Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR322C81880436230.0
Scas_643.24d78467017610.0
CAGL0F00737g79571915600.0
KLLA0A04103g78581313960.0
ACR291C68456911611e-148
Scas_30.1d72541363e-10
Kwal_26.7100178471339e-09
Scas_607.973569703.2
YMR001C (CDC5)70556686.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR322C
         (804 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR322C (YOR322C) [5104] chr15 complement(918601..921057) Protei...  1400   0.0  
Scas_643.24d                                                          682   0.0  
CAGL0F00737g 82773..85160 similar to tr|Q12502 Saccharomyces cer...   605   0.0  
KLLA0A04103g 369258..371615 similar to sgd|S0005849 Saccharomyce...   542   0.0  
ACR291C [1338] [Homologous to ScYOR322C - SH] (888927..890981) [...   451   e-148
Scas_30.1d                                                             57   3e-10
Kwal_26.7100                                                           56   9e-09
Scas_607.9                                                             32   3.2  
YMR001C (CDC5) [3966] chr13 complement(269019..271136) Serine/th...    31   6.1  

>YOR322C (YOR322C) [5104] chr15 complement(918601..921057) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.578p [2457 bp, 818 aa]
          Length = 818

 Score = 1400 bits (3623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 707/804 (87%), Positives = 707/804 (87%)

Query: 1   MAFSRLTSTHQSNHNGYSNSNKKGQSLPLTLSIDVESPPCVLYGSAMESSGAVLSGLFTV 60
           MAFSRLTSTHQSNHNGYSNSNKKGQSLPLTLSIDVESPPCVLYGSAMESSGAVLSGLFTV
Sbjct: 1   MAFSRLTSTHQSNHNGYSNSNKKGQSLPLTLSIDVESPPCVLYGSAMESSGAVLSGLFTV 60

Query: 61  TVVDPYSSAEDKSLKNTESNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
           TVVDPYSSAEDKSLKNTESNV                                       
Sbjct: 61  TVVDPYSSAEDKSLKNTESNVSTTSKSLKRKSTFGSALSSRLSSLSASTSNISPSTSSTS 120

Query: 121 XXXXXXXXNLRIMAGYTKITITSVTLSLVQKIHFHKPFVPNISSMQTCMNCKTKITNMKS 180
                   NLRIMAGYTKITITSVTLSLVQKIHFHKPFVPNISSMQTCMNCKTKITNMKS
Sbjct: 121 ISHSPTPANLRIMAGYTKITITSVTLSLVQKIHFHKPFVPNISSMQTCMNCKTKITNMKS 180

Query: 181 WEIQSNTQDLSVGSHSYPFSYLIPGSVPCSSSLGATAETQVKYELIAVVTYIDPHRNSFS 240
           WEIQSNTQDLSVGSHSYPFSYLIPGSVPCSSSLGATAETQVKYELIAVVTYIDPHRNSFS
Sbjct: 181 WEIQSNTQDLSVGSHSYPFSYLIPGSVPCSSSLGATAETQVKYELIAVVTYIDPHRNSFS 240

Query: 241 SGHSTPRKEGSSSKKRLLQLAMPIAVTRSIPRGPDKNSLRVFPPTELTAAAVLPNVVYPK 300
           SGHSTPRKEGSSSKKRLLQLAMPIAVTRSIPRGPDKNSLRVFPPTELTAAAVLPNVVYPK
Sbjct: 241 SGHSTPRKEGSSSKKRLLQLAMPIAVTRSIPRGPDKNSLRVFPPTELTAAAVLPNVVYPK 300

Query: 301 STFPLEMKLDGVSSGDRRWRMRKLSWRIEETTRVKAHACPVHKHELRQLEEQVKIKESEK 360
           STFPLEMKLDGVSSGDRRWRMRKLSWRIEETTRVKAHACPVHKHELRQLEEQVKIKESEK
Sbjct: 301 STFPLEMKLDGVSSGDRRWRMRKLSWRIEETTRVKAHACPVHKHELRQLEEQVKIKESEK 360

Query: 361 SKKPRSHIKRYGELGPQIRVAVNSLENMPSQRLPGEPGREQAPNSSGPASTGNVGLXXXX 420
           SKKPRSHIKRYGELGPQIRVAVNSLENMPSQRLPGEPGREQAPNSSGPASTGNVGL    
Sbjct: 361 SKKPRSHIKRYGELGPQIRVAVNSLENMPSQRLPGEPGREQAPNSSGPASTGNVGLDDEN 420

Query: 421 XXXXXXXXQPGSEFIHPSDDXXXXXXXXXXXXXXXXXXXXXXKNNSSLFTEEVRIISKGE 480
                   QPGSEFIHPSDD                      KNNSSLFTEEVRIISKGE
Sbjct: 421 PVNEDEEDQPGSEFIHPSDDALRQELLMQQQRARQQQLQQELKNNSSLFTEEVRIISKGE 480

Query: 481 MKSGWKTDFDNNGKIELVTEIDCMGLNSGVSNPVMHASTLQTPSTGNKKPSINVACDIQD 540
           MKSGWKTDFDNNGKIELVTEIDCMGLNSGVSNPVMHASTLQTPSTGNKKPSINVACDIQD
Sbjct: 481 MKSGWKTDFDNNGKIELVTEIDCMGLNSGVSNPVMHASTLQTPSTGNKKPSINVACDIQD 540

Query: 541 PNLGLYVSHILAVEIVVAEETLQYANGQPIRXXXXXXXXXXXXXXXXVHNPDQRLAELSP 600
           PNLGLYVSHILAVEIVVAEETLQYANGQPIR                VHNPDQRLAELSP
Sbjct: 541 PNLGLYVSHILAVEIVVAEETLQYANGQPIRKPNSKNKKETNNNTMNVHNPDQRLAELSP 600

Query: 601 IFANRNTPKVRRMGPEDITPVNSNKSNHSTNKEKASNGASNSNIVSVPTGAARVLRMQFR 660
           IFANRNTPKVRRMGPEDITPVNSNKSNHSTNKEKASNGASNSNIVSVPTGAARVLRMQFR
Sbjct: 601 IFANRNTPKVRRMGPEDITPVNSNKSNHSTNKEKASNGASNSNIVSVPTGAARVLRMQFR 660

Query: 661 LTVTERSGLGISWDEEVPPIYQDVELLSPPCYELSINNGIKNKLYSTMSTPVRSEDDFVG 720
           LTVTERSGLGISWDEEVPPIYQDVELLSPPCYELSINNGIKNKLYSTMSTPVRSEDDFVG
Sbjct: 661 LTVTERSGLGISWDEEVPPIYQDVELLSPPCYELSINNGIKNKLYSTMSTPVRSEDDFVG 720

Query: 721 GSDEDIGNYESQGLEPGPNVQEVTITQNKLTIPPTAHHYQPASSSQRSLTTVQSPPLESV 780
           GSDEDIGNYESQGLEPGPNVQEVTITQNKLTIPPTAHHYQPASSSQRSLTTVQSPPLESV
Sbjct: 721 GSDEDIGNYESQGLEPGPNVQEVTITQNKLTIPPTAHHYQPASSSQRSLTTVQSPPLESV 780

Query: 781 VSVQGSVPFRGHVLTPHSTRDIRI 804
           VSVQGSVPFRGHVLTPHSTRDIRI
Sbjct: 781 VSVQGSVPFRGHVLTPHSTRDIRI 804

>Scas_643.24d
          Length = 784

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/670 (54%), Positives = 436/670 (65%), Gaps = 35/670 (5%)

Query: 28  PLTLSIDVESPPCVLYGSAMESSGAVLSGLFTVTVVDPYSSAEDKSLKNTE-SNVXXXXX 86
           P+ LSI+VESPPCVLYGSA +S+G++LSG+ T+ V DPY+     +  + + S       
Sbjct: 129 PIELSINVESPPCVLYGSAADSTGSLLSGVVTLNVKDPYADVSIPTYDSIKPSKSAPQKS 188

Query: 87  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLRIMAGYTKITITSVTL 146
                                                     N +IM GYTKI++TSV+L
Sbjct: 189 PRPGRRKSAIGSTLSTTFSQLAVAQSQATASSQKTTPSPSPSNTKIMNGYTKISVTSVSL 248

Query: 147 SLVQKIHFHKPFVPNISSMQTCMNCKTKITNMKSWEIQSNTQDLSVGSHSYPFSYLIPGS 206
           + VQKIHFHKPF P+ SS+Q+C NC+TK+T+MKSW IQ   QD  VG+H+YPFSYLIPGS
Sbjct: 249 TFVQKIHFHKPFTPDTSSIQSCTNCRTKLTDMKSWPIQKAPQDKPVGAHTYPFSYLIPGS 308

Query: 207 VPCSSSLGATAETQVKYELIAVVTYIDPHRNSFSSGHSTPRKEGSSSKKRLLQLAMPIAV 266
           VP +S LG+ AETQ+KYELIAV TY +P R           +    SK+++L+L MP+AV
Sbjct: 309 VPSTSYLGSNAETQIKYELIAVATYKEPTR-----------RHDVKSKEKMLRLVMPVAV 357

Query: 267 TRSIPRGPDKNSLRVFPPTELTAAAVLPNVVYPKSTFPLEMKLDGVSSGDRRWRMRKLSW 326
           TRSIPRGPDKNSLRVFPPTELTAAAVLPNV+YPKSTFPLEMKLDGVS  DRRWRMRKLSW
Sbjct: 358 TRSIPRGPDKNSLRVFPPTELTAAAVLPNVIYPKSTFPLEMKLDGVSLQDRRWRMRKLSW 417

Query: 327 RIEETTRVKAHACPVHKHELRQLEEQVKIKESEKSKKPRSHIKRYGELGPQIRVAVNSLE 386
           R+EETTRV+++AC VH+HELR+LE+ VK +E E++KKP   IKRYG++GPQ+RVAV+S E
Sbjct: 418 RVEETTRVRSYACKVHQHELRKLEKHVKEREIERNKKPMQQIKRYGDIGPQVRVAVSSPE 477

Query: 387 NMPSQRLPGEPGREQAPNS---------SGPASTGN--VGLXXXXXXXXXXXXQPGSEFI 435
           N+P QRL          +           G AS+GN   G                 EFI
Sbjct: 478 NLPLQRLRNHGDLNSNSSRNNPSMRTPQDGSASSGNGHNGSNDIPEDRDDQDDVSVDEFI 537

Query: 436 HPSDDXXXXXXXXXXXXXXXXXXXXX-XKNNSSLFTEEVRIISKGEMKSGWKTDFDNNGK 494
           HPSDD                       KN+S+LFTEEVRII+KG+MKSGWKTDF+NNGK
Sbjct: 538 HPSDDALRQELLQQQQRLREQQLQQEIAKNDSTLFTEEVRIIAKGDMKSGWKTDFENNGK 597

Query: 495 IELVTEIDCMGLNSGVSNPVMHASTLQTPSTGNKKPSINVACDIQDPNLGLYVSHILAVE 554
           IELVTEIDCM LNSGV NPV   ST + P   + K   N++CDIQDPNLG+YV+HILAVE
Sbjct: 598 IELVTEIDCMPLNSGVGNPVTMVSTSK-PHINSHKQDANISCDIQDPNLGIYVNHILAVE 656

Query: 555 IVVAEETLQYANGQPIRXXXXXXXXXXXXXXXXVHNPDQRLAELSPIFANRNTPKVRRMG 614
           IVVAEETLQY+NGQPIR                    DQRLAELSP+FANRN P+ R + 
Sbjct: 657 IVVAEETLQYSNGQPIRSKSRSDKSKNSSNSGSS--ADQRLAELSPMFANRNAPRTRPVS 714

Query: 615 PEDITPVNSNKSNHST--------NKEKASNGASNSNIVSVPTGAARVLRMQFRLTVTER 666
              ITPVNS  +N  T        N E A    ++S +VSVPTGAARVLRMQFRL VTER
Sbjct: 715 NNSITPVNSRTTNGETSSGNNDENNSENAGLPINSSKVVSVPTGAARVLRMQFRLNVTER 774

Query: 667 SGLGISWDEE 676
           SGLGISWDEE
Sbjct: 775 SGLGISWDEE 784

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (59%), Gaps = 11/67 (16%)

Query: 749 KLTIPPTAHHYQ-----PASSSQRSLTTVQSPPLESVVSVQGSVPFRG------HVLTPH 797
           KLT P  AH+         SS+   L TV SPPLE+++S+QG+VP          +LTP+
Sbjct: 19  KLTRPTMAHYVDRNNSISGSSNSNGLNTVVSPPLENIISIQGNVPLLNQSNSSTQILTPN 78

Query: 798 STRDIRI 804
           +TR++R+
Sbjct: 79  NTREVRM 85

>CAGL0F00737g 82773..85160 similar to tr|Q12502 Saccharomyces
           cerevisiae YOR322c, hypothetical start
          Length = 795

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/719 (47%), Positives = 443/719 (61%), Gaps = 104/719 (14%)

Query: 135 GYTKITITSVTLSLVQKIHFHKPFVPN--ISSMQT--------------CMNCKTKITNM 178
           GY  ITITSV L  VQK+ ++KPF+P+  IS+  T              C NCK K T++
Sbjct: 118 GYNNITITSVHLKFVQKVTYNKPFIPDSSISASSTALQLPANATGNIINCKNCKVKYTSL 177

Query: 179 KSWEIQSNTQDLSVGSHSYPFSYLIPGSVPCSSSLGATAETQVKYELIAVVTYIDP-HRN 237
           KSW IQS  + +++G H+YPFSYL+PGSVP +S+LG +A T+++YEL+  V+Y DP H++
Sbjct: 178 KSWNIQSTKKLITIGKHAYPFSYLVPGSVPSTSALGLSANTKIQYELVGNVSYYDPVHKD 237

Query: 238 SFSSGHSTPRKEGSSSKKRLLQLAMPIAVTRSIPRGPDKNSLRVFPPTELTAAAVLPNVV 297
                           K+ +L + MPI VTRSI RGPDKNSLRVFPPT+LTAAAVLPNVV
Sbjct: 238 ----------------KEYMLNIKMPIPVTRSIHRGPDKNSLRVFPPTQLTAAAVLPNVV 281

Query: 298 YPKSTFPLEMKLDGVSS------GDRRWRMRKLSWRIEETTRVKAHACPVHKHELRQLEE 351
           YPKSTFPLEMKL+G+SS       D+RWRMRKL+WR+EETTRVK + C  HK +L++LE+
Sbjct: 282 YPKSTFPLEMKLNGISSPSTGKGSDKRWRMRKLAWRVEETTRVKTNVCTQHKPDLKKLED 341

Query: 352 QVKIKESEKSKKPRSHIKRYGELGPQIRVAVNSLENMP-----SQRLPGEPGREQAPNSS 406
           QVK+KE E+SKKP   IKRYG++GPQIR+A++S  NMP     S   P     E+APNS+
Sbjct: 342 QVKLKEEERSKKPPVPIKRYGDIGPQIRIALSSPSNMPLSGGRSGPQPTLTSSEEAPNSA 401

Query: 407 GPAS----TGNVGLXXXXXXXXXXXXQPGSEFIHPSDDXXXXXXXXXXXXXXXXXXXXXX 462
             +S     GN+              +   +F+HPSDD                      
Sbjct: 402 TLSSREGEAGNI---------DTDENETTDQFVHPSDDAMRQELLQQQQRQREQQLKQEL 452

Query: 463 KNNSSLFTEEVRIISKGEMKSGWKTDFD-NNGKIELVTEIDCMGLNSGVSNPVMHASTLQ 521
           KN+S+LF+EEVRIISKGEMKSGWKTDFD +NGK+ELVT+ID +  NSGVSNP+MH ST  
Sbjct: 453 KNSSALFSEEVRIISKGEMKSGWKTDFDSDNGKVELVTDIDLLHSNSGVSNPIMHTSTTH 512

Query: 522 TPSTGNKKPSINVACDIQDPNLGLYVSHILAVEIVVAEETLQYANGQPIRXXXXX----- 576
                   P + +ACDIQDPNLG+YV+H LA+EIVVAEE LQYANGQPIR          
Sbjct: 513 PYKKKPDLPPVTIACDIQDPNLGIYVNHTLAIEIVVAEEALQYANGQPIRNGGSRRSSVI 572

Query: 577 --------XXXXXXXXXXXVHNPDQRLAELSPIFANRNTPKVRRMGPEDITPVNSNKSNH 628
                                  DQRL ELSP+FANRN  + + +   D++PVNS  S  
Sbjct: 573 PEGSKPEGTTENMNDDDDDSREMDQRLLELSPMFANRNAQRAKPVEYNDLSPVNSRSSTR 632

Query: 629 STNKEK--ASNGASNSNIVSVPTGAARVLRMQFRLTVTERSGLGISWDEEVPPIYQDVEL 686
           S N       + +S   IVSVPTGAARVLRMQFR+ VTERSGLGISWDEEVPP+Y +++ 
Sbjct: 633 SGNNTGRITPHMSSTPRIVSVPTGAARVLRMQFRINVTERSGLGISWDEEVPPMYHEIQT 692

Query: 687 LSPPCYELSINNGIKNKLYSTMSTPVRSEDDFVGGSDEDIGNYESQGLEPGPNVQEVTIT 746
            +PP YE ++ +                      G  + + N E  G EP     +  I 
Sbjct: 693 NAPPSYEAALKD---------------------SGGVQIVDNSEDLGEEPE---HQTPI- 727

Query: 747 QNKLTIPPTAHHYQPASSSQRSLTTVQSPPLESVVSVQGSVPF-RGHVLTPHSTRDIRI 804
              +  PP AHH    S+ + +LTTVQSP LE+++S+QG+VP+ RG  LTP++T ++ I
Sbjct: 728 ---IAFPPMAHHNN--SNIRNNLTTVQSPQLENIISIQGAVPYGRGSPLTPNNTIEMGI 781

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 36/52 (69%)

Query: 27  LPLTLSIDVESPPCVLYGSAMESSGAVLSGLFTVTVVDPYSSAEDKSLKNTE 78
           LP+ L +++ESPPCVLYGSA +S+GAVL G F + V DP S     S+ N E
Sbjct: 55  LPIDLELNLESPPCVLYGSATDSAGAVLCGQFVLRVKDPQSENFIYSVDNQE 106

>KLLA0A04103g 369258..371615 similar to sgd|S0005849 Saccharomyces
           cerevisiae YOR322c, hypothetical start
          Length = 785

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/813 (40%), Positives = 448/813 (55%), Gaps = 107/813 (13%)

Query: 28  PLTLSIDVESPPCVLYGSAMESSGAVLSGLFTVTVVD--------------PYSSAEDKS 73
           P+ LSI++ESPPCVLYGSA ESSGA+L GL TVT+ D              P +S + K 
Sbjct: 30  PIELSINIESPPCVLYGSATESSGALLGGLLTVTINDDLPEIQPCKSTPLTPVNSGQRKQ 89

Query: 74  LKNTESNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLRIM 133
           L N+ +                                                 NL+ +
Sbjct: 90  LTNSLT----------------------------TSLSHLSLSHAHHAHHQKSGDNLKRL 121

Query: 134 AGYTKI-----TITSVT-----LSLVQKIHFHKPFVPNISSMQTCMNCKTKITNMKSWEI 183
           A  + +      ITSV+     LSL+QK+H+ KPF P+ + + TC NCKTKIT    W I
Sbjct: 122 ASMSNLITPPKAITSVSLNSVELSLIQKVHYEKPFRPSAAVLNTCTNCKTKITEFHRWTI 181

Query: 184 QSNTQDLSVGSHSYPFSYLIPGSVPCSSSLGATAETQVKYELIAVVTYIDPHRNSFSSGH 243
            +   +L+VG HS+PFS+LIPG++P ++ LG+ + + +KYELIAV TY  P         
Sbjct: 182 MNKPTELAVGQHSFPFSHLIPGNLPPTTHLGSNSHSTIKYELIAVATYKHPF-------- 233

Query: 244 STPRKEGSSSKKRLLQLAMPIAVTRSIPRGPDKNSLRVFPPTELTAAAVLPNVVYPKSTF 303
               K    S KR+LQL +PI++TRSI RG DK SLRVFPPTELTA AVLPNVVYPKSTF
Sbjct: 234 ----KGKGESAKRVLQLNLPISITRSILRGSDKTSLRVFPPTELTANAVLPNVVYPKSTF 289

Query: 304 PLEMKLDGVSSGDRRWRMRKLSWRIEETTRVKAHACPVHKHELRQLEEQVKIKES----- 358
            +E+KLDG+ S DRRWRMRKL+WRIEE  +V+AH C  HK +L+QLEE+VK  E      
Sbjct: 290 SMELKLDGICSDDRRWRMRKLNWRIEEKVKVRAHGCQAHKAKLKQLEEKVKQDEERDRQI 349

Query: 359 EKSKKPRSHIKRYGELGPQIRVAVNSLENMPSQRLPGEPGREQAPNSSGPASTGNVGLXX 418
            KS KP   IKR  ++GPQ+++ VN+  ++  Q+L       +  ++    +T       
Sbjct: 350 RKSSKP---IKRSVDMGPQVKMTVNTFHDVLLQQLSRANTEAEDVDNPEDTTTAPSDEAL 406

Query: 419 XXXXXXXXXXQPGSEFIHPSDDXXXXXXXXXXXXXXXXXXXXXXKNNSSLFTEEVRIISK 478
                      P ++FIHP+DD                      K  S+L+TEEVR I+ 
Sbjct: 407 RDEDHDTIPDTP-TDFIHPNDDAMRQEIMQQQQRVRQQQIEEELKQESALYTEEVRTIAN 465

Query: 479 GEMKSGWKTDFDNNGKIELVTEIDCMGLNSGVSNPVMHASTLQTPSTGNKKPSINVACDI 538
           GE+KSGWK+DF + G IELVT+IDCM LNSGV+NP+ HAST + P     + ++NV+CD+
Sbjct: 466 GEIKSGWKSDFSDKGTIELVTDIDCMRLNSGVTNPISHAST-RNPCVLPNQDNVNVSCDM 524

Query: 539 QDPNLGLYVSHILAVEIVVAEETLQYANGQPIRXXXXXXXXXXXXXXXXVHNPDQRLAEL 598
           +D NLG+YVSH+L VE++VAEE LQ  NG                     +N DQRLAEL
Sbjct: 525 EDTNLGVYVSHLLFVEVIVAEEQLQNVNGGNRSRTGSTVSDTSKTASKPKNNADQRLAEL 584

Query: 599 SPIFANR-NTPKVRRMGPEDITPVNSNKSNHSTNKEKASNGASNSNIVSVPTGAARVLRM 657
           SPIFA+R N P+          PV  N+  ++   +          IV VPTGAARVLRM
Sbjct: 585 SPIFADRENKPQ----------PVIDNQPGNNVGPK----------IVGVPTGAARVLRM 624

Query: 658 QFRLTVTERSGLGISWDEEVPPIYQDVELLSPPCYELSINNGIKNKLYSTMSTPVRSEDD 717
           QFR+ +TERSGLGISWD+EVPP YQD+ +L+PP Y+  ++  +   L+ST+S+P  +   
Sbjct: 625 QFRVIMTERSGLGISWDDEVPPAYQDIRMLTPPRYQ-DVSTTL---LHSTLSSPTITPPG 680

Query: 718 FVGGSDEDIGNYESQGLE-PGPNVQ-----EVTITQNKLTIPPTAHHYQPASSSQRSLTT 771
                  + GN   + +    P  +      + +   +   PP A H+   +SS  +   
Sbjct: 681 ESSLFTLETGNGAERAVTGSAPETRSNSSVRLNVNNAEYIRPPPALHHSANTSS--TSIA 738

Query: 772 VQSPPLESVVSVQGSVPFRGHVLTPHSTRDIRI 804
            Q   L+ V+S QG+ P     LTP +TR I +
Sbjct: 739 FQFSDLDHVMSTQGAEPGFNSALTPQTTRMINV 771

>ACR291C [1338] [Homologous to ScYOR322C - SH] (888927..890981)
           [2055 bp, 684 aa]
          Length = 684

 Score =  451 bits (1161), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 239/569 (42%), Positives = 327/569 (57%), Gaps = 57/569 (10%)

Query: 141 ITSVTLSLVQKIHFHKPFVPNISSMQTCMNCKTKITNMKSWEIQSNTQDLSVGSHSYPFS 200
           +  +TL L Q++ + +PFV     + +C  C+ +   +  WE+ +   +L+ G H+YPFS
Sbjct: 67  VARLTLVLEQQVTYGRPFVAG--PLGSCAACRERRRELARWEVVAQAAELAGGRHAYPFS 124

Query: 201 YLIPGSVPCSSSLGATAETQVKYELIAVVTYIDPHRNSFSSGHSTPRKEGSSSKKRLLQL 260
           +L+ G +P +S+LG+   TQ++YEL+A   Y               R  G   ++R L+L
Sbjct: 125 HLLAGELPATSTLGSAGATQIRYELVADAVY---------------RAGGGEERRRELRL 169

Query: 261 AMPIAVTRSIPRGPDKNSLRVFPPTELTAAAVLPNVVYPKSTFPLEMKLDGVSSGDRRWR 320
             P+ VTRSI RGPD+NSLRVFPPT++TA AVLP+V+YP+ST PLE++L GV   DRRWR
Sbjct: 170 --PVLVTRSILRGPDRNSLRVFPPTDVTATAVLPSVIYPRSTIPLELQLGGVCCADRRWR 227

Query: 321 MRKLSWRIEETTRVKAHACPVHKHELRQLEEQVKIKESEKSKKPRSHIKRYGELGPQIRV 380
           MR+L+WRI+E  RV++HAC  H+  LR LEE+V+ K +   KKP   IKR  ++GPQ+ V
Sbjct: 228 MRRLTWRIDEKVRVRSHACAAHRARLRALEEEVRAKTARNLKKPAKPIKRTPDMGPQVTV 287

Query: 381 AVNSLENMPSQRLPGEPGREQAPNSSGPASTGNVGLXXXXXXXXXXXXQPGSEFIHPSDD 440
           +V ++E+     LP + G   A      A  GN+                 S FIHPSD 
Sbjct: 288 SVATVEDP----LPFDAGSAAARQE---ADVGNM----------DDDADTQSAFIHPSDH 330

Query: 441 XXXXXXXXXXXXXXXXXXXXXXKNNSSLFTEEVRIISKGEMKSGWKTDFDNNGKIELVTE 500
                                 K  +S + EEVR I+  +++SGWK+DF  +GKIELV E
Sbjct: 331 AMQQELQELQARIRQQQLEEERKQETSHYIEEVRTIAGTDIRSGWKSDFSGSGKIELVME 390

Query: 501 IDCMGLNSGVSNPVMHASTLQTPSTGNKKPSINVACDIQDPNLGLYVSHILAVEIVVAEE 560
           IDCM LNSGV+NPV   ST  +P     +  +NV CD++DP LG+ V+H+L VEI+VAEE
Sbjct: 391 IDCMKLNSGVTNPVNMVST-TSPYLARGQAPVNVTCDVEDPTLGISVNHLLLVEIIVAEE 449

Query: 561 TLQYANGQPIRXXXXXXXXXXXXXXXXVHNP--------DQRLAELSPIFANRNTPKVRR 612
            L Y NGQ +                    P        DQRLAELSP+FANRN    R 
Sbjct: 450 MLHYTNGQLLSKGEAQGEGEGQGEALAEAKPAGLAGSHADQRLAELSPMFANRNNSMFR- 508

Query: 613 MGPEDITPVNSNKSNHSTNKE-KASNGASNSNIVSVPTGAARVLRMQFRLTVTERSGLGI 671
                     ++   HS   E   S   ++  IV  PTGAARVLRMQF+LT+TERSGLGI
Sbjct: 509 ----------ASAEEHSPGLEPDGSTAGADKRIVGTPTGAARVLRMQFKLTMTERSGLGI 558

Query: 672 SWDEEVPPIYQDVELLSPPCYELSINNGI 700
           SWD+EVPP YQ V+ L PP Y+ +++  +
Sbjct: 559 SWDDEVPPKYQQVKFLYPPSYDEAVSASV 587

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (59%), Gaps = 7/62 (11%)

Query: 1  MAFSRLTSTHQSNHNGYSNSNKKGQSLPLTLSIDVESPPCVLYGSAMESSGAVLSGLFTV 60
          M F RL +T +    G S+         + L +++ESPPCVLYG   ES+GA+LSGL TV
Sbjct: 1  MVFPRLVATGRRGSAGGSDHV-------VELGLEIESPPCVLYGPPTESAGALLSGLVTV 53

Query: 61 TV 62
           V
Sbjct: 54 HV 55

>Scas_30.1d
          Length = 72

 Score = 57.0 bits (136), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 38/54 (70%), Gaps = 3/54 (5%)

Query: 751 TIPPTAHHYQPASSSQRSLTTVQSPPLESVVSVQGSVPFRGHVLTPHSTRDIRI 804
           T+ P AH +Q    S   L +VQSP LE+VVS+QG+ P  G++LTPH+TRDI I
Sbjct: 8   TLXPVAHXHQ---DSFHGLASVQSPQLENVVSIQGNAPGHGYILTPHTTRDIGI 58

>Kwal_26.7100
          Length = 178

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 33/47 (70%)

Query: 136 YTKITITSVTLSLVQKIHFHKPFVPNISSMQTCMNCKTKITNMKSWE 182
           +TK  + SV+LSLVQK+ + KPF    +S+Q+C+NC++K T    WE
Sbjct: 128 FTKALVKSVSLSLVQKVRYAKPFDAQCNSIQSCLNCRSKDTERARWE 174

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 41/72 (56%), Gaps = 10/72 (13%)

Query: 1  MAFSRLTSTHQSNHNG-------YSNSNKKGQSLPLTLSIDVESPPCVLYGSAMESSGAV 53
          M F +L   H   +         +S+++  G    + L ID+ESPPCVLYG+A ES+GA+
Sbjct: 1  MGFPKLGHQHDKKYASNSSVDRIFSDTSNDGL---VELLIDIESPPCVLYGTATESTGAL 57

Query: 54 LSGLFTVTVVDP 65
          LSGL  V V  P
Sbjct: 58 LSGLLKVRVKQP 69

>Scas_607.9
          Length = 735

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 161 NISSMQTCMNCKTKITNMKSWEIQSNTQDLSVGSHSYPFSYLIPGSVPCSSSLGATAETQ 220
           NIS +++       + ++ S    SN   L  G++ +PFS ++PGS+    S+    +  
Sbjct: 122 NISGLRSRSKSTASLASLGSLTGSSNRHTLQRGNYEFPFSVILPGSL--EESVEGINDAS 179

Query: 221 VKYELIAVV 229
           V Y L A V
Sbjct: 180 VTYYLEANV 188

>YMR001C (CDC5) [3966] chr13 complement(269019..271136)
           Serine/threonine protein kinase required for exit from
           mitosis and for inactivation of the Rad53p checkpoint
           kinase during adaptation to unrepaired DNA damage,
           member of the polo family of protein kinases [2118 bp,
           705 aa]
          Length = 705

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 741 QEVTITQNKLTIPPTAHHYQPASSSQRSLTTV--QSPPLESVVSVQGSVPFRGHVL 794
           +E    Q K   P   HH+QPA   +R   +   ++PP  S++  +G    RGH L
Sbjct: 35  KENHFKQTKRLDPNNDHHHQPAQKKKREKLSALCKTPP--SLIKTRGKDYHRGHFL 88

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.128    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,538,020
Number of extensions: 978719
Number of successful extensions: 3170
Number of sequences better than 10.0: 31
Number of HSP's gapped: 3207
Number of HSP's successfully gapped: 38
Length of query: 804
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 694
Effective length of database: 12,788,129
Effective search space: 8874961526
Effective search space used: 8874961526
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)