        A   + 
Sbjct: 561 YNVTDWLSKNKDPLNENLLQVLNDCANPLVSQFF--------------------ADRIRG 600

Query: 632 GPIRTVNRKPTLGSMFKQSLIELMNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRA 691
              RT + K       ++ L  L+  + +T+ H++RCI PN  K+A  FD  ++L QLR 
Sbjct: 601 SSFRTSSNK------HREQLHTLIEQLGNTDPHFVRCIIPNNKKKAGDFDKKLILDQLRC 654

Query: 692 CGVLETIRISCAGFPSRWTFEEFVLRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDA 751
            GVLE IRI+  G+P+R  F+EF  RY IL   ++       K+  E   I +  + LD 
Sbjct: 655 NGVLEGIRIARDGYPNRIFFKEFFQRYKIL--SDECRFTNNSKKNCE---ILLSSLHLDP 709

Query: 752 TVKDKSKYQIGNTKIFFKAGMLAYLEKLRSNKMHNSIVMIQKKIRAKYYRKQ---YLQIS 808
           T+     Y++GNTK+FFKAG+LA LE L+  ++  ++  +   I A   RK+   +L+  
Sbjct: 710 TI-----YKVGNTKLFFKAGVLANLELLKEQRLSAAVTRLNAIISANSVRKEIRSHLKKL 764

Query: 809 QAIKYLQ 815
           QA + L+
Sbjct: 765 QAARILK 771

>Kwal_23.5534
          Length = 1907

 Score =  493 bits (1269), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 298/824 (36%), Positives = 471/824 (57%), Gaps = 83/824 (10%)

Query: 9   CWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSLPLLR---- 64
            W P  E  ++ A+++     D K     Q +D++ V V      N ++Q +        
Sbjct: 4   VWIPDAEQVFVRAQLV-----DEKTVRNKQNKDEKWVVVRV----NGREQEVAFEEVYAV 54

Query: 65  NPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDM 124
           NP   +  +D++ L++LNEP+VLH ++ RY+  NIYTYSG+ L+A NP+  + ++Y+QD 
Sbjct: 55  NPSTFDRIDDMSELTHLNEPSVLHNLENRYADDNIYTYSGLFLVAINPYSNI-RIYSQDY 113

Query: 125 IQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASV 184
           +  Y G  + + +PH+FAIAEEAY+ + +++++Q+I+V+GESGAGKT + K I++Y AS+
Sbjct: 114 VNLYHGSPKEDNKPHIFAIAEEAYQNLLSERRDQSILVTGESGAGKTENTKKILQYLASI 173

Query: 185 EEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSII 244
             ++  +     E    E+KIL +NPI+E+FGNA+T RN+NSSRFGK+++I FD+   I 
Sbjct: 174 TSDDKLSPDTSQES--FERKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFDELGKIN 231

Query: 245 GARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDAS--DYFYMNQGGD 302
           GA +  YLLE+SR++ Q   ERNYHIFYQ+++G+ AQ      L   S  DY Y+ +  +
Sbjct: 232 GAHVDWYLLEKSRVIQQNSRERNYHIFYQMLSGMSAQELRRYGLETNSIKDYGYL-RNSN 290

Query: 303 TKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSADE 362
             I G+DD+++++  + +  +VG +++    +   ++ +LHIGNIE    R  A  ++ +
Sbjct: 291 PSIPGVDDSQDFRTLLSSFQIVGFSEDEIQSMLTCISIILHIGNIEFVSER--AEQASFD 348

Query: 363 PNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALFDW 422
            +++  C LLG+   +F   V K +     + +    N  QA    +S+++ +Y  LF  
Sbjct: 349 GSVETLCNLLGVTEADFKVAVLKPRAKAGKDWVSQAKNAHQARFILNSLSRSLYENLFAH 408

Query: 423 LVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFK 482
           +V+ IN  L + ++ +   ++IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H+F 
Sbjct: 409 IVQRINNNLDHGSMTE---NYIGLLDIAGFEIFKHNSFEQLCINYTNEKLQQFFNHHMFV 465

Query: 483 LEQEEYVKEEIEWSFIEFN-DNQPCIDLIEN---KLGILSLLDEESRLPAGSDESWTQKL 538
           LEQ EY+KE ++W+FI++  D Q  IDLIE    K GIL LLDEES LP  +DES+  KL
Sbjct: 466 LEQNEYLKENVQWNFIDYGKDLQSTIDLIERKDTKPGILPLLDEESILPKSTDESFYSKL 525

Query: 539 YQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTN 598
            +T           K    Q  F++ HYA DV Y+V+G++ KN+D + +  L++L  S+N
Sbjct: 526 -ETF--YSDKSSKFKRSKKQRCFVLKHYAGDVEYNVDGWLSKNKDPLHENLLQMLSNSSN 582

Query: 599 ETLINIXXXXXXXXXXXXXXXXXXXXQAGSKKPGPIRTVNRKPTLGSMFKQSLIE----- 653
           E +                                    + K + GS FK + I      
Sbjct: 583 ELIRGF--------------------------------YSEKDSRGSSFKTTSIRHRDQL 610

Query: 654 --LMNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTF 711
             L++ ++ST  H++RCI PN  K+A  F+  ++L QLR  GVLE IRI+  G+P+R  F
Sbjct: 611 KSLLDRLSSTEPHFVRCIIPNDKKKAHDFNRKLILDQLRCNGVLEGIRIAREGYPNRIFF 670

Query: 712 EEFVLRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAG 771
           +EF  RY IL    ++    KK            +++L +   D S +++GN+K+FFKAG
Sbjct: 671 KEFFQRYKILSDEYRFSNTSKKN----------CEIVLSSLRLDPSVFKVGNSKLFFKAG 720

Query: 772 MLAYLEKLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQ 815
           +LA LE  +  ++ +    +  +I     R+     SQ +K LQ
Sbjct: 721 VLASLEAKKEGRISDMASKLNARINGNAVRR---STSQKLKKLQ 761

>CAGL0J00693g complement(61246..66900) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1, hypothetical
           start
          Length = 1884

 Score =  470 bits (1210), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 286/751 (38%), Positives = 430/751 (57%), Gaps = 38/751 (5%)

Query: 65  NPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDM 124
           NP   +  ++++ L++LNEP+VL+ ++ RY    IYTYSG+ L+A NP+  +  LY+   
Sbjct: 61  NPANFDRVDNMSELTHLNEPSVLNNLENRYKDNLIYTYSGLFLVAINPYKEISNLYSNST 120

Query: 125 IQAY-AGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFAS 183
           I++Y +       +PH+F +AE AYR +K+ KQ+Q+I+V+GESGAGKT + K I++Y AS
Sbjct: 121 IKSYHSSNEETSQKPHIFEVAESAYRDLKSKKQDQSILVTGESGAGKTENTKKILQYLAS 180

Query: 184 VEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSI 243
           +   +S  V +  EM     KIL +NP++E+FGNA+T RN+NSSRFGK+++I FD+   I
Sbjct: 181 ITS-DSFEVSNNFEM-----KILQSNPVLESFGNAQTVRNNNSSRFGKFIKIEFDQSGKI 234

Query: 244 IGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDY--FYMNQGG 301
            GA I  YLLE+SR+  +   ERNYHIFYQL+ G   +  E ++   ++D+  + +    
Sbjct: 235 NGAFIEWYLLEKSRITNENRNERNYHIFYQLLKGTSQKDLESIYKLSSNDFAHYQILANS 294

Query: 302 DTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIE-IKKTRNDASLSA 360
           +  I G+DDA E++  + AL  VG  K+  + IFKI+A +LH GNIE + +    AS  +
Sbjct: 295 NHVIPGVDDAAEFQKLLVALETVGFGKDQINSIFKIVAVILHCGNIEFVSEKSEQASFKS 354

Query: 361 DEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALF 420
           D   +     LLG+   +F   + K +     E +    N +QA    +S+ + +Y  LF
Sbjct: 355 D---ISAIATLLGVSESDFKTAILKPRSKAGREWVSQAKNANQARFIINSLCRTLYEHLF 411

Query: 421 DWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 480
            ++V+ IN  L + ++    +++IG+LDI GFE FE NSFEQ CINY NEKLQQ FN H+
Sbjct: 412 GYIVDTINMSLNHGSM---TANYIGLLDIAGFEIFEHNSFEQLCINYTNEKLQQFFNHHM 468

Query: 481 FKLEQEEYVKEEIEWSFIEFN-DNQPCIDLIENK---LGILSLLDEESRLPAGSDESWTQ 536
           F LEQ EY+KE I+W ++++  D Q  I+L+E K    GIL LLDEE+ LP   D S+  
Sbjct: 469 FVLEQSEYLKENIQWDYVDYGKDLQSTINLLEAKGPPTGILPLLDEETILPKSEDSSFYS 528

Query: 537 KLYQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAS 596
           KL  T  ++ T   F + +     F++ HYA DV Y V G++ KN+D +++  + +L  S
Sbjct: 529 KLISTWQQNSTK--FKRSKLDMC-FVLKHYAGDVEYHVNGWLAKNKDPLNENLVNILSVS 585

Query: 597 TNETLINIXX--XXXXXXXXXXXXXXXXXXQAGSKKPGPIRTVNRKPTLGSMFKQSLIEL 654
           +N  +                          A     G  RT N K  L S  ++    L
Sbjct: 586 SNRLISEFFSGFESISSPSSSPTRLTHSSSSASINSLGKGRT-NLKTAL-SRHREQQSSL 643

Query: 655 MNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEF 714
           ++ +  TN H++RCI PN  K +  FD  ++L QLR  GVLE IRI+  G+P+R  F+EF
Sbjct: 644 LSQLALTNPHFVRCIIPNNKKMSETFDRRLILDQLRCNGVLEGIRIAREGYPNRILFKEF 703

Query: 715 VLRYYILIPH--EQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGM 772
             RY IL  H  +  D I  K+ +     I + ++ LD T      Y++G +K+FFKAG 
Sbjct: 704 YERYRILSEHLDKSSDAINYKQSSQ----ILISELHLDPTT-----YKVGTSKLFFKAGT 754

Query: 773 LAYLEKLRSNKMHNSIVMIQKKIRAKYYRKQ 803
           LA LE  + + +    V     IR    RK+
Sbjct: 755 LAELESKKESILFEITVRFNSIIRGWSQRKR 785

>KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w MYO5 myosin I, start by
           similarity
          Length = 1260

 Score =  452 bits (1162), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 280/752 (37%), Positives = 409/752 (54%), Gaps = 50/752 (6%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAG 130
              DLT LS +++ A+   +K+R+    IYTY G VLI+ NPF R   +YT  ++++Y G
Sbjct: 35  GVSDLTLLSSISDDAINQNLKKRFENGTIYTYIGHVLISVNPF-RDLGIYTDAVLESYKG 93

Query: 131 KRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSA 190
           K R E+ PH+FAIAE  Y  +K   +NQ +++SGESGAGKT +AK IM+Y A+      A
Sbjct: 94  KNRLEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAA------A 147

Query: 191 TVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRT 250
           +  H+  + + +  +LATNP++E+FG AKT RN+NSSR GKYLEI F++       +I  
Sbjct: 148 SSTHEASIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNEQFEPCAGQITN 207

Query: 251 YLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQGGDTKINGIDD 310
           YLLE+ R+V Q   ERN+HIFYQ   G     ++   +     Y Y +  G T ++ IDD
Sbjct: 208 YLLEKQRVVGQIRNERNFHIFYQFTKGASDTYRQNFGVLQPDQYIYTSASGCTSVDTIDD 267

Query: 311 AKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSADEPNLKLACE 370
             +Y+ T+ A+ ++G+++E Q QIF++L+A+L IGN+   +     +   D         
Sbjct: 268 LHDYQETIKAMQVIGLSQEEQDQIFRMLSAILWIGNVTFVENNEGNAEVRDTSVTDFVAY 327

Query: 371 LLGIDAYNFAKWVTKKQIIT-----RSEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVE 425
           L+ +D+    K + ++ + T     R       LN  QA   +D++AK IY+ LFDW+V+
Sbjct: 328 LMQVDSGLLIKCLVERVMETGHGSRRGSVYHVPLNVVQATAVRDALAKAIYNNLFDWIVD 387

Query: 426 NINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQ 485
            +N  L   A    + S IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K EQ
Sbjct: 388 RVNVSL--KAFPGAVKS-IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQ 444

Query: 486 EEYVKEEIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTLD 543
           EEY KE+I+W+ I++ DN+   DLIE+K   GI + LD+          +  Q   Q L+
Sbjct: 445 EEYNKEQIQWTPIKYFDNKVVCDLIESKRPPGIFATLDDSVATAHADSNAADQAFAQRLN 504

Query: 544 KSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLIN 603
              TN  F       +KF++ HYA DV YD+ G  +KN+D +     E+++ +TN  L  
Sbjct: 505 LFSTNAHFD---LRSSKFVIKHYAGDVTYDISGMTDKNKDQLVKDLAELVQTTTNPFLST 561

Query: 604 IXXXXXXXXXXXXXXXXXXXXQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINSTNV 663
           I                       SK+        R PT G+   +S  EL+ T++    
Sbjct: 562 I---------------FPDTIDKSSKR--------RPPTAGNKIIKSANELVETLSKAQP 598

Query: 664 HYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILIP 723
            YIR IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R TFE+FV R+Y+L P
Sbjct: 599 SYIRTIKPNQTKSPRDYDDQQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSP 658

Query: 724 HEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAG-MLAYLEKLRSN 782
                  +    T + D +  VK IL       ++YQ+G TK+F K    L  LE +R  
Sbjct: 659 ----KCSYAGDYTWQGDTLGAVKQILQDASIPTTEYQLGVTKVFIKTPETLFALEHMRDR 714

Query: 783 KMHNSIVMIQKKIRAKYYRK--QYLQISQAIK 812
             +N    IQ+  R    R+    ++I +AI+
Sbjct: 715 YWYNMAARIQRAWRRFIQRRIDSAIKIQRAIR 746

>Kwal_26.7587
          Length = 1250

 Score =  447 bits (1151), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 273/735 (37%), Positives = 399/735 (54%), Gaps = 50/735 (6%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAG 130
              DLT LS +++ A+   +K+R+    IYTY G VLI+ NPF R   +YT  ++++Y G
Sbjct: 37  GVSDLTLLSKISDEAINENLKKRFQNGTIYTYIGHVLISVNPF-RDLGIYTDSVLRSYVG 95

Query: 131 KRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSA 190
           K R E+ PH+FAIAE  Y  MK   +NQ +++SGESGAGKT +AK IM+Y A+  E +S 
Sbjct: 96  KNRLEVAPHVFAIAESMYYNMKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASETHSD 155

Query: 191 TVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRT 250
           ++    +M      +LATNP++E+FG AKT RN+NSSR GKYLEI F+         I  
Sbjct: 156 SIGKIKDM------VLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGNITN 209

Query: 251 YLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQGGDTKINGIDD 310
           YLLE+ R+V Q   ERN+HIFYQ   G     ++   +     Y Y +  G T ++ IDD
Sbjct: 210 YLLEKQRVVGQLKDERNFHIFYQFTKGASDNYRQIYGVQKPEQYLYTSASGCTSVDTIDD 269

Query: 311 AKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSADEPNLKLACE 370
             +++ T++A++++GIT+  Q ++F+ LAA+L IGNI   +     +   D         
Sbjct: 270 LSDFQETLNAMSVIGITQHEQDEVFRFLAAILWIGNISFTENEEGNAQVRDTSVTDFVAY 329

Query: 371 LLGIDAYNFAKWVTKKQIIT-----RSEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVE 425
           LL +D+    + + ++ + T     R       LN  QA   KD++AK IY+ LFDW V+
Sbjct: 330 LLQVDSNLLVQALVERVMETNHGMKRGSIYHVPLNVVQATAVKDALAKAIYNNLFDWTVD 389

Query: 426 NINTVL-CNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLE 484
            +N  L   P  N      IG+LDIYGFE F+ NSFEQ CINY NEKLQQ F Q   K E
Sbjct: 390 RVNLSLQALPGANKS----IGILDIYGFEIFDYNSFEQICINYVNEKLQQIFIQLTLKSE 445

Query: 485 QEEYVKEEIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTL 542
           QEEY +E+IEW+ I++ DN+   DLIE +   GI++ +++         ++  Q   Q L
Sbjct: 446 QEEYAREQIEWTPIKYFDNRVVCDLIEARRPPGIIAAMNDSVATAHADSDAADQAFAQRL 505

Query: 543 DKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLI 602
           +   +N  F       +KFI+ HYA DV YD+ G  +KN+D +    +E++K S+NE L 
Sbjct: 506 NLFSSNPHF---ELRSSKFIIKHYAGDVTYDIFGMTDKNKDQLQKDLVELVKTSSNEFLC 562

Query: 603 NIXXXXXXXXXXXXXXXXXXXXQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINSTN 662
           ++                       SK+        R P+ G    +S  EL+ T++   
Sbjct: 563 SL---------------FPTVVDKNSKR--------RPPSAGDKIIKSANELVETLSKAQ 599

Query: 663 VHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILI 722
             YIR IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R  F++FV R+Y+L 
Sbjct: 600 PSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQVFDKFVERFYLLS 659

Query: 723 PHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAG-MLAYLEKLRS 781
           P       +    T + D +  VK+IL       ++YQ+G +K+F K    L  LE +R 
Sbjct: 660 PQ----CSYAGDYTWQGDTLEAVKLILKDASIPPTEYQLGVSKVFIKTPESLFALETMRD 715

Query: 782 NKMHNSIVMIQKKIR 796
              HN    IQ+  R
Sbjct: 716 KYWHNMAARIQRAWR 730

>Scas_721.119
          Length = 1232

 Score =  444 bits (1142), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 274/731 (37%), Positives = 390/731 (53%), Gaps = 50/731 (6%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAG 130
              DLT LS +++  +   +K+R+    IYTY G VLI+ NPF R   +YT  ++++Y G
Sbjct: 37  GVSDLTLLSKISDETINDNLKKRFMNGTIYTYIGHVLISVNPF-RDLGIYTDAIVESYKG 95

Query: 131 KRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSA 190
           K R E+ PH+FAIAE  Y  MK+  +NQ +++SGESGAGKT +AK IM+Y AS      A
Sbjct: 96  KNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAS------A 149

Query: 191 TVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRT 250
           +  H   + + +  +LATNP++E+FG AKT RN+NSSR GKYLEI F+         I  
Sbjct: 150 STTHSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNITN 209

Query: 251 YLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQGGDTKINGIDD 310
           YLLE+ R+V Q   ERN+HIFYQ   G     ++   +     Y Y +  G T ++ IDD
Sbjct: 210 YLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYIYTSASGCTSVDTIDD 269

Query: 311 AKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSADEPNLKLACE 370
             +Y+ T+ A+ ++G+ +E Q QIF++LAA+L IGN+   +     +   D         
Sbjct: 270 VNDYRETLKAMEVIGLHQEEQDQIFRMLAAVLWIGNVSFVENEEGNAQVRDTSVTDFVAY 329

Query: 371 LLGIDAYNFAKWVTKKQIIT-----RSEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVE 425
           LL IDA    K + ++ + T     R       LN  QA   +D++AK IY+ LF+W+V 
Sbjct: 330 LLQIDAPLLIKSLVERVMETNHGMRRGSVYHVPLNIVQATAVRDALAKAIYNNLFEWIVG 389

Query: 426 NINTVL-CNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLE 484
            +N  L   P  +      IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K E
Sbjct: 390 RVNVSLQAYPGADRS----IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSE 445

Query: 485 QEEYVKEEIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTL 542
           QE Y +E+I+W+ I++ DN+   DLIE K   GI + +++          +  Q   Q L
Sbjct: 446 QETYKREKIKWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSNAADQAFAQRL 505

Query: 543 DKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLI 602
           +   +N  F        KF++ HYA DV YDV G  +KN+D +    +E++  +TN  L 
Sbjct: 506 NMFSSNPHF---ELRSNKFVIKHYAGDVTYDVNGITDKNKDQLQKDLVELIATTTNPFLS 562

Query: 603 NIXXXXXXXXXXXXXXXXXXXXQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINSTN 662
            I                       SK+        R PT G    +S  EL+ T++   
Sbjct: 563 GIFPVEVDKE---------------SKR--------RPPTAGDKIIKSANELVETLSKAQ 599

Query: 663 VHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILI 722
             YIR IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R TFE+FV R+Y+L 
Sbjct: 600 PSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLS 659

Query: 723 PHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAG-MLAYLEKLRS 781
           PH  +   +    T + + +  V+ IL+      S+YQ+G T +F K    L  LE +R 
Sbjct: 660 PHCSYAGDY----TWQGETLDAVQHILNDASIPASEYQLGTTSVFIKTPETLFALEHMRD 715

Query: 782 NKMHNSIVMIQ 792
              HN    IQ
Sbjct: 716 RYWHNMAARIQ 726

>CAGL0K07590g 748352..752110 highly similar to sp|P36006
           Saccharomyces cerevisiae YKL129c or sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin like proteins,
           start by similarity
          Length = 1252

 Score =  443 bits (1140), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 286/763 (37%), Positives = 410/763 (53%), Gaps = 63/763 (8%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAG 130
              DLT LS +++ ++   +K+R+    IYTY G VLI+ NPF R   +YT D +++Y G
Sbjct: 37  GVSDLTLLSKISDESINDNLKKRFEHGIIYTYIGYVLISVNPF-RDLGIYTDDTMKSYQG 95

Query: 131 KRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSA 190
           K R E  PH+FAIAE  Y  +K+  +NQ +++SGESGAGKT +AK IM+Y A+    +S 
Sbjct: 96  KNRLEAPPHVFAIAENMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAATSSTHSE 155

Query: 191 TVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRT 250
           ++      S+ +  +LATNP++E+FG AKT RN+NSSR GKYLEI FD         I  
Sbjct: 156 SI------SKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFDAHFQPCAGHITN 209

Query: 251 YLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQGGDTKINGIDD 310
           YLLE+ R+V Q   ERN+HIFYQ   G P + ++   +     Y Y +    T +  +DD
Sbjct: 210 YLLEKQRVVGQIKNERNFHIFYQFTKGAPEEYRQLFGVQQPEQYIYTSASQCTAVENMDD 269

Query: 311 AKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSADEPNLKLACE 370
            +E+  T++A+  +G+TK  Q QIF+ LAA+L IGNI   +     +   D+        
Sbjct: 270 VEEFNETLNAMRTIGLTKSEQDQIFRALAAILWIGNISFVENEAGNAEIRDKSVTTFVAY 329

Query: 371 LLGIDAYNFAKWVTKKQIIT-----RSEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVE 425
           LL +      K + ++ I T     R     S LN  QA   +D++AK IY+ LF+W+VE
Sbjct: 330 LLEVQEELLIKALIERIIETTHGAKRGSTYHSPLNIIQATAVRDALAKAIYNNLFEWIVE 389

Query: 426 NINTVL-CNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLE 484
            +N  L   P  +      IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K E
Sbjct: 390 RVNNSLQAFPGADKS----IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSE 445

Query: 485 QEEYVKEEIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTL 542
           Q+ Y KE+I W+ IE+ DN+   DLIE K   GI + +++         ++  Q   Q L
Sbjct: 446 QDTYKKEQIHWTPIEYFDNKIVCDLIEAKRPPGIFAAMNDAIATAHADSDAADQAFAQRL 505

Query: 543 DKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLI 602
           +   TN  F      Q KF+V HYA DV YD+ G  +KN+D +    +E+L  ++N  + 
Sbjct: 506 NLFTTNPHF---ELRQNKFVVKHYAGDVTYDIFGITDKNKDQLQKDLVELLSTTSNSFVR 562

Query: 603 NIXXXXXXXXXXXXXXXXXXXXQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINSTN 662
            I                    Q  S++        R PT G    +S  EL+ T++   
Sbjct: 563 EI---------------FPDQPQTDSRR--------RPPTSGDKIIKSANELVETLSKAQ 599

Query: 663 VHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILI 722
             YIR IKPN  K +  +D+  VL Q++  G+ E +RI  AGF  R  FE+FV R+Y+L 
Sbjct: 600 PSYIRTIKPNDTKSSTIYDDQRVLHQIKYLGLKENVRIRRAGFAHRQVFEKFVERFYLLS 659

Query: 723 PHEQW--DLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFK-AGMLAYLEKL 779
           P   +  D ++      + + +  VK+IL       ++Y+IG T+IF K    L  LE +
Sbjct: 660 PQCSYAGDYVW------DGETLDAVKLILQDASIPTTEYEIGVTQIFIKHPETLFALENM 713

Query: 780 RSNKMHNSIVMIQKKIRAKYYRKQYLQ--ISQAIKYLQNNIKG 820
           R    +N    IQ+  R      +YLQ  I  AI+ +QN I+G
Sbjct: 714 RDKYWYNMAARIQRAWR------RYLQKRIDAAIR-IQNAIRG 749

>YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may
           play a role in cell growth or polarity that is partially
           redundant with Myo3p, appears to stimulate actin patch
           formation, has an SH3 domain [3660 bp, 1219 aa]
          Length = 1219

 Score =  435 bits (1118), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 272/735 (37%), Positives = 386/735 (52%), Gaps = 50/735 (6%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAG 130
              DLT LS +++ A+   +K+R+    IYTY G VLI+ NPF R   +YT  ++  Y G
Sbjct: 37  GVSDLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPF-RDLGIYTDAVMNEYKG 95

Query: 131 KRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSA 190
           K R E+ PH+FAIAE  Y  MK+  +NQ +++SGESGAGKT +AK IM+Y A+      A
Sbjct: 96  KNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAA------A 149

Query: 191 TVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRT 250
           +  H   + + +  +LATNP++E+FG AKT RN+NSSR GKYLEI F+         I  
Sbjct: 150 SSTHTESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITN 209

Query: 251 YLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQGGDTKINGIDD 310
           YLLE+ R+V Q   ERN+HIFYQ   G     ++   +     Y Y    G      IDD
Sbjct: 210 YLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVYTAAAGCISAETIDD 269

Query: 311 AKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSADEPNLKLACE 370
            ++Y+ T+ A+ ++G+ +E Q QIF++LAA+L IGN+   +     +   D         
Sbjct: 270 LQDYQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSFIENEEGNAQVRDTSVTDFVAY 329

Query: 371 LLGIDAYNFAKWVTKKQIIT-----RSEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVE 425
           LL ID+    K + ++ + T     R       LN  QA   +D++AK IY+ LFDW+V 
Sbjct: 330 LLQIDSQLLIKSLVERIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDWIVS 389

Query: 426 NINTVL-CNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLE 484
            +N  L   P         IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K E
Sbjct: 390 RVNKSLQAFPGAEKS----IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSE 445

Query: 485 QEEYVKEEIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTL 542
           QE Y +E+I+W+ I++ DN+   DLIE +   GI + +++          +  Q   Q L
Sbjct: 446 QETYEREKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFAQRL 505

Query: 543 DKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLI 602
           +   TN  F        KF++ HYA DV YD++G  +KN+D +    +E++  +TN  L 
Sbjct: 506 NLFTTNPHFD---LRSNKFVIKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFLA 562

Query: 603 NIXXXXXXXXXXXXXXXXXXXXQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINSTN 662
            I                       SK+        R PT G    +S  +L+ T++   
Sbjct: 563 TIFPDTVDRE---------------SKR--------RPPTAGDKIIKSANDLVETLSKAQ 599

Query: 663 VHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILI 722
             YIR IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R  FE+FV R+Y+L 
Sbjct: 600 PSYIRTIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLS 659

Query: 723 PHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAG-MLAYLEKLRS 781
           PH      +    T + D +  VK IL  +   + +YQ+G T +F K    L  LE +R 
Sbjct: 660 PH----CSYAGDYTWQGDTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFALEHMRD 715

Query: 782 NKMHNSIVMIQKKIR 796
              HN    IQ+  R
Sbjct: 716 RYWHNMAARIQRAWR 730

>CAGL0K03487g 322030..325683 highly similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin-like protein,
           start by similarity
          Length = 1217

 Score =  434 bits (1117), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 275/762 (36%), Positives = 405/762 (53%), Gaps = 63/762 (8%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAG 130
              DLT L+ +++ ++   +K+R+    IYTY G VLI+ NPF R   +YT  ++++Y G
Sbjct: 38  GVSDLTLLTSISDESINDNLKKRFLNGTIYTYIGHVLISVNPF-RDLGIYTDAIMKSYQG 96

Query: 131 KRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSA 190
           K R E+ PH++AI+E  Y  +K   +NQ +++SGESGAGKT +AK IM Y A+    +S 
Sbjct: 97  KNRLEVPPHVYAISEAMYYNLKAYNENQCVIISGESGAGKTEAAKKIMEYIAATSSTHSE 156

Query: 191 TVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRT 250
           ++    +M      +LATNP++E+FG AKT RN+NSSR GKYLEI F+         I  
Sbjct: 157 SIGKIKDM------VLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNITN 210

Query: 251 YLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQGGDTKINGIDD 310
           YLLE+ R+V Q   ERN+HIFYQ   G     ++   +     Y Y +    T ++ IDD
Sbjct: 211 YLLEKQRVVGQITNERNFHIFYQFTKGASDNYRQTFGVQLPEQYVYTSASKCTSVDTIDD 270

Query: 311 AKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSADEPNLKLACE 370
            K+++ T+ A+ ++G+ +E Q QIF++LAA+L IGNI   +     +   D         
Sbjct: 271 VKDFEATIKAMQVIGLAQEEQDQIFRMLAAILWIGNISFIENEEGNAQVRDTSVTDFVAY 330

Query: 371 LLGIDAYNFAKWVTKKQIIT-----RSEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVE 425
           LL +D+ +  K + ++ + T     R       LN  QA   +D++AK IY+ LF+W+V+
Sbjct: 331 LLQVDSQSLIKALVERIVETNHGSRRGSVYHVPLNIVQATAVRDALAKAIYNNLFEWIVD 390

Query: 426 NINTVL-CNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLE 484
            +N  L   P  +      IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K E
Sbjct: 391 RVNKSLHAYPGADKS----IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSE 446

Query: 485 QEEYVKEEIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTL 542
           Q+ Y +E+I+W+ I++ DN+   DLIE K   GI + +++          +  Q   Q L
Sbjct: 447 QDTYAREKIQWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSSAADQAFAQRL 506

Query: 543 DKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLI 602
               +N  F +    Q KF++ HYA DV YDV G  +KN+D +    +E++  +TN  L 
Sbjct: 507 SLFSSNPHFEQ---RQNKFVIKHYAGDVTYDVLGMTDKNKDQLQKDLVELVGTTTNAFLT 563

Query: 603 NIXXXXXXXXXXXXXXXXXXXXQAGSKKPGPIRTVN--RKPTLGSMFKQSLIELMNTINS 660
            +                          P  +   N  R PT G    +S  EL+ T++ 
Sbjct: 564 TLF-------------------------PNQVDKDNKRRPPTAGDKIIKSANELVETLSK 598

Query: 661 TNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYI 720
               YIR IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R  FE+FV R+Y+
Sbjct: 599 AQPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQGFEKFVERFYL 658

Query: 721 LIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAG-MLAYLEKL 779
           L P       +    T   DI+  V++IL   +  + +YQ+G T++F K    L  LE +
Sbjct: 659 LSPR----CSYAGDYTWTGDILEAVRLILQDALIPEKEYQLGVTQVFIKTPETLFALENM 714

Query: 780 RSNKMHNSIVMIQKKIRAKYYRKQYLQ--ISQAIKYLQNNIK 819
           R    HN    IQ+  R      +YLQ  I  A+K +Q  IK
Sbjct: 715 RDKFWHNMAARIQRAWR------RYLQRRIDAAVK-IQRTIK 749

>YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin type
           I, may play a role in cell growth or polarity that is
           partially redundant with Myo5p, has an SH3 domain [3816
           bp, 1271 aa]
          Length = 1271

 Score =  430 bits (1105), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 282/756 (37%), Positives = 405/756 (53%), Gaps = 58/756 (7%)

Query: 74  DLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAGKRR 133
           DLT LS +++ ++   +K+R+    IYTY G VLI+ NPF R   +YT  ++++Y GK R
Sbjct: 40  DLTLLSKISDESINENLKKRFKNGIIYTYIGHVLISVNPF-RDLGIYTNAVLESYKGKNR 98

Query: 134 GELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSATVQ 193
            E+ PH+FAIAE  Y  +K+  +NQ +++SGESGAGKT +AK IM+Y A+      A+  
Sbjct: 99  LEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAA------ASNS 152

Query: 194 HQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRTYLL 253
           H   + + +  +LATNP++E+FG AKT RN+NSSR GKYLEI F+         I  YLL
Sbjct: 153 HSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITNYLL 212

Query: 254 ERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQGGDTKINGIDDAKE 313
           E+ R+V Q   ERN+HIFYQ   G     K+   +     Y Y    G T  + +   K+
Sbjct: 213 EKQRVVGQIKNERNFHIFYQFTKGASDTYKQMFGVQMPEQYIYTAAAGCTSADQL-MRKD 271

Query: 314 YKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSADEPNLKLACELLG 373
           Y+ T++A+  +G+ +E Q QIF++LAA+L IGNI   +     +   D         LL 
Sbjct: 272 YEGTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISFIENEEGNAQVGDTSVTDFVAYLLQ 331

Query: 374 IDAYNFAKWVTKKQIIT-----RSEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVENIN 428
           +DA    K + ++ + T     R       LN  QA   +D++AK IY+ LFDW+V+ +N
Sbjct: 332 VDASLLVKCLVERIMQTSHGMKRGSVYHVPLNPVQATAVRDALAKAIYNNLFDWIVDRVN 391

Query: 429 TVL-CNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEE 487
             L   P  +      IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K EQE 
Sbjct: 392 VSLQAFPGADKS----IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAEQET 447

Query: 488 YVKEEIEWSFIEFNDNQPCIDLIE--NKLGILSLLDEESRLPAGSDESWTQKLYQTLDKS 545
           Y +E+I+W+ I++ DN+   DLIE  N  GIL+ +++          +  Q   Q L+  
Sbjct: 448 YEREKIKWTPIKYFDNKVVCDLIEAKNPPGILAAMNDSIATAHADSNAADQAFAQRLNLF 507

Query: 546 PTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLINIX 605
            +N  F        KF++ HYA DV YD+ G  +KN+D +    +E++  +TN  L  I 
Sbjct: 508 NSNPYF---ELRANKFVIKHYAGDVTYDINGITDKNKDQLQKDLIELIGTTTNTFLSTIF 564

Query: 606 XXXXXXXXXXXXXXXXXXXQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINSTNVHY 665
                                 SK+        R PT G    +S  EL+ T++     Y
Sbjct: 565 PDDVDKD---------------SKR--------RPPTAGDKIIKSANELVETLSKAEPSY 601

Query: 666 IRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILIPHE 725
           IR IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R TFE+FV R+Y+L P  
Sbjct: 602 IRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSP-- 659

Query: 726 QWDLIFKKKETTEEDIISVVKMIL-DATVKDKSKYQIGNTKIFFKAG-MLAYLEKLRSNK 783
             D  +    T + D +  VK+IL DA + +K ++Q+G T +F K    L  LE +R   
Sbjct: 660 --DCSYAGDYTWDGDTLEAVKLILRDAMIPEK-EFQLGVTSVFIKTPESLFALEDMRDKY 716

Query: 784 MHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIK 819
            +N    IQ+  R    R+    I  AIK +Q  I+
Sbjct: 717 WYNMAARIQRAWRRFLQRR----IDAAIK-IQRTIR 747

>AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C
           (MYO3) - SH] (65141..69019) [3879 bp, 1292 aa]
          Length = 1292

 Score =  422 bits (1086), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 275/771 (35%), Positives = 406/771 (52%), Gaps = 65/771 (8%)

Query: 71  ATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAG 130
              DLT LS +++  +   +K+R+   +IYTY G VLI+ NPF R   +YT  +++ Y G
Sbjct: 36  GVSDLTLLSKISDEHINENLKRRFENGSIYTYIGHVLISVNPF-RDLGIYTDQVLETYKG 94

Query: 131 KRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSA 190
           + R E+ PH+FAIAE  Y  +K   +NQ +++SGESGAGKT +AK IM+Y A+    + A
Sbjct: 95  RNRLEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASSSHEA 154

Query: 191 TVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRT 250
           ++    +M      +LATNP++E+FG AKT RN+NSSR GKYLEI F+        +I  
Sbjct: 155 SIGRIKDM------VLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGQITN 208

Query: 251 YLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQGGDTKINGIDD 310
           YLLE+ R+V Q   ERN+HIFYQ   G   + ++   +     Y Y +  G T ++ IDD
Sbjct: 209 YLLEKQRVVGQIKNERNFHIFYQFSKGASDRYRKTYGVQLPEQYVYTSASGCTSVDTIDD 268

Query: 311 AKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSADEPNLKLACE 370
             +Y+ T++A+ ++G+++  Q +IF++L+A+L IGN+   +     +  AD         
Sbjct: 269 LNDYEATLEAMNVIGLSQAEQDEIFRLLSAILWIGNVTFMEDDEGNAKIADTSITDFVAY 328

Query: 371 LLGIDAYNFAKWVTKKQIIT-----RSEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVE 425
           LL +DA    K + ++ I T     R       LN  QA   +D++AK IY+ LF+W+V+
Sbjct: 329 LLQVDAGLLVKSLVERTIETTHGMRRGSIYNVPLNIVQATAVRDALAKAIYNNLFEWIVD 388

Query: 426 NINTVL-CNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLE 484
            +N  L   P         IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K E
Sbjct: 389 RVNVSLQALPGAEKS----IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSE 444

Query: 485 QEEYVKEEIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTL 542
           QEEY KE+I+W+ I++ DN+   +LIE K   GI + L++          +  Q   Q L
Sbjct: 445 QEEYAKEQIQWTPIKYFDNKVVCELIEAKRPPGIFAALNDSVATAHADSNAADQAFAQRL 504

Query: 543 DKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLI 602
           +   +N  F       +KF++ HYA DV YD+ G  +KN+D +    +E+L +++N  L 
Sbjct: 505 NLFTSNPHF---ELRSSKFVIKHYAGDVTYDIGGMTDKNKDQLQRDLVELLNSTSNTFLA 561

Query: 603 NIXXXXXXXXXXXXXXXXXXXXQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINSTN 662
            I                      G K    I +     T G    +S  EL++T++   
Sbjct: 562 TI------------------FPDTGDKDSKRIPS-----TAGDKIIRSANELVDTLSKAQ 598

Query: 663 VHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILI 722
             YIR IKPN  K    +D+  VL Q++  G+ E +RI  A +  R  F++FV R+Y+L 
Sbjct: 599 PSYIRTIKPNQTKSPLDYDDRQVLHQVKYLGLQENVRIRRACYAYRHIFDKFVERFYLLS 658

Query: 723 PHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAG-MLAYLEKLRS 781
           P       +    T + + +  V +IL  T    ++YQ+G TK+F K    L  LE +R 
Sbjct: 659 PQ----CSYAGDYTWQGNTLDAVNLILRDTSIPVTEYQLGVTKVFIKTPETLFALENMRD 714

Query: 782 NKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMK 832
              HN    IQ+  R               ++LQ  I   I  QR   EMK
Sbjct: 715 KYWHNMASRIQRAWR---------------RFLQRRIDSAIRIQRAIREMK 750

>ABR111C [703] [Homologous to ScYPR090W - SH; ScYPR089W - SH]
            (591654..594023) [2370 bp, 789 aa]
          Length = 789

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 15/73 (20%), Positives = 39/73 (53%)

Query: 1358 ILTFFNSIYWCMKSFHIENEVFHAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNV 1417
            I+  F ++ + ++S  +   +    ++T + +     FN ++  + +LS  + +Q+  N+
Sbjct: 452  IVQIFGALAYVLESHQVHPLLSMQCLSTSIEWFSTSIFNIMVSSKKYLSRAQAMQIRLNL 511

Query: 1418 TRLEEWCKTHGLT 1430
            + +E+W K H +T
Sbjct: 512  STIEDWVKNHDMT 524

>Kwal_55.21515
          Length = 567

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 79/131 (60%), Gaps = 17/131 (12%)

Query: 915  RRRAAQRKLKQLKAD-AKSVNHLKEVSYK---LENKVIELTQ------NLASKVKENKEM 964
            RRR  Q++++ L+ D +K+ +H+K+   +   LE ++ +L Q      NL  K+ +++++
Sbjct: 109  RRRELQQQVRSLEKDLSKANSHVKDRDERILTLEKQLDDLKQRSNQLRNLDGKIDDDRKI 168

Query: 965  T-ERIKELQVQVEESAKLQETLENMKKEHLID-IDNQKSKDMEL----QKTIENNLQSTE 1018
              ++IKEL+ Q+++  K ++ L N K E L + I  Q ++   L    +KT+EN++++ +
Sbjct: 169  KDQKIKELRAQIQQVVKQKDEL-NRKNEELRERIVTQATRSPALKINTRKTLENDIETQK 227

Query: 1019 QTLKDAQLELE 1029
               K+ +LE+E
Sbjct: 228  LRAKNQELEVE 238

>YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Component
           of the abundant RSC chromatin remodeling complex [2658
           bp, 885 aa]
          Length = 885

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%)

Query: 58  QSLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQ 96
           +S+P L + P+  A E  T L+++  PA+ H +   Y+Q
Sbjct: 136 KSVPSLESKPVTSANESSTPLNWVQGPAIFHMLTSPYTQ 174

>Sklu_1723.1 YHR011W, Contig c1723 448-1779 reverse complement
          Length = 443

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 61/112 (54%), Gaps = 11/112 (9%)

Query: 924  KQLKADAKSVNHLKEVSYKLENKVIELTQNLASKVKENKEMTERIKELQVQVEESAKLQE 983
            ++L + + +V  L++  + ++  + E+ Q L S   +N+E+T    ELQ Q++E      
Sbjct: 4    RRLFSVSSAVRFLRKPQFDVKAIIAEMPQYLGSI--KNRELTVG-DELQKQLQE------ 54

Query: 984  TLENMKKEHLIDIDNQKSKDMELQKTIENNLQSTEQTLKDAQLELEDMVKQH 1035
             L N + E L D D Q +K    +K+IEN L+  +  + + + +L+D+  Q+
Sbjct: 55   -LPNYQTE-LRDCDYQIAKIQADRKSIENKLKQDKSRISELKRDLQDLKLQY 104

>YNL062C (GCD10) [4528] chr14 complement(508774..510210) RNA-binding
           subunit of initiation factor eIF3 [1437 bp, 478 aa]
          Length = 478

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 2   SFEVGTRCWYPHK---ELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKD- 57
           +FEV     YP     E+ + G EV  +E  D K   ++ +    ++S + KD+NNDKD 
Sbjct: 40  AFEVNDIIGYPFGLTFEIYYDGEEVSSDENRDSKPKNKIPIGKVRLLSQEIKDVNNDKDD 99

Query: 58  -QSLPLL 63
            QS P L
Sbjct: 100 GQSEPPL 106

>CAGL0D02750g 288647..289021 no similarity, hypothetical start
          Length = 124

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 433 NPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYA 468
           N AV   +SSF+ + D+ GFE++  N + QF I+Y 
Sbjct: 69  NYAV-GTLSSFV-IFDVNGFEYYVINVYRQFTIHYC 102

>AFR603C [3795] [Homologous to ScYOL090W (MSH2) - SH]
           (1524851..1527721) [2871 bp, 956 aa]
          Length = 956

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 935 HLKEVSYKLENKVIELTQNLASKVKENKEMTERIKELQVQVEESAKLQETLENMKKE 991
           H+ EV  +  +K++++ +  A+++ + KE TE +K+L+   E  AK  E L+N+ +E
Sbjct: 848 HVAEV-VQFPSKIVKMAKRKATELDDIKEETECLKKLKCSPEHIAKGSEVLKNLLQE 903

>YIL151C (YIL151C) [2526] chr9 complement(57338..60694) Protein of
            unknown function, has high similarity to uncharacterized
            S. cerevisiae Ykr096p [3357 bp, 1118 aa]
          Length = 1118

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 54/123 (43%), Gaps = 29/123 (23%)

Query: 899  RFLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIEL--TQNLAS 956
            R+LR  KD  VV++  R     R+L                    E K+I +  T N+A+
Sbjct: 985  RYLRGSKDDTVVEAATRSVITIRQLYD------------------EKKIIPMRFTGNIAT 1026

Query: 957  KVKENKEMTERIKELQVQVEES-----AKLQETLENMKKEHLIDIDNQKSKDMELQKTIE 1011
             V+EN E  E+I   +  V+E      AKL +  +    E L D +  K K+  +  T +
Sbjct: 1027 HVEENLEFEEQIT-WKTHVDEFVIDAIAKLNQRFQ---AERLTDENKNKGKEFAVLVTDD 1082

Query: 1012 NNL 1014
            +N+
Sbjct: 1083 DNM 1085

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 49,078,887
Number of extensions: 2218877
Number of successful extensions: 10951
Number of sequences better than 10.0: 364
Number of HSP's gapped: 11041
Number of HSP's successfully gapped: 539
Length of query: 1546
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1431
Effective length of database: 12,615,039
Effective search space: 18052120809
Effective search space used: 18052120809
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)