Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR323C (PRO2)45644923700.0
Sklu_2164.250844819450.0
Scas_663.345744919340.0
Kwal_26.706745744818610.0
CAGL0F00693g45544918490.0
KLLA0A03982g44744917940.0
ADR351C45244616260.0
Sklu_1149.229669710.88
ADL066C560177710.97
AEL062C38392711.0
YFR045W28554701.3
Kwal_27.10298882132711.4
Kwal_26.796729769691.8
YBR291C (CTP1)29969682.0
Scas_717.7452293682.5
YFR025C (HIS2)33584673.0
AFR439C31064673.1
Scas_489.429769663.4
KLLA0B13794g93657639.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR323C
         (449 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR323C (PRO2) [5105] chr15 complement(921530..922900) Gamma-glu...   917   0.0  
Sklu_2164.2 YOR323C, Contig c2164 742-2268 reverse complement         753   0.0  
Scas_663.3                                                            749   0.0  
Kwal_26.7067                                                          721   0.0  
CAGL0F00693g 79324..80691 highly similar to sp|P54885 Saccharomy...   716   0.0  
KLLA0A03982g 354208..355551 highly similar to sp|P54885 Saccharo...   695   0.0  
ADR351C [2092] [Homologous to ScYOR323C (PRO2) - SH] (1324789..1...   630   0.0  
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         32   0.88 
ADL066C [1675] [Homologous to ScYER065C (ICL1) - SH] (563788..56...    32   0.97 
AEL062C [2444] [Homologous to ScYJR032W (CPR7) - SH] (519416..52...    32   1.0  
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    32   1.3  
Kwal_27.10298                                                          32   1.4  
Kwal_26.7967                                                           31   1.8  
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    31   2.0  
Scas_717.74                                                            31   2.5  
YFR025C (HIS2) [1705] chr6 complement(203731..204738) Histidinol...    30   3.0  
AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH] (1...    30   3.1  
Scas_489.4                                                             30   3.4  
KLLA0B13794g 1206318..1209128 gi|28565040|gb|AAO32603.1 Kluyvero...    29   9.8  

>YOR323C (PRO2) [5105] chr15 complement(921530..922900)
           Gamma-glutamyl phosphate reductase (phosphoglutamate
           dehydrogenase), proline biosynthetic enzyme [1371 bp,
           456 aa]
          Length = 456

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/449 (100%), Positives = 449/449 (100%)

Query: 1   MSSSQQIAKNARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGL 60
           MSSSQQIAKNARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGL
Sbjct: 1   MSSSQQIAKNARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGL 60

Query: 61  ADSLLKRLDLFKGDKFEVMLQGIKDVAELEDPVGKVKMARELDDGLTLYQVTAPVGVLLV 120
           ADSLLKRLDLFKGDKFEVMLQGIKDVAELEDPVGKVKMARELDDGLTLYQVTAPVGVLLV
Sbjct: 61  ADSLLKRLDLFKGDKFEVMLQGIKDVAELEDPVGKVKMARELDDGLTLYQVTAPVGVLLV 120

Query: 121 IFESRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSV 180
           IFESRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSV
Sbjct: 121 IFESRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSV 180

Query: 181 QLIETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADL 240
           QLIETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADL
Sbjct: 181 QLIETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADL 240

Query: 241 IKAKRISLDAKTNYPAGCNAMETLLINPKFSKWWEVLENLTLEGGVTIHATKDLKTAYFD 300
           IKAKRISLDAKTNYPAGCNAMETLLINPKFSKWWEVLENLTLEGGVTIHATKDLKTAYFD
Sbjct: 241 IKAKRISLDAKTNYPAGCNAMETLLINPKFSKWWEVLENLTLEGGVTIHATKDLKTAYFD 300

Query: 301 KLNELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAI 360
           KLNELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAI
Sbjct: 301 KLNELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAI 360

Query: 361 VTENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVS 420
           VTENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVS
Sbjct: 361 VTENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVS 420

Query: 421 YQYQIRGDGQVASDYLGAGGNKAFVHKDL 449
           YQYQIRGDGQVASDYLGAGGNKAFVHKDL
Sbjct: 421 YQYQIRGDGQVASDYLGAGGNKAFVHKDL 449

>Sklu_2164.2 YOR323C, Contig c2164 742-2268 reverse complement
          Length = 508

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/448 (81%), Positives = 403/448 (89%)

Query: 2   SSSQQIAKNARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGLA 61
           S++++IA+ AR AGNILKT+S+E RS ILY IHD LKANA +IE+ANK+DL  AKET L+
Sbjct: 54  STAEKIAQKARLAGNILKTLSDEQRSKILYIIHDGLKANAESIEKANKVDLQNAKETNLS 113

Query: 62  DSLLKRLDLFKGDKFEVMLQGIKDVAELEDPVGKVKMARELDDGLTLYQVTAPVGVLLVI 121
           DSL+KRLDLFKGDKFE MLQGIKDVAELEDPVGK+KMARELD+ LTLYQVTAPVGVLLVI
Sbjct: 114 DSLIKRLDLFKGDKFETMLQGIKDVAELEDPVGKIKMARELDENLTLYQVTAPVGVLLVI 173

Query: 122 FESRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSVQ 181
           FESRPEVIANITALSIKSGNAAILKGGKESVNTFREM++I+N  IA+ +  TGVP G+VQ
Sbjct: 174 FESRPEVIANITALSIKSGNAAILKGGKESVNTFREMSRIINTIIAENEKLTGVPSGAVQ 233

Query: 182 LIETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADLI 241
           LIETRQDVSDLLDQD YIDLVVPRGSNALVR+IK +TKIPVLGHADGICSIYLDEDADL 
Sbjct: 234 LIETRQDVSDLLDQDAYIDLVVPRGSNALVRQIKCSTKIPVLGHADGICSIYLDEDADLE 293

Query: 242 KAKRISLDAKTNYPAGCNAMETLLINPKFSKWWEVLENLTLEGGVTIHATKDLKTAYFDK 301
           KAKRI+LDAKTNYPAGCNA+ET+LINP    WWEVLENLTLEG V +H TKD+K AY  K
Sbjct: 294 KAKRITLDAKTNYPAGCNAVETILINPALKNWWEVLENLTLEGNVIVHLTKDVKEAYVSK 353

Query: 302 LNELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAIV 361
           L E GKL EA++ K V+A+E +DFDKEFLSLD A KFV+ST+ A+QHIN HSS+HTDAI+
Sbjct: 354 LKENGKLDEALEQKIVEANEAEDFDKEFLSLDCAVKFVSSTQEAVQHINLHSSKHTDAII 413

Query: 362 TENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVSY 421
           TENK +AE F+KGVDSSGVYWNASTRFADGFRYGFG EVGISTSKIHARGPVGLDGLVSY
Sbjct: 414 TENKEDAEFFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 473

Query: 422 QYQIRGDGQVASDYLGAGGNKAFVHKDL 449
           QYQIRG GQVASDYLGAGGNKAF+HKDL
Sbjct: 474 QYQIRGTGQVASDYLGAGGNKAFIHKDL 501

>Scas_663.3
          Length = 457

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/449 (80%), Positives = 397/449 (88%)

Query: 1   MSSSQQIAKNARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGL 60
           MSS+QQIA+ AR AGN LKTISN+ RS ILYKI DALKA A  IE ANK+DL  AKET L
Sbjct: 1   MSSAQQIAQRARMAGNSLKTISNDNRSAILYKIRDALKAGASDIEAANKLDLQNAKETHL 60

Query: 61  ADSLLKRLDLFKGDKFEVMLQGIKDVAELEDPVGKVKMARELDDGLTLYQVTAPVGVLLV 120
           +DSLLKRLDLFKGDKFE MLQGIKDVA+LEDPVGK+KMARELD+GLTLYQVTAPVGVLLV
Sbjct: 61  SDSLLKRLDLFKGDKFETMLQGIKDVADLEDPVGKIKMARELDEGLTLYQVTAPVGVLLV 120

Query: 121 IFESRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSV 180
           IFESRPEVIANITAL IKSGNA ILKGGKESVNTFREM++I+NDTI + + ETGVPVG+V
Sbjct: 121 IFESRPEVIANITALCIKSGNAGILKGGKESVNTFREMSRIINDTIEKNEKETGVPVGAV 180

Query: 181 QLIETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADL 240
           QLIETRQDV+DLLDQDEYIDLVVPRGSNALVR IK++TKIPVLGHADGICS+Y+DE+ADL
Sbjct: 181 QLIETRQDVNDLLDQDEYIDLVVPRGSNALVRNIKNSTKIPVLGHADGICSVYIDEEADL 240

Query: 241 IKAKRISLDAKTNYPAGCNAMETLLINPKFSKWWEVLENLTLEGGVTIHATKDLKTAYFD 300
            KAKRI  DAKTNYPAGCNAMETLLINP    WWEVLEN+T +G VT+H   D+K AY D
Sbjct: 241 EKAKRIVFDAKTNYPAGCNAMETLLINPSCPNWWEVLENVTRKGDVTLHCMPDVKKAYLD 300

Query: 301 KLNELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAI 360
           KL +LG   + I+  TVD DE+ DFDKEFLSLD A KFV STE AI+HIN HSSRHTDAI
Sbjct: 301 KLTQLGTSDDVIKTHTVDVDEKHDFDKEFLSLDCAVKFVNSTEEAIKHINVHSSRHTDAI 360

Query: 361 VTENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVS 420
           VTENK +AE F+KGVDSSGVYWNASTRFADGFRYGFG EVGISTSKIHARGPVGLDGLVS
Sbjct: 361 VTENKDSAELFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVS 420

Query: 421 YQYQIRGDGQVASDYLGAGGNKAFVHKDL 449
           YQYQIRG+GQ+A DYLGAGGN+AF+HKDL
Sbjct: 421 YQYQIRGNGQIAGDYLGAGGNRAFIHKDL 449

>Kwal_26.7067
          Length = 457

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/448 (76%), Positives = 395/448 (88%)

Query: 2   SSSQQIAKNARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGLA 61
           S+S+ IAKNAR  GN+LKTISNE RS +LYKIHD LKANA++I+EANK DL +AKE  LA
Sbjct: 3   SNSETIAKNARLGGNVLKTISNEARSSLLYKIHDGLKANANSIKEANKKDLEIAKEANLA 62

Query: 62  DSLLKRLDLFKGDKFEVMLQGIKDVAELEDPVGKVKMARELDDGLTLYQVTAPVGVLLVI 121
           DSL +RLDLFKGDKF+ ML GIKDVAELEDPVGK+K+ARELD+ L LYQVTAPVG LLVI
Sbjct: 63  DSLYRRLDLFKGDKFDTMLVGIKDVAELEDPVGKIKLARELDENLNLYQVTAPVGALLVI 122

Query: 122 FESRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSVQ 181
           FESRPEVIANIT+L+IKSGNAAILKGGKESV+TFRE+++I+N  I++ ++ +G+P   +Q
Sbjct: 123 FESRPEVIANITSLAIKSGNAAILKGGKESVHTFREISRIINTVISENEASSGIPASVIQ 182

Query: 182 LIETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADLI 241
           LIETRQDVSDLL QD YIDLVVPRGSN LVRKIK +TKIPVLGHADGICSIYLDE+ADL 
Sbjct: 183 LIETRQDVSDLLQQDMYIDLVVPRGSNELVRKIKASTKIPVLGHADGICSIYLDEEADLQ 242

Query: 242 KAKRISLDAKTNYPAGCNAMETLLINPKFSKWWEVLENLTLEGGVTIHATKDLKTAYFDK 301
           KA RI++DAKT+YPAGCNAMETLLINPK S+WW+VLENL+  G VT+H T+D+K +YF K
Sbjct: 243 KALRITIDAKTSYPAGCNAMETLLINPKMSQWWKVLENLSKTGDVTLHVTEDVKASYFAK 302

Query: 302 LNELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAIV 361
           L E  +L + I  KTVDA+  +DFDKEFLSLD A KFV+STE A+ HIN HSS+HTDAI+
Sbjct: 303 LAESNELDDVITKKTVDANTSEDFDKEFLSLDCAVKFVSSTEDAVSHINLHSSKHTDAII 362

Query: 362 TENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVSY 421
           TENK+NAE FMKGVDSSGVYWNASTRFADGFRYGFG EVGISTSKIHARGPVGLDGLVSY
Sbjct: 363 TENKSNAEYFMKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 422

Query: 422 QYQIRGDGQVASDYLGAGGNKAFVHKDL 449
           QYQ+RGDGQ+ASDY+G+GG +AFVHK+L
Sbjct: 423 QYQLRGDGQIASDYVGSGGKRAFVHKNL 450

>CAGL0F00693g 79324..80691 highly similar to sp|P54885 Saccharomyces
           cerevisiae YOR323c PRO2 gamma-glutamyl phosphate
           reductase, start by similarity
          Length = 455

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/449 (77%), Positives = 393/449 (87%), Gaps = 1/449 (0%)

Query: 1   MSSSQQIAKNARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGL 60
           MSS+++IAK AR AGN+LKTIS+E RS ILY+I DAL      IE ANK DL  A+  GL
Sbjct: 1   MSSAEKIAKQARVAGNVLKTISDENRSKILYRIRDALANAKDEIESANKEDLEQARAGGL 60

Query: 61  ADSLLKRLDLFKGDKFEVMLQGIKDVAELEDPVGKVKMARELDDGLTLYQVTAPVGVLLV 120
           ADSL+KRLDLFKGDKF+VMLQGI DVA+LEDPVGKVKMARE+D+GL LYQVTAPVGV+LV
Sbjct: 61  ADSLVKRLDLFKGDKFDVMLQGISDVADLEDPVGKVKMAREIDNGLMLYQVTAPVGVILV 120

Query: 121 IFESRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSV 180
           IFESRPEVIANITAL IKSGNA ILKGGKESVNTF+ MAK+VN TI Q++ ETGVPVG+V
Sbjct: 121 IFESRPEVIANITALCIKSGNAGILKGGKESVNTFKAMAKVVNQTIEQYKDETGVPVGAV 180

Query: 181 QLIETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADL 240
           QLIETRQDVSDLL QDEYIDLVVPRGSN+LVR+IKD+TKIPVLGHADGICSIY+D DADL
Sbjct: 181 QLIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDSTKIPVLGHADGICSIYVDRDADL 240

Query: 241 IKAKRISLDAKTNYPAGCNAMETLLINPKFSKWWEVLENLTLEGGVTIHATKDLKTAYFD 300
            KAKRI LDAKTNYPAGCNAME LL+NP FS+W +VL +L  EGGVTIHAT D+K A+  
Sbjct: 241 EKAKRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDVLHHLITEGGVTIHATTDVKEAFLK 300

Query: 301 KLNELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAI 360
           KL + GKL + I+ K VDA ++ DFDKEFLSLD A KF+ +T  AI HIN HSS+HTDAI
Sbjct: 301 KLQDSGKLNDDIKAKIVDA-KDGDFDKEFLSLDCAVKFIPNTVDAINHINEHSSKHTDAI 359

Query: 361 VTENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVS 420
           +TE+K +AEKF+KG+DSSGVYWNASTRFADGFRYGFG EVGISTSKIHARGPVGLDGLV+
Sbjct: 360 ITESKEDAEKFLKGIDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVT 419

Query: 421 YQYQIRGDGQVASDYLGAGGNKAFVHKDL 449
           YQYQIRGDGQVASDYLGAGGNKAFVHKD+
Sbjct: 420 YQYQIRGDGQVASDYLGAGGNKAFVHKDI 448

>KLLA0A03982g 354208..355551 highly similar to sp|P54885
           Saccharomyces cerevisiae YOR323c PRO2 gamma-glutamyl
           phosphate reductase singleton, start by similarity
          Length = 447

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/449 (75%), Positives = 381/449 (84%), Gaps = 9/449 (2%)

Query: 1   MSSSQQIAKNARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGL 60
           MS S+ IAK AR AGNILKT+S+E RS ILYKIHD LKANA +IE ANK+DL  AK T L
Sbjct: 1   MSVSESIAKTARAAGNILKTLSDEERSSILYKIHDGLKANAASIEAANKLDLEQAKSTNL 60

Query: 61  ADSLLKRLDLFKGDKFEVMLQGIKDVAELEDPVGKVKMARELDDGLTLYQVTAPVGVLLV 120
           +DSL+KRLDLFKGDKFE MLQGI DVA L+DPVGKV  ARE+D+ LTLYQ+TAPVGVLLV
Sbjct: 61  SDSLVKRLDLFKGDKFETMLQGIVDVANLQDPVGKVNFAREIDENLTLYQITAPVGVLLV 120

Query: 121 IFESRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSV 180
           IFESRPEVIANITALSIKSGNAAILKGGKES+NTF+EM++IVND + Q +  T VPVG+V
Sbjct: 121 IFESRPEVIANITALSIKSGNAAILKGGKESLNTFKEMSRIVNDVVEQNEKTTHVPVGAV 180

Query: 181 QLIETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADL 240
           QLIETR+DVSDLL QDEYIDLV+PRGSNALVR+IK +TKIPVLGHADGICSIY+DE AD+
Sbjct: 181 QLIETREDVSDLLQQDEYIDLVIPRGSNALVRQIKSSTKIPVLGHADGICSIYVDESADI 240

Query: 241 IKAKRISLDAKTNYPAGCNAMETLLINPKFSKWWEVLENLTLEGGVTIHATKDLKTAYFD 300
            KAKRI +DAKTNYPAGCNA+ETLLINPK   WWEVL +L +E GVT+H +K++K  Y  
Sbjct: 241 GKAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSL-IENGVTLHVSKEVKKQY-- 297

Query: 301 KLNELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAI 360
                 K   +     VD DE +DFDKEFLSLD+A  FV STE+A+ HINTHSS+HTDAI
Sbjct: 298 ------KEHNSTSDHIVDLDESKDFDKEFLSLDIAVAFVESTEAAVLHINTHSSKHTDAI 351

Query: 361 VTENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVS 420
           VTEN  NAE F+K VDSS VYWNASTRFADGFRYGFG EVGISTSKIHARGPVGLDGLV+
Sbjct: 352 VTENSENAEYFLKAVDSSSVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVT 411

Query: 421 YQYQIRGDGQVASDYLGAGGNKAFVHKDL 449
           YQYQ+RG+GQ+ASDYLGAGG KAFVHKDL
Sbjct: 412 YQYQLRGNGQIASDYLGAGGKKAFVHKDL 440

>ADR351C [2092] [Homologous to ScYOR323C (PRO2) - SH]
           (1324789..1326147) [1359 bp, 452 aa]
          Length = 452

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/446 (68%), Positives = 366/446 (82%), Gaps = 5/446 (1%)

Query: 4   SQQIAKNARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGLADS 63
           ++ IAK AR AGN+LKT+SNE R+ +L +IHD L A    I +AN+ DL  A +  LA +
Sbjct: 5   AESIAKKARVAGNVLKTLSNEQRTGVLRRIHDGLLAKKEDIRKANEADLETAAQNNLAPA 64

Query: 64  LLKRLDLFKGDKFEVMLQGIKDVAELEDPVGKVKMARELDDGLTLYQVTAPVGVLLVIFE 123
           L++RL+LFKGDKFE MLQGI DVA LEDPVGK++M RELD+GLTLY+VTAPVGV+L+IFE
Sbjct: 65  LVQRLNLFKGDKFEAMLQGILDVAALEDPVGKLQMVRELDEGLTLYKVTAPVGVMLIIFE 124

Query: 124 SRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSVQLI 183
           SRPEVIANI+AL IKSGNA ILKGGKE+VNTFRE+A ++N  +A+ + ETGVPV +VQL+
Sbjct: 125 SRPEVIANISALCIKSGNAGILKGGKETVNTFRELAAVINLVLAESEPETGVPVHAVQLV 184

Query: 184 ETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADLIKA 243
           E+R +VSDLL QDEYIDLVVPRGSNALV++IK +TKIPVLGHADGICSIYLD DADL KA
Sbjct: 185 ESRSEVSDLLQQDEYIDLVVPRGSNALVKQIKASTKIPVLGHADGICSIYLDADADLAKA 244

Query: 244 KRISLDAKTNYPAGCNAMETLLINPKFSKWWEVLENLTLEGGVTIHATKDLKTAYFDKLN 303
           KRI LD+KTNY A CNA E+LLINP+ S W EVL +L + G V +H T D+K A+F    
Sbjct: 245 KRIVLDSKTNYCAACNAAESLLINPRCSGWEEVLAHLIIAGNVKLHVTSDVKEAFFAYAG 304

Query: 304 ELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAIVTE 363
           +      A++   VDA EE DF +EFLSLD+A KF+ S + A+ HIN HSS+HTDAIVTE
Sbjct: 305 D----DAALKGNVVDA-EEGDFSREFLSLDIAVKFIDSVQEAVIHINEHSSKHTDAIVTE 359

Query: 364 NKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVSYQY 423
            K  A+ F+KG+DS+GVYWNASTRFADGFRYGFG EVGISTSKIHARGPVGLDGLV+YQY
Sbjct: 360 CKQTADFFLKGIDSAGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQY 419

Query: 424 QIRGDGQVASDYLGAGGNKAFVHKDL 449
           Q+RG GQVASDY+GAGG++AFVHKDL
Sbjct: 420 QVRGTGQVASDYIGAGGDRAFVHKDL 445

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 32.0 bits (71), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 5/69 (7%)

Query: 222 VLGHADGICSIYLDEDADLIKAKRISLDAKTNYPAGCNAMETLLINPKFSKWWE----VL 277
           V+G   GI ++Y     D +K +  SLD+K  Y +  N   T+        +W+     L
Sbjct: 216 VVGAFSGIVTVYTTMPIDTVKTRMQSLDSK-RYSSTINCFTTIFKEEGLKAFWKGATPRL 274

Query: 278 ENLTLEGGV 286
             L L GG+
Sbjct: 275 GRLFLSGGI 283

>ADL066C [1675] [Homologous to ScYER065C (ICL1) - SH]
           (563788..565470) [1683 bp, 560 aa]
          Length = 560

 Score = 32.0 bits (71), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 71/177 (40%), Gaps = 25/177 (14%)

Query: 166 IAQFQSETGVPVGSVQLIETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVL-- 223
           IA+F S+ G P     + E R+   +LL QD Y D  +PR    L R  K  T+  ++  
Sbjct: 341 IAKFNSQIG-PQTGASIREMRKLGRELLGQDVYFDWDLPRAREGLYR-YKGGTQCAIMRA 398

Query: 224 -GHADGICSIYLDED-ADLIKAKRISLDAKTNYPAGCNAMETLLINPKFSKWWEVLENLT 281
              A     ++ + +  D  +AK  +   +  +P   N      ++P F+ W + +    
Sbjct: 399 RAFAPYADLVWFESNFPDFQQAKEFAQGVREKFP---NKWMAYNLSPSFN-WPKAMPPKE 454

Query: 282 LEGGVTIHATKDLKTAYFDKLNELGKLTEAIQCKTV--DADEEQDFDKEFLSLDLAA 336
            E              Y  +L E+G + + I    +  +A    +F +EF    + A
Sbjct: 455 QEN-------------YIQRLGEIGYVWQFITLAGLHTNALAIDNFSREFSRFGMRA 498

>AEL062C [2444] [Homologous to ScYJR032W (CPR7) - SH]
           (519416..520567) [1152 bp, 383 aa]
          Length = 383

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 5/92 (5%)

Query: 263 TLLINPKFSKWWEVLENLTLEGGVTIHATKDLKTAYFDKLNELGKLTEAIQCKTVDADEE 322
           TL    +F K +     L  E G  +   KD + A+F     L  + E I    +DA++ 
Sbjct: 217 TLFGGEEFGKAYAAAV-LIKESGTQLLKRKDFQNAFFKYRKSLNYVNEYIPDVDIDAEQF 275

Query: 323 QDFD----KEFLSLDLAAKFVTSTESAIQHIN 350
           + F+    K +L++ LA   + S +SAI + N
Sbjct: 276 EKFNVLKQKLYLNMTLALFNMGSYDSAISYTN 307

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/54 (22%), Positives = 26/54 (48%)

Query: 222 VLGHADGICSIYLDEDADLIKAKRISLDAKTNYPAGCNAMETLLINPKFSKWWE 275
           + G A     + + +  D++K + +S +AKT Y    N M  + +    + +W+
Sbjct: 199 ITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWK 252

>Kwal_27.10298
          Length = 882

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 55/132 (41%), Gaps = 23/132 (17%)

Query: 298 YFDKLNELGKLTEAI--------QCKTVD--ADEEQDFDKEFLSLDLAAKFVTSTESAIQ 347
           Y DKL  L KLT  I        Q   VD  AD+E    KE+ S D+   +V     + Q
Sbjct: 184 YIDKLYSLPKLTTPIEIDIRVTKQPAVVDKKADDESIL-KEYTSGDIIHGYVVIENRSNQ 242

Query: 348 HIN------THSSRHTDAIVTENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAE-- 399
            +N      T   R T       K   ++F++ VD S  +   +   A+G  Y  G +  
Sbjct: 243 RLNFEMFYVTLEGRATTVDRNCGKRTVKRFLRMVDLSASWSYTTIEVANGLNYVPGHKDF 302

Query: 400 ----VGISTSKI 407
               VG++ S++
Sbjct: 303 ENCFVGLNNSRV 314

>Kwal_26.7967
          Length = 297

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 5/69 (7%)

Query: 222 VLGHADGICSIYLDEDADLIKAKRISLDAKTNYPAGCNAMETLLINPKFSKWWE----VL 277
           V+G   GI ++Y     D +K +  SLD+ + Y +  N   T+        +W+     L
Sbjct: 216 VVGAFSGIVTVYTTMPIDTVKTRMQSLDS-SKYSSTINCFATVFREEGLKTFWKGATPRL 274

Query: 278 ENLTLEGGV 286
             L L GG+
Sbjct: 275 GRLILSGGI 283

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 5/69 (7%)

Query: 222 VLGHADGICSIYLDEDADLIKAKRISLDAKTNYPAGCNAMETLLINPKFSKWWE----VL 277
           ++G   GI ++Y     D +K +  SLD+ T Y +  N   T+        +W+     L
Sbjct: 219 LVGAFSGIVTVYSTMPLDTVKTRMQSLDS-TKYSSTMNCFATIFKEEGLKTFWKGATPRL 277

Query: 278 ENLTLEGGV 286
             L L GG+
Sbjct: 278 GRLVLSGGI 286

>Scas_717.74
          Length = 522

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 47/93 (50%), Gaps = 9/93 (9%)

Query: 116 GVLLVIFESRPEVIANI-TALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETG 174
            VL++   + P ++A +  A +I +GN+ ILK  + + +T   M +I+         E G
Sbjct: 126 NVLVISPFNFPVLLALVPVAHAIGAGNSVILKPSERTAHTALVMQRII--------EEAG 177

Query: 175 VPVGSVQLIETRQDVSDLLDQDEYIDLVVPRGS 207
            P G VQ+++   D +  L   + +D++   GS
Sbjct: 178 FPDGLVQVVQGAIDETQRLITSKDLDMIFYTGS 210

>YFR025C (HIS2) [1705] chr6 complement(203731..204738) Histidinol
           phosphatase [1008 bp, 335 aa]
          Length = 335

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 10/84 (11%)

Query: 118 LLVIFESRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPV 177
           LL  F+S+ E++ NI  L +         G  +    F     +VN        ETGVPV
Sbjct: 159 LLSYFQSQYEMLINIKPLVV---------GHFDLYKLFLPNDMLVNQKSGNCNEETGVPV 209

Query: 178 GSVQLIETRQDVSDLLDQD-EYID 200
            S+ +I    ++ D + ++ ++ID
Sbjct: 210 ASLDVISEWPEIYDAVVRNLQFID 233

>AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH]
           (1228716..1229648) [933 bp, 310 aa]
          Length = 310

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%)

Query: 328 EFLSLDLAAKFVTSTESAIQHINTHSSRHTDAIVTENKANAEKFMKGVDSSGVYWNASTR 387
           E+  L+L  + V S  +AI      SS  T  I T     A+  + GV+    Y   S +
Sbjct: 69  EWTPLELEERIVLSKNAAIYRFKLRSSVETLDIPTGFHLAAKVMLDGVEEVRYYTPISNK 128

Query: 388 FADG 391
           FA+G
Sbjct: 129 FAEG 132

>Scas_489.4
          Length = 297

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 5/69 (7%)

Query: 222 VLGHADGICSIYLDEDADLIKAKRISLDAKTNYPAGCNAMETLLINPKFSKWWE----VL 277
           ++G   G+ ++Y     D +K +  SLDA T Y +  N    +        +W+     L
Sbjct: 217 IVGAFSGVVTVYTTMPIDTVKTRMQSLDA-TKYTSTVNCFAKIFKEEGLKTFWKGATPRL 275

Query: 278 ENLTLEGGV 286
             L L GG+
Sbjct: 276 GRLILSGGI 284

>KLLA0B13794g 1206318..1209128 gi|28565040|gb|AAO32603.1
           Kluyveromyces lactis MNN4, hypothetical start
          Length = 936

 Score = 28.9 bits (63), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 17  ILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGLADSLLKRLDLFKG 73
           +L+ ++  G S +L  IH+AL  NA+ ++E   +D+   K+    D  L  LD+F+ 
Sbjct: 770 LLENMATSGYSLMLSTIHNALSLNAYRVKE---LDITYDKDLS-RDEKLDLLDIFRN 822

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,835,888
Number of extensions: 604983
Number of successful extensions: 1440
Number of sequences better than 10.0: 31
Number of HSP's gapped: 1435
Number of HSP's successfully gapped: 31
Length of query: 449
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 344
Effective length of database: 12,961,219
Effective search space: 4458659336
Effective search space used: 4458659336
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 63 (28.9 bits)