Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR324C60259224980.0
Scas_663.275591653063e-29
CAGL0G06314g6531652772e-25
Scas_592.145491652566e-23
YAL028W5281512272e-19
Sklu_2164.44651341399e-09
Kwal_26.70633781631202e-06
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR324C
         (592 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR324C (YOR324C) [5106] chr15 complement(923227..925035) Protei...   966   0.0  
Scas_663.27                                                           122   3e-29
CAGL0G06314g complement(603668..605629) some similarities with s...   111   2e-25
Scas_592.14                                                           103   6e-23
YAL028W (YAL028W) [40] chr1 (92903..94489) Protein of unknown fu...    92   2e-19
Sklu_2164.4 YAL028W, Contig c2164 3696-5093 reverse complement         58   9e-09
Kwal_26.7063                                                           51   2e-06

>YOR324C (YOR324C) [5106] chr15 complement(923227..925035) Protein
           of the endoplasmic reticulum membrane [1809 bp, 602 aa]
          Length = 602

 Score =  966 bits (2498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/592 (82%), Positives = 491/592 (82%)

Query: 1   MNLLIDRMENPGSRNCTLLPPSFPRGFCKGRRASSGDAVKIKESGXXXXXXXXXXXAKTN 60
           MNLLIDRMENPGSRNCTLLPPSFPRGFCKGRRASSGDAVKIKESG           AKTN
Sbjct: 1   MNLLIDRMENPGSRNCTLLPPSFPRGFCKGRRASSGDAVKIKESGLQPQPQPEPLQAKTN 60

Query: 61  VAHFSKSSSRLPVIAVNDNPVVPRPSTEVNLGSLLQXXXXXXXXXQPALHDRRHLYVTKN 120
           VAHFSKSSSRLPVIAVNDNPVVPRPSTEVNLGSLLQ         QPALHDRRHLYVTKN
Sbjct: 61  VAHFSKSSSRLPVIAVNDNPVVPRPSTEVNLGSLLQKEREKEKEEQPALHDRRHLYVTKN 120

Query: 121 RAHGVRQRSLEMTSLPVLGSTKTGKFSDFLFEDDIDNRVGRHSRSYSGASSLDDPFRVSP 180
           RAHGVRQRSLEMTSLPVLGSTKTGKFSDFLFEDDIDNRVGRHSRSYSGASSLDDPFRVSP
Sbjct: 121 RAHGVRQRSLEMTSLPVLGSTKTGKFSDFLFEDDIDNRVGRHSRSYSGASSLDDPFRVSP 180

Query: 181 KTDFNSNRARLSCLSKGRRGSMSVFQSCHTGLAFNQIXXXXXXXXXXXXXXFDYERKRLV 240
           KTDFNSNRARLSCLSKGRRGSMSVFQSCHTGLAFNQI              FDYERKRLV
Sbjct: 181 KTDFNSNRARLSCLSKGRRGSMSVFQSCHTGLAFNQIQGSSSSQRRSSAGSFDYERKRLV 240

Query: 241 NQFLQPSLGNSDPFDTLRESVVFEPSSTAGGIKLGNMHXXXXXXXXXXXXXXLFYHDLDG 300
           NQFLQPSLGNSDPFDTLRESVVFEPSSTAGGIKLGNMH              LFYHDLDG
Sbjct: 241 NQFLQPSLGNSDPFDTLRESVVFEPSSTAGGIKLGNMHSQSQISVNSSPSTSLFYHDLDG 300

Query: 301 SAVNDSSSFLYSRSNVPAFLXXXXXXXXXXXXXXXEDVDRRSLNGVYPSLGYLTNQRKPR 360
           SAVNDSSSFLYSRSNVPAFL               EDVDRRSLNGVYPSLGYLTNQRKPR
Sbjct: 301 SAVNDSSSFLYSRSNVPAFLSSSAFSSTSSTSSDSEDVDRRSLNGVYPSLGYLTNQRKPR 360

Query: 361 NSSGSSTAPGTDTLGFKYLLNRQKSADSSTRFKSVLKVNNNNGSAATPXXXXXXXXXXXX 420
           NSSGSSTAPGTDTLGFKYLLNRQKSADSSTRFKSVLKVNNNNGSAATP            
Sbjct: 361 NSSGSSTAPGTDTLGFKYLLNRQKSADSSTRFKSVLKVNNNNGSAATPDSSSNSISKSNS 420

Query: 421 XXXXXXXELNYYQNHISTLLVKIENEMRRNLNDTIIKNENNVQKTIQKYDXXXXXXXXXX 480
                  ELNYYQNHISTLLVKIENEMRRNLNDTIIKNENNVQKTIQKYD          
Sbjct: 421 NLNDNIDELNYYQNHISTLLVKIENEMRRNLNDTIIKNENNVQKTIQKYDLLSGELTLLL 480

Query: 481 XXXXXXXXXVINQFLVKLKSDFDEDDNKAFINELKISVEESVAQLQGLERRMEVCQERLN 540
                    VINQFLVKLKSDFDEDDNKAFINELKISVEESVAQLQGLERRMEVCQERLN
Sbjct: 481 DEMTTLRTTVINQFLVKLKSDFDEDDNKAFINELKISVEESVAQLQGLERRMEVCQERLN 540

Query: 541 KQKSSLREMDSLIELKNVLNKSKNNTKSIYLYRYFIIDIIAFLLMGGFIVYV 592
           KQKSSLREMDSLIELKNVLNKSKNNTKSIYLYRYFIIDIIAFLLMGGFIVYV
Sbjct: 541 KQKSSLREMDSLIELKNVLNKSKNNTKSIYLYRYFIIDIIAFLLMGGFIVYV 592

>Scas_663.27
          Length = 559

 Score =  122 bits (306), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 61/165 (36%), Positives = 98/165 (59%)

Query: 428 ELNYYQNHISTLLVKIENEMRRNLNDTIIKNENNVQKTIQKYDXXXXXXXXXXXXXXXXX 487
           ELNYYQ HI   L + E  +++NL   +IK+E ++  T+ K+D                 
Sbjct: 387 ELNYYQTHICNTLAEFERLLKQNLQTFVIKDEADLHGTLSKFDNLTFHLQNMKNRIDELY 446

Query: 488 XXVINQFLVKLKSDFDEDDNKAFINELKISVEESVAQLQGLERRMEVCQERLNKQKSSLR 547
             +  ++L K+K+ F+EDD  +F  EL+ SVE S+ QL+ LE RME CQ +L +Q+ ++R
Sbjct: 447 DVINEKYLSKIKTAFNEDDESSFEFELRTSVEASIKQLEELENRMEYCQLKLQEQRETMR 506

Query: 548 EMDSLIELKNVLNKSKNNTKSIYLYRYFIIDIIAFLLMGGFIVYV 592
           ++D+LI ++N L +SK N K IY YR+ + DI+   ++  F  +V
Sbjct: 507 QLDNLILIENSLLESKKNVKHIYSYRFLVFDILVIFVVLYFGYWV 551

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 66/165 (40%), Gaps = 39/165 (23%)

Query: 1   MNLLIDRMENPGSRNCTLLPPSFPRGFCKGRRASSGDAVKIKESGXXXXXXXXXXXAKTN 60
           MN LIDR+ENPG+R  TLLP SFP    K         +                 A + 
Sbjct: 1   MNFLIDRIENPGTR-TTLLPSSFPNKLQK--------KIDKSHEADLFSNNLKRKSAASK 51

Query: 61  VAHFSKSSS----RLPVIAVNDNPVVPRPSTEVNLGSLLQXXXXXXXXXQPALHDRRHLY 116
             H + + S    +LP++++ND P++    + + L S                  +RH  
Sbjct: 52  TRHLAPTKSQNNIKLPILSINDEPILESEPSRIGLASYF---------------SQRH-- 94

Query: 117 VTKNRAHGV------RQRSLEMTSLPVLGSTKTGKFSDFLFEDDI 155
              N   G+      R++ LE   LP   +   G FSD +F D +
Sbjct: 95  ---NSEEGLSFKTSSRRKHLESQPLPDYSAASLGTFSDCIFNDAL 136

>CAGL0G06314g complement(603668..605629) some similarities with
           sp|P39734 Saccharomyces cerevisiae YAL028w, hypothetical
           start
          Length = 653

 Score =  111 bits (277), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 100/165 (60%), Gaps = 2/165 (1%)

Query: 428 ELNYYQNHISTLLVKIENEMRRNLNDTIIKNENNVQKTIQKYDXXXXXXXXXXXXXXXXX 487
           E +YYQ HI++ L K+E++++ +L   I+K+E  ++  I  +D                 
Sbjct: 482 ETDYYQQHINSRLTKLESQIKNDLKSVILKDELELKNNITSFDNLTSDLQNLKSQILGLK 541

Query: 488 XXVINQFLVKLKSDFDEDDNKAFINELKISVEESVAQLQGLERRMEVCQERLNKQKSSLR 547
             + N++L  LK+DFDE++ ++F ++L+ +VEE+V  L+ LE +M  CQ +L  QK ++R
Sbjct: 542 NTIANEYLTVLKADFDENNPESFESQLRKTVEENVKHLEFLENKMSECQSQLVDQKETMR 601

Query: 548 EMDSLIELKNVLNKSKNNTKSIYLYRYFIIDI--IAFLLMGGFIV 590
           +M+SL+ L+N L  SK NT   Y YRY + DI  + FL++ G+ +
Sbjct: 602 KMESLLYLENSLMVSKKNTGLAYKYRYMLYDILTLGFLVLIGYYL 646

>Scas_592.14
          Length = 549

 Score =  103 bits (256), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 92/165 (55%), Gaps = 2/165 (1%)

Query: 428 ELNYYQNHISTLLVKIENEMRRNLNDTIIKNENNVQKTIQKYDXXXXXXXXXXXXXXXXX 487
           E++YYQ HI+  L K E  M+ NL D I+K EN++   +Q +D                 
Sbjct: 379 EIDYYQRHIAIRLKKSEALMKENLRDIILKRENDLHNNLQNFDTYLHDLKKLKYQIISLQ 438

Query: 488 XXVINQFLVKLKSDFDEDDNKAFINELKISVEESVAQLQGLERRMEVCQERLNKQKSSLR 547
             V N +LV LK DFD ++  +F N L   + ++V +LQ LERRME   ERLN+QK +++
Sbjct: 439 KLVRNDYLVILKEDFDVNNKNSFENHLTEILNKNVTKLQDLERRMESSGERLNEQKETMK 498

Query: 548 EMDSLIELKNVLNKSKNNTKSIYLYRYFIID--IIAFLLMGGFIV 590
            M++LI L+N L  S+ N   +   +  + D  ++  LL+ G+++
Sbjct: 499 RMENLINLENSLKLSQKNASWVSKNKAIVYDLSVVFILLLSGYLL 543

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 71/201 (35%), Gaps = 49/201 (24%)

Query: 1   MNLLIDRMENPGSRNCTLLPPSF--PRGFCKGRRASSGDAVK------------------ 40
           M+ LI RME+PG R+ + +  S   P     G   S   A K                  
Sbjct: 1   MDRLIARMEDPGKRSPSPMASSTEEPLTLVAGMNPSINRAKKKILRRETHTPENTSSEES 60

Query: 41  IKESGXXXXXXXXXXXAKTNVAHFSKSSSRLPVIAVNDNPVVPRPSTEVNLGSLLQXXXX 100
           +K SG            KT           +P I VN+ P+  +P               
Sbjct: 61  LKPSGSEMEEPKPETIPKT---------VEIPTIRVNNEPIEDQPK-------------L 98

Query: 101 XXXXXQPALHDRRHLYVTKNRAHGVRQRSLEMTSLPVLGSTKTGKFSDFLF-EDDIDNRV 159
                QP      +L     +A+G R+ +   +  P   S  TG FSD +F E   D  +
Sbjct: 99  VRQQSQP------NLVALGAKANGHRESATLRSGKPDYTSANTGMFSDHIFNESTADGLI 152

Query: 160 GRHSRSYSGASSLDDPFRVSP 180
            R +      ++ D+P +++P
Sbjct: 153 PRQNELPFMDTNTDNPVKLTP 173

>YAL028W (YAL028W) [40] chr1 (92903..94489) Protein of unknown
           function [1587 bp, 528 aa]
          Length = 528

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 83/151 (54%)

Query: 428 ELNYYQNHISTLLVKIENEMRRNLNDTIIKNENNVQKTIQKYDXXXXXXXXXXXXXXXXX 487
           EL+YYQ HI   L + E  ++ +L D ++K+EN++ K I  +D                 
Sbjct: 357 ELDYYQRHIGLQLQQTEALLKHSLKDEVLKDENDLVKNIANFDKIVKELRDLRSRTIGWK 416

Query: 488 XXVINQFLVKLKSDFDEDDNKAFINELKISVEESVAQLQGLERRMEVCQERLNKQKSSLR 547
             V   +L+ LK DFD+++ ++F   L  ++  +VA+LQ LE+RM  C++RL  +K  +R
Sbjct: 417 ELVEEDYLMNLKQDFDKENPESFEARLSDTINTNVAKLQDLEKRMASCKDRLASRKEVMR 476

Query: 548 EMDSLIELKNVLNKSKNNTKSIYLYRYFIID 578
           +M+SL+ L+N L  SK N      YR   +D
Sbjct: 477 KMESLLSLENSLMISKKNVTFASKYRNEALD 507

>Sklu_2164.4 YAL028W, Contig c2164 3696-5093 reverse complement
          Length = 465

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 72/134 (53%)

Query: 432 YQNHISTLLVKIENEMRRNLNDTIIKNENNVQKTIQKYDXXXXXXXXXXXXXXXXXXXVI 491
           Y+ +I   + K E+ ++  + D +   E  ++ + Q                      V 
Sbjct: 295 YKEYIVNEIDKFESIIKNTVTDVLCMKEKYMEHSFQTLSTLEKELRRIRTRIVELHYEVK 354

Query: 492 NQFLVKLKSDFDEDDNKAFINELKISVEESVAQLQGLERRMEVCQERLNKQKSSLREMDS 551
             +LV+L++ F+  D+++FI++L   ++E ++ L+ LE R++  ++ L +QK++L +M+S
Sbjct: 355 ENYLVELETHFNATDSESFISQLDEIIQEHLSSLEKLEVRIKNSKDVLARQKNALEDMES 414

Query: 552 LIELKNVLNKSKNN 565
           +++LK ++  SK N
Sbjct: 415 IVKLKQLVADSKKN 428

>Kwal_26.7063
          Length = 378

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 75/163 (46%), Gaps = 4/163 (2%)

Query: 433 QNHISTLLVKIENEMRRNLNDTIIKNENNVQKTIQKYDXXXXXXXXXXXXXXXXXXXVIN 492
           Q + +  L K ++ +R +L  +I  +E+ + KT  + D                   + +
Sbjct: 208 QQYFANELSKFDHYIR-DLMASISSDESRITKTRTELDDLQQHIREAKSVIKDIDRCIQD 266

Query: 493 QFLVKLKSDFDEDDNKAFINELKISVEESVAQLQGLERRMEVCQERLNKQKSSLREMDSL 552
           Q +  L+  F+ +D  +FI+    ++      L   E+R+  C+  L  QK+++ ++++ 
Sbjct: 267 QDIKMLRKSFESEDESSFISRFSAAIATYSESLASFEKRIGKCKVDLTTQKATVHKLETT 326

Query: 553 IELKNVLNKSKNNT---KSIYLYRYFIIDIIAFLLMGGFIVYV 592
           I+L  ++  S++N      I  Y+  I D  A +L+   IV +
Sbjct: 327 IKLNEMIQDSQSNMCFLDRIREYKGLIYDFCALILLIALIVVL 369

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,193,437
Number of extensions: 597701
Number of successful extensions: 2176
Number of sequences better than 10.0: 28
Number of HSP's gapped: 2230
Number of HSP's successfully gapped: 30
Length of query: 592
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 485
Effective length of database: 12,891,983
Effective search space: 6252611755
Effective search space used: 6252611755
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)