Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YOR321W (PMT3)75374039710.0
YAL023C (PMT2)75970526600.0
Kwal_26.710574073626080.0
Scas_505.275274025160.0
KLLA0F15829g74170524970.0
Scas_643.2476975424820.0
ACR290W75571924010.0
CAGL0J08734g74273023800.0
CAGL0F00759g73471820710.0
Kwal_33.1547175575817640.0
KLLA0F21978g75774917360.0
YGR199W (PMT6)75976117090.0
CAGL0K00979g73069615610.0
Scas_408.1*3913729321e-119
CAGL0L07216g8587429081e-110
KLLA0E01342g8386788471e-101
Kwal_23.36238767058421e-100
YDL095W (PMT1)8176858341e-99
ADR279C8176718156e-97
YDL093W (PMT5)7436807363e-86
KLLA0B03762g7727207191e-83
ABL085W7576977041e-81
CAGL0M00220g7657017007e-81
Kwal_47.167347927016885e-79
Scas_442.13093026473e-78
Scas_719.807626246411e-72
YJR143C (PMT4)7627066411e-72
Scas_710.19196656421e-71
CAGL0L07172g7776505383e-58
Sklu_2215.66536934346e-45
Scas_329.12732133613e-38
Scas_30.11281093387e-37
AAL050W6574033629e-36
Kwal_33.143576574932971e-27
Scas_588.77264972722e-24
KLLA0C14828g6294812161e-17
YDR307W6624921972e-15
CAGL0J11044g7366291491e-09
Scas_710.0d2711451131e-05
CAGL0L07546g63467741.0
Kwal_27.10376901145712.2
YKL107W30988683.5
YMR266W953194669.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YOR321W
         (740 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YOR321W (PMT3) [5103] chr15 (916025..918286) Mannosyltransferase...  1534   0.0  
YAL023C (PMT2) [45] chr1 complement(106275..108554) Mannosyltran...  1029   0.0  
Kwal_26.7105                                                         1009   0.0  
Scas_505.2                                                            973   0.0  
KLLA0F15829g complement(1464112..1466337) similar to sp|P31382 S...   966   0.0  
Scas_643.24                                                           960   0.0  
ACR290W [1337] [Homologous to ScYAL023C (PMT2) - SH; ScYOR321W (...   929   0.0  
CAGL0J08734g 860389..862617 highly similar to sp|P31382 Saccharo...   921   0.0  
CAGL0F00759g complement(85452..87656) similar to sp|P31382 Sacch...   802   0.0  
Kwal_33.15471                                                         684   0.0  
KLLA0F21978g 2042656..2044929 similar to sp|P42934 Saccharomyces...   673   0.0  
YGR199W (PMT6) [2149] chr7 (897505..899784) Protein with similar...   662   0.0  
CAGL0K00979g complement(97306..99498) similar to sp|P42934 Sacch...   605   0.0  
Scas_408.1*                                                           363   e-119
CAGL0L07216g complement(799529..802105) similar to sp|P33775 Sac...   354   e-110
KLLA0E01342g complement(134691..137207) similar to sp|P33775 Sac...   330   e-101
Kwal_23.3623                                                          328   e-100
YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase (...   325   1e-99
ADR279C [2020] [Homologous to ScYDL095W (PMT1) - SH; ScYDL093W (...   318   6e-97
YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT O-m...   288   3e-86
KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces c...   281   1e-83
ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH] complement(2...   275   1e-81
CAGL0M00220g 28137..30434 similar to sp|P46971 Saccharomyces cer...   274   7e-81
Kwal_47.16734                                                         269   5e-79
Scas_442.1                                                            253   3e-78
Scas_719.80                                                           251   1e-72
YJR143C (PMT4) [3035] chr10 complement(698241..700529) Mannosylt...   251   1e-72
Scas_710.1                                                            251   1e-71
CAGL0L07172g complement(796354..798687) similar to sp|P33775 Sac...   211   3e-58
Sklu_2215.6 YDR307W, Contig c2215 9395-11356 reverse complement       171   6e-45
Scas_329.1                                                            143   3e-38
Scas_30.1                                                             134   7e-37
AAL050W [137] [Homologous to ScYDR307W - SH] complement(256490.....   144   9e-36
Kwal_33.14357                                                         119   1e-27
Scas_588.7                                                            109   2e-24
KLLA0C14828g complement(1292713..1294602) weakly similar to sp|Q...    88   1e-17
YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein contain...    80   2e-15
CAGL0J11044g complement(1073988..1076198) weakly similar to sp|Q...    62   1e-09
Scas_710.0d                                                            48   1e-05
CAGL0L07546g complement(831824..833728) highly similar to sp|P38...    33   1.0  
Kwal_27.10376                                                          32   2.2  
YKL107W (YKL107W) [3155] chr11 (235787..236716) Protein of unkno...    31   3.5  
YMR266W (YMR266W) [4220] chr13 (798517..801378) Possible membran...    30   9.2  

>YOR321W (PMT3) [5103] chr15 (916025..918286) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), involved in initiation of
           O-glycosylation [2262 bp, 753 aa]
          Length = 753

 Score = 1534 bits (3971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 740/740 (100%), Positives = 740/740 (100%)

Query: 1   MPYRVATGYSEKSTDDDLIWRTPIVKEELEDADNFLKDDAELYDKVKNESAVSHLDTIVM 60
           MPYRVATGYSEKSTDDDLIWRTPIVKEELEDADNFLKDDAELYDKVKNESAVSHLDTIVM
Sbjct: 1   MPYRVATGYSEKSTDDDLIWRTPIVKEELEDADNFLKDDAELYDKVKNESAVSHLDTIVM 60

Query: 61  PIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYL 120
           PIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYL
Sbjct: 61  PIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYL 120

Query: 121 AGYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILV 180
           AGYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILV
Sbjct: 121 AGYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILV 180

Query: 181 IFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAI 240
           IFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAI
Sbjct: 181 IFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAI 240

Query: 241 SVKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLCFKI 300
           SVKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLCFKI
Sbjct: 241 SVKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLCFKI 300

Query: 301 HFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALGGALLHSHVQP 360
           HFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALGGALLHSHVQP
Sbjct: 301 HFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALGGALLHSHVQP 360

Query: 361 FPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENKTIEFVKGGEMYRLMHRLTGKN 420
           FPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENKTIEFVKGGEMYRLMHRLTGKN
Sbjct: 361 FPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENKTIEFVKGGEMYRLMHRLTGKN 420

Query: 421 LHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQVGEEDPTLLHPLSTSFRIKNS 480
           LHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQVGEEDPTLLHPLSTSFRIKNS
Sbjct: 421 LHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQVGEEDPTLLHPLSTSFRIKNS 480

Query: 481 ILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENERLPQGEDFVYPKTS 540
           ILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENERLPQGEDFVYPKTS
Sbjct: 481 ILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENERLPQGEDFVYPKTS 540

Query: 541 FFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRLCEWSEKSIKYFLLGS 600
           FFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRLCEWSEKSIKYFLLGS
Sbjct: 541 FFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRLCEWSEKSIKYFLLGS 600

Query: 601 PASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDVFVMAAFYPLLAWLLHYMPFV 660
           PASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDVFVMAAFYPLLAWLLHYMPFV
Sbjct: 601 PASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDVFVMAAFYPLLAWLLHYMPFV 660

Query: 661 VMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTGKFLRLGAYIVYGSIVIAGFFY 720
           VMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTGKFLRLGAYIVYGSIVIAGFFY
Sbjct: 661 VMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTGKFLRLGAYIVYGSIVIAGFFY 720

Query: 721 FSPFSFGMDGPVDDYAYLAW 740
           FSPFSFGMDGPVDDYAYLAW
Sbjct: 721 FSPFSFGMDGPVDDYAYLAW 740

>YAL023C (PMT2) [45] chr1 complement(106275..108554)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           responsible for initiation of O-glycosylation [2280 bp,
           759 aa]
          Length = 759

 Score = 1029 bits (2660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/705 (67%), Positives = 580/705 (82%), Gaps = 4/705 (0%)

Query: 39  DAELYDKVK--NESAVSHLDTIVMPIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYY 96
           DAE + K K   +S++  L+++VMP+IFT L +FTRMYKIG NNHVVWDEAHFGKFGSYY
Sbjct: 44  DAEDFSKEKPAAQSSLLRLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYY 103

Query: 97  LRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSSLCV 156
           LRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGE+YPDY+DYVKMRLF A FS+LCV
Sbjct: 104 LRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSALCV 163

Query: 157 PLAYFTGRAIGFSRLSVWLFTILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTM 216
           PLAYFT +AIGFS  +VWL T+LV+FENSY+TLG+FILLDSMLLFFTV+S+F    FH  
Sbjct: 164 PLAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQ 223

Query: 217 RKSPFSARWWLWLCLTGLNLGCAISVKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYV 276
           R  PFS +WW WL +TG++LGC ISVKMVGLFII++VGIYT+ +LW  L+D+S+SWK Y+
Sbjct: 224 RSKPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYI 283

Query: 277 NHWLARIFGLIIIPVCVFLLCFKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVA 336
           NHWLARIFGLII+P C+FLLCFKIHFDLLS+SG GD+ MPSLFQA L G+ VG+GPRD+A
Sbjct: 284 NHWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIA 343

Query: 337 LGSSIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDA 396
           LGSS++SIKNQALGG+LLHSH+Q +P+GS QQQVT YGY DANNEWFF R RG+  W++ 
Sbjct: 344 LGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSEN 403

Query: 397 ENKTIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEI 456
           E   IE++K G  YRL+H+ TG+NLHTH V AP+SK+++EVS YGD  +GD KDNW+IEI
Sbjct: 404 ETD-IEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEI 462

Query: 457 VEQVGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRT 516
           ++Q G+EDP  LH L+TSFRIKN  +GCYLAQ+G  LPEWGFRQ EVVC+K+  KRDKRT
Sbjct: 463 MDQRGDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRT 522

Query: 517 WWNIETHENERL-PQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQ 575
           WWNIETHENERL P+ EDF YPKT+F ++F+ LN AMMATNNALVP+P+KFD +ASSAWQ
Sbjct: 523 WWNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQ 582

Query: 576 WPTLNVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDP 635
           WPTLNVG+RLC W + + KYFLLG+PAS W SS+AV A +  V+ L ++WQRQ V L +P
Sbjct: 583 WPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNP 642

Query: 636 VERDVFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWAT 695
              +VF+M  FYPLLAW LHYMPFV+MSRV Y HHYLP LYFAL+IL+Y FD   ++W+ 
Sbjct: 643 SNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSR 702

Query: 696 RNTGKFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAW 740
              G+ +R   Y  + ++VI  F+YFSP SFGM+GP  ++ YL W
Sbjct: 703 SKCGRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLNW 747

>Kwal_26.7105
          Length = 740

 Score = 1009 bits (2608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/736 (64%), Positives = 574/736 (77%), Gaps = 6/736 (0%)

Query: 6   ATGYSEKSTDDDLIWRTPIVKEELEDADNFLKDDAELYDKVKNESAVSHLDTIVMPIIFT 65
           ATG+  + +D  L  R     +E+ D    ++ D  + +K    + +  L++I MP+IFT
Sbjct: 3   ATGFDSRISDGTLKQRKVTTVDEIPD----IEVDDRIEEKSVEVNPLLRLESIAMPMIFT 58

Query: 66  VLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNG 125
            +G FTRMYKIG NNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG++AGYNG
Sbjct: 59  AVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNG 118

Query: 126 SWDFPSGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILVIFENS 185
           SWDFPSGE YPDY+DYVKMR+F A FS+LC+PLAYFT +AIGFS  +VWLFTILVIFENS
Sbjct: 119 SWDFPSGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENS 178

Query: 186 YATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAISVKMV 245
           YATLG+FILLDSMLLFFTV+S FC   FH  R  PFS +WW WL LTG++LGC ISVKMV
Sbjct: 179 YATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKMV 238

Query: 246 GLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLCFKIHFDLL 305
           GLFII++VGIYT+ ELW LL D+ VS K Y  HWLARI  LII+P  +FL CFK+HFDLL
Sbjct: 239 GLFIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLL 298

Query: 306 SNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALGGALLHSHVQPFPEGS 365
           S+SG GD+ MPSLFQA L G+ VG GPRD+A+GSSI+SIKNQALGG+LLHSHVQ +PEGS
Sbjct: 299 SHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGS 358

Query: 366 EQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENKTIEFVKGGEMYRLMHRLTGKNLHTHE 425
            QQQVT YG+ D+NN W F RIR + PW++ E + IEFVK G  YRL+H  TGKNLHTH 
Sbjct: 359 NQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEETE-IEFVKPGSSYRLVHPNTGKNLHTHP 417

Query: 426 VPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQVGEEDPTLLHPLSTSFRIKNSILGCY 485
           + API+KSE+EVS YG  ++GD KD+W++E+V Q G ED + LHPL++SFRIKN+ LGCY
Sbjct: 418 IAAPITKSEWEVSGYGTAEVGDPKDHWVVEVVAQHGSEDESRLHPLTSSFRIKNAELGCY 477

Query: 486 LAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENERLP-QGEDFVYPKTSFFRN 544
           LAQ+G HLPEWGFRQ EV CLK+  KRDKRTWWN+ETH NE+LP +  DF YPK +F +N
Sbjct: 478 LAQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINFIKN 537

Query: 545 FMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRLCEWSEKSIKYFLLGSPASV 604
           F+ LN AMMATNNALVP+P+K D +ASSAWQWPTLNVG+RLC W + ++KYFL+GSPAS 
Sbjct: 538 FIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPAST 597

Query: 605 WPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDVFVMAAFYPLLAWLLHYMPFVVMSR 664
           W S+IAV   +  V+ L L+WQRQ   LSD  + ++F+M  FYPLL W LHYMPFV+MSR
Sbjct: 598 WLSTIAVVGFMGLVVLLLLRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSR 657

Query: 665 VVYAHHYLPTLYFALMILSYYFDMITKRWATRNTGKFLRLGAYIVYGSIVIAGFFYFSPF 724
           V Y HHYLP LYFAL+ILSY F+   K       G+  R   Y+ YG+IVI GF+YFSP 
Sbjct: 658 VTYVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGFYYFSPI 717

Query: 725 SFGMDGPVDDYAYLAW 740
           SFG+ GP  +YA+L W
Sbjct: 718 SFGLSGPSSNYAHLNW 733

>Scas_505.2
          Length = 752

 Score =  973 bits (2516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/740 (63%), Positives = 570/740 (77%), Gaps = 7/740 (0%)

Query: 6   ATGYSEKSTD-DDLIWRTPI---VKEELEDADNFLKDDAELYDKVKNESAVSHLDTIVMP 61
           ATG+  +  D +++  R  I     EE+ D    LK +    +K K  + +  +++I+MP
Sbjct: 4   ATGFKAREKDTEEVKARQDINIDTHEEIIDEKEDLKKEIVSTEK-KESNTLLRVESIIMP 62

Query: 62  IIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 121
           ++FT L +F RMYKIG N+HVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA
Sbjct: 63  LVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 122

Query: 122 GYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILVI 181
           GYNGS+DF SG  YPDY+DYVKMR+F A FS++CVP+AYFT +AIGFS  +VWLFTI V+
Sbjct: 123 GYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTITVL 182

Query: 182 FENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAIS 241
           FENSY TLGKFILLDSMLLFFTV SY C   FH  R  PFS +WW W+ LTGL++GCAIS
Sbjct: 183 FENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLLTGLSMGCAIS 242

Query: 242 VKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLCFKIH 301
           VKMVGLFII+VVGIYTI +LWN L D+++SWK Y+ HWLARI  LII+P  VFL CFKIH
Sbjct: 243 VKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLIIVPFLVFLACFKIH 302

Query: 302 FDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALGGALLHSHVQPF 361
           FDLL++SG GD+ M SLFQA+L G+ VG GPRDVA+GSSIISIKNQALGGALLHSH   +
Sbjct: 303 FDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQALGGALLHSHYNAY 362

Query: 362 PEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENKTIEFVKGGEMYRLMHRLTGKNL 421
           PEGS QQQVT Y Y DANNEWFF R RG EP+       IE+V G   YRL+H  TGKNL
Sbjct: 363 PEGSNQQQVTAYSYKDANNEWFFDRPRG-EPFYHENETDIEYVLGDSQYRLVHHKTGKNL 421

Query: 422 HTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQVGEEDPTLLHPLSTSFRIKNSI 481
           HTH V APIS +++EVS YGD + GD +DNW+IEIV+Q G+ED T LHPL+TSFRI N  
Sbjct: 422 HTHPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQRGDEDKTKLHPLTTSFRIYNPD 481

Query: 482 LGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENERL-PQGEDFVYPKTS 540
           + CYL+Q+G HLPEWGF+Q EV C+++  +RDKRTWWNIET+EN+ L P+  DF +PKT+
Sbjct: 482 MDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNENDVLPPRPADFKFPKTN 541

Query: 541 FFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRLCEWSEKSIKYFLLGS 600
           FF++F+QLN AMMATNNALVP+PEKFD +ASSAWQWPTL  G+R+C W E  +KYFLLG+
Sbjct: 542 FFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRICSWGEDVVKYFLLGT 601

Query: 601 PASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDVFVMAAFYPLLAWLLHYMPFV 660
           PAS W SS+AV  L+++++ L ++WQRQ   L DP + + F+M AFYPLLAW LHY PFV
Sbjct: 602 PASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTFMMGAFYPLLAWGLHYAPFV 661

Query: 661 VMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTGKFLRLGAYIVYGSIVIAGFFY 720
           +MSRV Y HHYLP LYFAL+IL+Y FD   K      + + LR+  Y+     VI  F+Y
Sbjct: 662 IMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKSTQILRIVIYLAAYVTVIGCFWY 721

Query: 721 FSPFSFGMDGPVDDYAYLAW 740
           FSP SFGM GP+++Y+YL W
Sbjct: 722 FSPISFGMVGPMENYSYLNW 741

>KLLA0F15829g complement(1464112..1466337) similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2
           mannosyltransferase, start by similarity
          Length = 741

 Score =  966 bits (2497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/705 (64%), Positives = 554/705 (78%), Gaps = 4/705 (0%)

Query: 39  DAELYDKVK--NESAVSHLDTIVMPIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYY 96
           +AE   K K  NES +  L++I+MPIIFT L  F RMYKIG N+HVVWDEAHFGKFGSYY
Sbjct: 30  EAEDLSKQKHVNESPLLKLESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYY 89

Query: 97  LRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSSLCV 156
           LRHEFYHDVHPPLGKMLVG SGYLAGYNGSWDFPSGE YP+YID+VKMRLF A+FS+LCV
Sbjct: 90  LRHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGEQYPEYIDFVKMRLFNALFSALCV 149

Query: 157 PLAYFTGRAIGFSRLSVWLFTILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTM 216
           P+AYFT ++IGFS  +VWLFT LV+FENSY TLG+FILLDSMLLFFTV S FC  KFH +
Sbjct: 150 PVAYFTAKSIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNV 209

Query: 217 RKSPFSARWWLWLCLTGLNLGCAISVKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYV 276
           R  PF+ +WW WL  TG +LGC ISVKMVGL II++VGIYT+ +LWN+L+D  +S KVY 
Sbjct: 210 RSKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYA 269

Query: 277 NHWLARIFGLIIIPVCVFLLCFKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVA 336
            HW +R   LI++P  VFL CFKIHFDLLS+SG GD+ MPSLFQA+L G+ VG+GPRDVA
Sbjct: 270 AHWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDVA 329

Query: 337 LGSSIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDA 396
           LGSS I+IKNQALGG LLHSH+Q +PEGS+QQQVT YG+ D+NN W F R R   P+   
Sbjct: 330 LGSSEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKN 389

Query: 397 ENKTIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEI 456
           E +T EFV  G  YRL+H  TG+NLHTH   AP+  + +EVS YGD  +GD KD+WIIEI
Sbjct: 390 ETET-EFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGDAKVGDPKDDWIIEI 448

Query: 457 VEQVGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRT 516
           V+Q G ED T LHPL++SFR+KN+ +GCYL+Q+G  LP+WGFRQ EV C+K+  KRDKRT
Sbjct: 449 VDQKGPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRT 508

Query: 517 WWNIETHENERL-PQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQ 575
           WWNIET+ NE+L P+ E+F YPKTSF ++F+ LN AMMATNNALVPN EK D +ASSAWQ
Sbjct: 509 WWNIETNVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQ 568

Query: 576 WPTLNVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDP 635
           WPTLNVG+RLC W E++IKYFL+GSPAS WPS+IAV A ++ V    ++WQRQ   L++P
Sbjct: 569 WPTLNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNP 628

Query: 636 VERDVFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWAT 695
            + ++F+M   YPLLAW LH++PF++MSRV Y HHYLP LYFAL++L+Y F++  K+W  
Sbjct: 629 EDINLFLMGGIYPLLAWGLHFVPFIIMSRVTYVHHYLPALYFALLVLAYLFEISMKKWNK 688

Query: 696 RNTGKFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAW 740
              GK +R   Y  Y +IVI GF+YF+P SFGM GP  DY YL W
Sbjct: 689 SKCGKVMRYTIYGSYMAIVIYGFYYFAPISFGMSGPSTDYEYLNW 733

>Scas_643.24
          Length = 769

 Score =  960 bits (2482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/754 (61%), Positives = 571/754 (75%), Gaps = 24/754 (3%)

Query: 7   TGYSEKSTDDDLIWRTPIVKEELEDADNFLKDDAELYDKVKN---------ESAVSHLDT 57
           +G+  K    DL  R          A    KD A + +K +N         ES +  ++ 
Sbjct: 9   SGFEPKKEASDLKVRQHNSSAATSKA---AKDSASIDEKDENVKKQQPPSEESPLCKVEA 65

Query: 58  IVMPIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLS 117
            VMPI+FT L  FTRMYKIG NNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLS
Sbjct: 66  WVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLS 125

Query: 118 GYLAGYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFT 177
           GYLAGYNGSWDFPSGE YPDY+DYVKMRLFQA FSSLCVP+AY T +AIGFS  +VWLFT
Sbjct: 126 GYLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLFT 185

Query: 178 ILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLG 237
            LV+FENSYATLG+FILLDSML FFTV+S+     FHT RK+PFS +WW  L L G NLG
Sbjct: 186 CLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALLGFNLG 245

Query: 238 CAISVKMVGLFIISVVGIYTISELWNLLSDRSV-------SWKVYVNHWLARIFGLIIIP 290
           CAISVKMVGLFII++VGIYT+++LW LL  ++        +WKVY  HW+ARI  LIIIP
Sbjct: 246 CAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCLIIIP 305

Query: 291 VCVFLLCFKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALG 350
             VFL CF+IHF LLS+SG GD+ MPSLFQA+L+G+ VGKGPRDVALGSS +SIKNQALG
Sbjct: 306 FLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIKNQALG 365

Query: 351 GALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIR--GVEPWTDAENKTIEFVKGGE 408
           GALLHSHVQ FP+GS QQQVT Y Y+D NN WFF RIR  G +PW++     IE+V+ G 
Sbjct: 366 GALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEYVRVGN 425

Query: 409 MYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYG-DVDLGDYKDNWIIEIVEQVGEEDPTL 467
            YRL+HR T KNLH  ++ AP+SK+++EV+ +G   ++GD  DNWIIE++EQ G+ED ++
Sbjct: 426 EYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIEQAGDEDKSM 485

Query: 468 LHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENER 527
           +HPL+T+F IK+++LGCYL Q+ K LPEWGFRQ E+ C    SK DKRTWWN+E+HENE+
Sbjct: 486 IHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVESHENEK 545

Query: 528 LPQGE-DFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRLC 586
           LP  +  F YPKT+FF++F+ LN  MMATNNALVP+ +K+D +AS+AWQWPTLNVG+RLC
Sbjct: 546 LPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPTLNVGLRLC 605

Query: 587 EWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDVFVMAAF 646
            W++ ++KYFLLGSPAS WPS+++V  L+I ++ L  +WQRQ    ++    + F+M AF
Sbjct: 606 GWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKALNTFMMGAF 665

Query: 647 YPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTGKFLRLGA 706
           YPLLAW LH+MPFV+M+RV Y HHYLP LYFAL++L+Y+F+ I +R       K++    
Sbjct: 666 YPLLAWGLHFMPFVIMARVTYVHHYLPALYFALLVLAYFFEAIIRR-PKGTLAKYITYIT 724

Query: 707 YIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAW 740
            ++Y ++VI GFFYFSP SFGMDGP  +Y YL W
Sbjct: 725 LVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDW 758

>ACR290W [1337] [Homologous to ScYAL023C (PMT2) - SH; ScYOR321W
           (PMT3) - SH] complement(886525..888792) [2268 bp, 755
           aa]
          Length = 755

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/719 (61%), Positives = 546/719 (75%), Gaps = 5/719 (0%)

Query: 26  KEELEDADNFLKDDAELYDKVKNE-SAVSHLDTIVMPIIFTVLGMFTRMYKIGRNNHVVW 84
           K   ED     ++D     +V+ E + +  L+  VMP++FT+L ++TRM+KIG NN VVW
Sbjct: 31  KASAEDGAGVQEEDVSKLREVQQERNPLYKLEAFVMPVLFTLLALYTRMHKIGANNRVVW 90

Query: 85  DEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEVYPDYIDYVKM 144
           DEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGY+AGYNGSWDFPSGE YP+YIDYVKM
Sbjct: 91  DEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDFPSGEEYPEYIDYVKM 150

Query: 145 RLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILVIFENSYATLGKFILLDSMLLFFTV 204
           R+F A+FS++C P+AYFTG+AIGFS  +VWLF+ILV+FENSYATLG+FILLDSMLLFFTV
Sbjct: 151 RMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVFENSYATLGRFILLDSMLLFFTV 210

Query: 205 SSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAISVKMVGLFIISVVGIYTISELWNL 264
            S++    FH  R  PF  +WW WL   G++LGC ISVKMVGLFIISVVGIYT+ +LWN 
Sbjct: 211 CSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLGCTISVKMVGLFIISVVGIYTVVDLWNK 270

Query: 265 LSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLCFKIHFDLLSNSGPGDSTMPSLFQASLN 324
           LS+ ++S   +  H+ AR   LI++P  VFL CFK+HF+ LS SG GD+ MPSLFQA L+
Sbjct: 271 LSEPNMSVSRFAGHFSARALCLIVVPFMVFLFCFKLHFEFLSVSGTGDAMMPSLFQAGLS 330

Query: 325 GTKVGKGPRDVALGSSIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFF 384
           G+ VG GPRD+A+GSS++SIKNQALGG LLHSHVQ +P GS QQQVT YG++D+NN W F
Sbjct: 331 GSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNNWVF 390

Query: 385 QRIRGVEPWTDAENKTIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVD 444
            RIRG+  W+  E +  EFV+ G  YRL+H  TG+NLHTH +PAP+SK+ +EVS YGD  
Sbjct: 391 DRIRGLPAWSINETEH-EFVQDGRPYRLVHANTGRNLHTHPIPAPVSKTHWEVSGYGDAQ 449

Query: 445 LGDYKDNWIIEIVEQVGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVV 504
           +GD KDNWIIE V Q  +ED ++LH +STSFRIKN  +GCYLAQ+G  LPEWGFRQGEV 
Sbjct: 450 VGDPKDNWIIEFVSQPSDEDKSVLHTISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGEVA 509

Query: 505 CLKHASKRDKRTWWNIETHENERL-PQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNP 563
           C+ +  KRDKRTWWNIET+ NERL P  EDF YPKTSFF++F+ LN AMMATNNALVP+P
Sbjct: 510 CISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVPDP 569

Query: 564 EKFDGIASSAWQWPTLNVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTL 623
           +K D +ASSAWQWPTLNVG+RLC W++   KYFL+GSPAS WPS+ AV    +  ++  L
Sbjct: 570 DKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLITVYYLL 629

Query: 624 KWQRQCVILSDPVERDVFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILS 683
           KWQRQ V+     + ++F+M   YPLL W LHY+PF VM RV Y HHYLP LYFAL+IL+
Sbjct: 630 KWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLILA 689

Query: 684 YYFD--MITKRWATRNTGKFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAW 740
           Y F+  +   R + ++  K L    Y VY   +I GF+YF P + GM+GP  +Y +L W
Sbjct: 690 YVFEASLRAARQSQKSYWKILVYVVYAVYYCTIICGFYYFYPITVGMEGPSSNYKHLNW 748

>CAGL0J08734g 860389..862617 highly similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 742

 Score =  921 bits (2380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/730 (59%), Positives = 545/730 (74%), Gaps = 16/730 (2%)

Query: 11  EKSTDDDLIWRTPIVKEELEDADNFLKDDAELYDKVKNESAVSHLDTIVMPIIFTVLGMF 70
           + S DD LI       EE ED        ++L D   ++S +  L+  +MP++FT L +F
Sbjct: 21  QTSVDDVLI-------EEKEDT-------SKLKDAKVSQSPLLQLEAYLMPLVFTGLALF 66

Query: 71  TRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFP 130
            RMY+IG N +VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGS+DF 
Sbjct: 67  VRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFE 126

Query: 131 SGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILVIFENSYATLG 190
           SG  YP+Y+D+VKMRLF A FS++CVPLAYFT +AIGFS  +VWLFT +V+FENSY+TLG
Sbjct: 127 SGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFENSYSTLG 186

Query: 191 KFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAISVKMVGLFII 250
           +FILLDSMLLFFTV+S F    FH  R  PFS +WW WL LTG+NLGC ISVKMVGLF+I
Sbjct: 187 RFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKMVGLFVI 246

Query: 251 SVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLCFKIHFDLLSNSGP 310
           ++VGIYT+ +L  +L+++ +SWK Y  HWLARI  LI +P+ VF++CFK+HFDLL +SG 
Sbjct: 247 TLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDLLWHSGT 306

Query: 311 GDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALGGALLHSHVQPFPEGSEQQQV 370
           GD+ MPSLFQA L G+ VG GPRDVA+GSS +SIKNQAL GALLHSHVQ +PEGS QQQV
Sbjct: 307 GDANMPSLFQAGLVGSDVGGGPRDVAIGSS-VSIKNQALSGALLHSHVQTYPEGSNQQQV 365

Query: 371 TVYGYSDANNEWFFQRIRGVEPWTDAENKTIEFVKGGEMYRLMHRLTGKNLHTHEVPAPI 430
           T Y Y DANN W F R+R    W D     IE+V  G +YRL+H  T KNLHTH + AP+
Sbjct: 366 TAYSYKDANNNWVFHRVREESLW-DINETDIEYVVDGAVYRLVHANTQKNLHTHSIAAPV 424

Query: 431 SKSEYEVSAYGDVDLGDYKDNWIIEIVEQVGEEDPTLLHPLSTSFRIKNSILGCYLAQSG 490
            K  +EVS YG+  +GD KD W++EIV+Q G E+ T +HPL+TSFR++N  L CYLAQ+G
Sbjct: 425 DKKNWEVSGYGNHTIGDAKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKELDCYLAQTG 484

Query: 491 KHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENERLPQGEDFVYPKTSFFRNFMQLNS 550
            HLPEWGFRQ E+ C+K   +RDKRTWWN+E+HENE+LP  E+F YP + F ++F+ LN 
Sbjct: 485 NHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLPTPEEFKYPGSGFLKDFIHLNL 544

Query: 551 AMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRLCEWSEKSIKYFLLGSPASVWPSSIA 610
           AMMATNNALVP  +KFD +ASSAW+WPTL+VG+RLC W + + KYFLLG+P + W SS+A
Sbjct: 545 AMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTTWASSVA 604

Query: 611 VCALIIHVIFLTLKWQRQCVILSDPVERDVFVMAAFYPLLAWLLHYMPFVVMSRVVYAHH 670
           V + +I  + L L+WQRQ    S+  + ++F+M  FYP+L W LH++PFV+MSRV Y HH
Sbjct: 605 VISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSRVTYVHH 664

Query: 671 YLPTLYFALMILSYYFDMITKRWATRNTGKFLRLGAYIVYGSIVIAGFFYFSPFSFGMDG 730
           YLP LYFAL+IL+Y  D  TKRW     G  +RL  + +  + V+  F+YFSP SFGM G
Sbjct: 665 YLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGCFWYFSPISFGMTG 724

Query: 731 PVDDYAYLAW 740
           P  +Y YL W
Sbjct: 725 PAINYHYLKW 734

>CAGL0F00759g complement(85452..87656) similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 734

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/718 (52%), Positives = 507/718 (70%), Gaps = 8/718 (1%)

Query: 25  VKEELEDADNFLKDDAELYDKVKNESAVSHLDTIVMPIIFTVLGMFTRMYKIGRNNHVVW 84
           VK E +   +   D+ E   K  N+     L+ + MPI+FT+L +  R+Y++     V W
Sbjct: 16  VKVEHDHGHDLANDNKE--QKASNKQFWLRLERVAMPIVFTLLALLVRLYRLDVVKKVTW 73

Query: 85  DEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEVYPDYIDYVKM 144
           DEAHFGKFGSYYLRH FYHDVHPPLGKMLVG SGYLAGYNGSWDFPSG+ YPDY+ +VKM
Sbjct: 74  DEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGQPYPDYVPFVKM 133

Query: 145 RLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILVIFENSYATLGKFILLDSMLLFFTV 204
           R+FQ   S+LCVP+ YF  +AIGFS  +VWL TILV+ ENSY TLGK ILLDS+LLFFTV
Sbjct: 134 RIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTLGKLILLDSLLLFFTV 193

Query: 205 SSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAISVKMVGLFIISVVGIYTISELWNL 264
           +++ C  KFH+  + PFS +W LWL LTG ++GCAISVKMVGLF+I++VGI+TI ELW L
Sbjct: 194 ATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVELWTL 253

Query: 265 LSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLCFKIHFDLLSNSGPGDSTMPSLFQASLN 324
           L D++++WK Y NHW+ARI  LI+ P  +F LCFKIHF LL  SGPGD  MP  FQA+LN
Sbjct: 254 LGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQAALN 313

Query: 325 GTKVGKGPRDVALGSSIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFF 384
           GT +G+GPRDV++GS+ I+++N    GA LHSH Q +PEGS+Q+QVT Y Y D NN+W  
Sbjct: 314 GTNIGQGPRDVSIGST-ITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNNDWIV 372

Query: 385 QRIRGVEPW--TDAENKTIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGD 442
            R  G   W   D E+   E ++ G+  RL+H+ TG NLH+H+V AP++K +YEVS YG+
Sbjct: 373 YRPHGKPIWHVNDTEH---EAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLDYEVSGYGN 429

Query: 443 VDLGDYKDNWIIEIVEQVGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGE 502
           + +GD KD+W++EI++  G ED  L+HP++T  R ++++L CYLAQS +HLPEWGF Q E
Sbjct: 430 LTIGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHLPEWGFSQAE 489

Query: 503 VVCLKHASKRDKRTWWNIETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPN 562
           V C++   K D +T W ++TH +  L   E+F+YP+ SF+ +F +LN  MMATNNAL  +
Sbjct: 490 VRCIREPEKNDIKTMWIVDTHTHPNLEAPENFIYPRRSFWSDFFELNKRMMATNNALTVS 549

Query: 563 PEKFDGIASSAWQWPTLNVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLT 622
            +K D + S +W+WPTL   +R+  W+E   +Y LLGSPAS WPS++AV  L+  +++  
Sbjct: 550 KDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTVAVLFLVFALLYKV 609

Query: 623 LKWQRQCVILSDPVERDVFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMIL 682
           LKW RQ  I  +  + ++F+    YPLL W LH+ PFV+M RV Y HHYLP LYFAL +L
Sbjct: 610 LKWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPALYFALFVL 669

Query: 683 SYYFDMITKRWATRNTGKFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAW 740
           +Y FD   + +    T + ++   Y  Y S+VI GF  F+PFS+GM G +++Y +L W
Sbjct: 670 AYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGKLENYKHLNW 727

>Kwal_33.15471
          Length = 755

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/758 (46%), Positives = 486/758 (64%), Gaps = 36/758 (4%)

Query: 6   ATGYSEKSTDDDLIWRTPIVKEE---LEDADNFLKDDAELYDKVKNESAVSHLDTIVM-- 60
           ++G+  KS++ +L  R     E    +   ++   D  E   K K + A S +   V+  
Sbjct: 3   SSGFLPKSSELNLRERQKNFTENELSIPPNESLDSDVDEKNSKNKTKFASSSISRNVLLQ 62

Query: 61  ---PIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLS 117
               I+ T+L  + R  KI  N+ VVWDEAHFGKFGSYY+++EFYHDVHPPLGKML+ LS
Sbjct: 63  VTGVILLTILSFYVRFNKIDANDEVVWDEAHFGKFGSYYIKNEFYHDVHPPLGKMLIALS 122

Query: 118 GYLAGYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFT 177
            YLAG+NG + F SG  YP  ++Y  MR F A F +LC P+   T + +GFS L  +   
Sbjct: 123 QYLAGFNGDFAFDSGAPYPSGMNYKFMRQFNATFGALCAPIMLLTAKNLGFSNLGSYFLG 182

Query: 178 ILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLG 237
           ++V  E S+  L KFILLDSMLLFFT +++ C+ + H +R  PF+ RW LW+ L GL++G
Sbjct: 183 MMVALELSFVALSKFILLDSMLLFFTATTFHCITELHKVRNRPFTRRWSLWMLLLGLSVG 242

Query: 238 CAISVKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLC 297
           C  SVK VGLFI  + GIYT+ +L++   D+ +S   Y  HWL RI  LI+IP  V+L C
Sbjct: 243 CVCSVKWVGLFITVIAGIYTVVDLFSYHYDKELSRLSYYKHWLVRIIDLIVIPFLVYLFC 302

Query: 298 FKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALGGALLHSH 357
           FKIHF +L  SG GD+   +LFQ +L+G K+  GPR+VA GS  ++I++  L   LLHSH
Sbjct: 303 FKIHFAILHKSGTGDAATNTLFQVNLDGNKIEIGPRNVAFGSE-VTIRSHGLSPNLLHSH 361

Query: 358 VQPFPEGSEQQQVTVYGYSDANNEWFFQRIR--GVEPWTDA-ENKTIEFVKGGEMYRLMH 414
           VQ +P GS Q QVT YG+SD NN W  +  R  G++   +  ++   + +  G   RL+H
Sbjct: 362 VQLYPFGSGQHQVTGYGHSDDNNNWVIKYPREGGLKAAENGLQDVQSDLLTEGSEIRLVH 421

Query: 415 RLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQVG-------EEDPTL 467
           + TG NLH+HE+PA +SK  +EVS YGD ++GD KD+W++EIV+Q+        +EDP+L
Sbjct: 422 KNTGANLHSHEIPAHVSKGSFEVSGYGDEEIGDIKDDWVVEIVQQLDSDNSSFPKEDPSL 481

Query: 468 LHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENER 527
           LHP+STSFR+++  LGCYLA +G   P WGF+Q E+VC     KRDK TWWNIE H N  
Sbjct: 482 LHPISTSFRLRHKYLGCYLATTGLAYPAWGFKQAEIVCKHTWMKRDKSTWWNIEDHWNPN 541

Query: 528 LPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRLCE 587
           L + E +V PK+ F+ +F+ +N AM ++NNALVP+ +K+D +AS AWQWPTL+VG+R+C 
Sbjct: 542 LEKSEGYVPPKSKFWPDFILINFAMASSNNALVPDEDKYDSLASEAWQWPTLHVGLRMCS 601

Query: 588 WSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDVFVMAAFY 647
           WS  ++KYFLLGSP   W S++++   ++ ++ L  KWQRQ V L+   E     M    
Sbjct: 602 WSNDTVKYFLLGSPFQTWLSTLSLFIFVLILLRLAFKWQRQTVNLTGN-ELSEISMQGVL 660

Query: 648 PLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDM-ITKRWATRNTGKFLRLGA 706
           P LAWLLHY+PFV+M RV Y HHY+P LYFA+++  +  +  + KR+       FL    
Sbjct: 661 PFLAWLLHYLPFVLMGRVTYVHHYVPALYFAILVFGFVLETCLPKRY-------FLN--- 710

Query: 707 YIVYGSIVIAGFFY----FSPFSFGMDGPVDDYAYLAW 740
           YIVY ++  AG  Y    FSP + G+DGP  ++ YL W
Sbjct: 711 YIVYTALY-AGCIYIYVLFSPIAQGIDGPAHNFKYLQW 747

>KLLA0F21978g 2042656..2044929 similar to sp|P42934 Saccharomyces
           cerevisiae YGR199w PMT6 putative mannosyltransferase,
           start by similarity
          Length = 757

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/749 (45%), Positives = 483/749 (64%), Gaps = 26/749 (3%)

Query: 6   ATGYSEKSTDDDLIWRTPIVK--EELEDADNFLKDDAELYDKVKNE------SAVSHLDT 57
           ++G+   S+D  L  R       E LED   FL+D+  + DK+         S  +H   
Sbjct: 5   SSGFLPNSSDLRLRERKAQFDGTEVLED---FLRDNEPVEDKLVKPLKSSIFSNRNHRFH 61

Query: 58  IVMPIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLS 117
             + ++ T++    R YKI R+N VVWDEAHFGKFGSYYL+HEFYHDVHPPLGKML+GL 
Sbjct: 62  TYVCLLLTLVSFVLRFYKIDRSNIVVWDEAHFGKFGSYYLKHEFYHDVHPPLGKMLIGLG 121

Query: 118 GYLAGYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFT 177
            YLAG++G++DF S   YPD +++  MR F A+FSSLC PLA++  R + FS  +V+L  
Sbjct: 122 EYLAGFDGNFDFSSNSSYPDEVNFKIMRQFNAIFSSLCTPLAFYAARNLNFSMPTVYLVA 181

Query: 178 ILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLG 237
           ++V FE+SY  LGKF+LLDSMLLFFTV +++CL++ + +R+   + +W  W+  TG ++G
Sbjct: 182 LMVCFEHSYIVLGKFVLLDSMLLFFTVLTFYCLSQLYRLRECQLTVKWLAWILATGFSIG 241

Query: 238 CAISVKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLC 297
           C  SVK VGL I ++VGIYT+SEL+ L  DRS+S   Y+ HW+ RI  LI+ P+ ++++ 
Sbjct: 242 CVCSVKWVGLLITALVGIYTVSELYCLHCDRSLSKTKYLGHWIVRISALIVFPLILYMVF 301

Query: 298 FKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALGGALLHSH 357
           FKIHF LL  +G GDS+  SLFQA+L G ++   PRD+A GS  IS+++  L   LLHSH
Sbjct: 302 FKIHFTLLYKTGTGDSSTHSLFQANLEGAQIKPSPRDIAFGSC-ISLRSHGLSPGLLHSH 360

Query: 358 VQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAE---NKTIEFVKGGEMYRLMH 414
            Q +P+GS Q+QVT Y Y D NN W  +  R     +  E   +  I F+K G++ RL+H
Sbjct: 361 PQTYPDGSNQRQVTGYSYRDGNNNWIVKYSRSSGKASAEERVYSDNILFLKDGDLLRLVH 420

Query: 415 RLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQVGE-----EDPTLLH 469
             T  NLHTH++P+ +SK  YEVS YG+  +GD KD+WIIE+VEQ+       E+  L+H
Sbjct: 421 EKTKNNLHTHQIPSHVSKGHYEVSGYGNDAVGDLKDDWIIEVVEQLPTGNNTMENKALIH 480

Query: 470 PLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENERLP 529
           PL+TSFR++N  LGCYLA +G   P WG+ Q E+VC    ++RDK TWWN+E H N  L 
Sbjct: 481 PLTTSFRLRNKELGCYLAATGLSYPGWGYNQAEIVCKYPWNQRDKSTWWNVEDHINSNLH 540

Query: 530 QGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRLCEWS 589
             + F  P T F+ +F+ +N AM A+NNAL+P+ +K+D IAS  W+WP L  G+R+C W+
Sbjct: 541 IDQTFTPPPTKFWTDFVVINFAMAASNNALIPDLDKYDRIASEPWEWPILYKGLRMCNWN 600

Query: 590 EKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDVFVMAAFYPL 649
           +K++KY+LLGSP + W S+ A+  L+I V     ++QRQ + L++    ++F  A     
Sbjct: 601 DKTVKYYLLGSPFNTWLSTAALPILLILVSMELFRYQRQSLQLNEKKAWNLFACAGL-SF 659

Query: 650 LAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTGKFLRLGAYIV 709
           + WLLHY PF +M RV Y HHY+P L+FA+M  +Y  D     +A  N+ ++L++ AY  
Sbjct: 660 IGWLLHYAPFFIMGRVTYIHHYVPALFFAIMTFAYVVD-----FALANSNRYLKVVAYSS 714

Query: 710 YGSIVIAGFFYFSPFSFGMDGPVDDYAYL 738
             +     ++YF+PF  GM  P   Y  L
Sbjct: 715 LYAGCTFTYWYFAPFCQGMPEPNLTYVNL 743

>YGR199W (PMT6) [2149] chr7 (897505..899784) Protein with similarity
           to O-mannosyltransferases Pmt1p, Pmt2p, Pmt3p, Pmt4p and
           Pmt5p [2280 bp, 759 aa]
          Length = 759

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/761 (43%), Positives = 488/761 (64%), Gaps = 41/761 (5%)

Query: 6   ATGYSEKSTDDDLIWRTPIVKEELEDADNFLKDDAELYDKV-------KNE--SAVSHLD 56
            TG+S   T+D+ + R   V +   +A +   +  + ++++       KNE  +A+  L 
Sbjct: 6   GTGFSSIDTEDENL-RERYVNQPKANASDIQDEQLDCFEQLEEKHRTKKNEEYTALKILR 64

Query: 57  TIVMPIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGL 116
            ++ P++ T+   + R   I +NN+VVWDEAHFGKFGSYY++HE+YHDVHPPLGKML+ L
Sbjct: 65  DVIGPLLLTITSFYLRFQHIDQNNYVVWDEAHFGKFGSYYIKHEYYHDVHPPLGKMLIAL 124

Query: 117 SGYLAGYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLF 176
           S ++AG++G +DF S   YP+ +++  MR F A F +LC P+A+FT + +GF+  +V+L 
Sbjct: 125 SEWMAGFDGQFDFSSNNAYPENVNFKLMRQFNATFGALCTPVAFFTAKWMGFNYFTVYLI 184

Query: 177 TILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNL 236
             +V  E+SY  L KFILLDSMLLFF+++++ C+ K +T+RK   + +W LW+ LTGL++
Sbjct: 185 ATMVTLEHSYIVLSKFILLDSMLLFFSMTTFACMIKLYTLRKQQMTKKWSLWMLLTGLSI 244

Query: 237 GCAISVKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFLL 296
           GC  SVK VGLFI  VVG+YT  EL+ L  D+ +    Y  HWL RI  LI+IP  ++L 
Sbjct: 245 GCVCSVKWVGLFITVVVGLYTCIELFLLYCDKELPRIKYYKHWLIRIINLIVIPFLIYLY 304

Query: 297 CFKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALGGALLHS 356
           CFKIHF LL  SG GDST  +LFQ +L GT++  GPRDVA GS  ++I++  L   LLHS
Sbjct: 305 CFKIHFVLLYKSGTGDSTTNTLFQINLEGTQIEAGPRDVAFGSE-LTIRSHGLSPNLLHS 363

Query: 357 HVQPFPEGSEQQQVTVYGYSDANNEWFFQ--RIRGVEPWTDA--ENKTIEFVKGGEMYRL 412
           H+Q +PEGS Q+Q+T YG++D+NN W F+  R  G+E   +     K I    G E+ RL
Sbjct: 364 HIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNGTLNGKIIPITDGVEV-RL 422

Query: 413 MHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQVGEEDP------- 465
            H+ TG NLH+H+VP+ +S+  YEVS YG   +GD KD+WI+EIV+Q+   +P       
Sbjct: 423 SHKNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVEIVKQMDSPNPVYSNENS 482

Query: 466 TLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHEN 525
           T+LHP+ST FR+++ +LGCYLA +G   P WGF+Q E+VC    S+RDK TWWN+E H N
Sbjct: 483 TILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDSWSRRDKSTWWNVEDHWN 542

Query: 526 ERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRL 585
             L   ED+V PK++F+ +F+  N AM ++NNALVP+ +K+D ++S AW+WPTL+ G+R+
Sbjct: 543 HNLETAEDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYDSLSSDAWEWPTLHKGLRM 602

Query: 586 CEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDVFVMAA 645
           C W+    +Y+L+GSP + W S++++      ++F+  +W+RQ + LSD     + +   
Sbjct: 603 CSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRRQTLYLSDDQIWQITIQGI 662

Query: 646 FYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKR--WATRNTGKFLR 703
           F P ++W+ HY+PF +M RV Y HHY+P LYFA+++  +  D    R  W  +       
Sbjct: 663 F-PFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDFTLTRVHWMVK------- 714

Query: 704 LGAYIVYGSIVIAGFFY----FSPFSFGMDGPVDDYAYLAW 740
              Y +Y S+   G  Y    F+P   GM G   +Y  L W
Sbjct: 715 ---YPIYLSL-FGGCIYIYNLFAPICQGMHGDKAEYLPLQW 751

>CAGL0K00979g complement(97306..99498) similar to sp|P42934
           Saccharomyces cerevisiae YGR199w
           Dolichyl-phosphate-mannose--protein mannosyltransferase
           6, hypothetical start
          Length = 730

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/696 (45%), Positives = 450/696 (64%), Gaps = 23/696 (3%)

Query: 58  IVMPIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLS 117
           ++  + FTVL    R   I +NN VVWDEAHFGKFGSYY+RHEFYHDVHPPLGKML+ LS
Sbjct: 37  LIACLGFTVLSFVLRFQGIDKNNSVVWDEAHFGKFGSYYIRHEFYHDVHPPLGKMLIALS 96

Query: 118 GYLAGYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFT 177
            +LAG++G +DF SG  YPD +++  MR F A F +LC P+ +FT + +  S   V+L T
Sbjct: 97  EWLAGFDGEFDFESGHQYPDGVNFKFMRQFNATFGALCTPVVFFTAKTMNLSWPIVYLVT 156

Query: 178 ILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLG 237
           ++V  E+S+  L KFILLDSMLLFFT +++ C+ K   +R    + +W  WL LTGL++G
Sbjct: 157 LMVTLEHSFIALSKFILLDSMLLFFTATTFACMVKLIQLRGCQLTRQWLWWLLLTGLSIG 216

Query: 238 CAISVKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLC 297
           C  SVK VGLFI  VVG++TI +L     ++  S K+Y  HW+ RI  LIIIP  V+L C
Sbjct: 217 CVCSVKWVGLFITLVVGLFTIIDLLEHYWNKKESRKIYYKHWILRIINLIIIPFLVYLFC 276

Query: 298 FKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALGGALLHSH 357
           FKIHF LL  SG GD++  SLFQ +L GT++   PR V  GS  ++I++  L   LLHSH
Sbjct: 277 FKIHFLLLYKSGTGDASTNSLFQVNLEGTQIQNSPRTVMYGSE-VTIRSHGLSPNLLHSH 335

Query: 358 VQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENKTIEF----VKGGEMYRLM 413
           VQ +P+GS Q+QVT YG+SD NN W  +  R    + D +NK +      V+ G+  RL 
Sbjct: 336 VQLYPDGSRQRQVTGYGHSDGNNNWMIKFGRTTGRYLDEDNKRLNGELVPVRDGDTIRLF 395

Query: 414 HRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQV-------GEEDPT 466
           H   G NLH+H + + +SK  YEVS YG  ++GD KD+WIIEI+EQ+       G+ED  
Sbjct: 396 HVRMGCNLHSHTISSHVSKGNYEVSGYGSEEVGDEKDDWIIEIMEQLDSANTNFGKEDNE 455

Query: 467 LLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENE 526
           +LHP+ST FR+++  LGCYLA +G   P WGF Q E+VC     KRDK TWWN+E H N+
Sbjct: 456 VLHPISTMFRLRHKDLGCYLASTGLSYPTWGFHQAEIVCKYSWGKRDKSTWWNVEDHWND 515

Query: 527 RLPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRLC 586
           +L   E++V PK+ F+ +F+ +N AM ++NNALVP+ +K+D +AS AW+WP L+ G+RLC
Sbjct: 516 QLVVDEEYVPPKSKFWTDFILINFAMASSNNALVPDEDKYDYLASKAWEWPILHKGLRLC 575

Query: 587 EWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDVFVMAAF 646
            WS   ++Y+LLGSP + W SSIA+   I+  + + +KW+RQ +++++     +      
Sbjct: 576 GWSSAGVRYYLLGSPFNTWLSSIALLVNILLGMVVAIKWRRQSIVINEESCWKL-FTLLL 634

Query: 647 YPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTGKFLRLGA 706
           +P LAWL ++MP+V+M RV Y HHY+P LYFA++      + +   + T        + A
Sbjct: 635 FPFLAWLANFMPYVMMGRVTYVHHYMPALYFAIIAFGSITEYLLADYCT--------VKA 686

Query: 707 YIVYGSIVIAG--FFYFSPFSFGMDGPVDDYAYLAW 740
           ++ + S+V     ++YF+P   G+ G    Y YL W
Sbjct: 687 FLAFLSMVGCTYIYWYFAPICQGLHGIGSHYFYLQW 722

>Scas_408.1*
          Length = 391

 Score =  363 bits (932), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 181/372 (48%), Positives = 253/372 (68%), Gaps = 6/372 (1%)

Query: 14  TDDDLIWRTPIVKEELE-DADNFLKDDAEL----YDKVKNESAVSHLDTIVMPIIFTVLG 68
           TD  L  R  + +   E D      DD++     Y  V      S + + + P++ T+L 
Sbjct: 15  TDSSLRERKAVTQTSTELDIKQHEPDDSKQNKSRYPYVTTAKISSSMRSYIGPLLLTILS 74

Query: 69  MFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWD 128
              R + IG+NNHVVWDEAHFGKFGSYY+ HEFYHDVHPPLGKML+ LS YLAG++G ++
Sbjct: 75  FQLRFHDIGKNNHVVWDEAHFGKFGSYYITHEFYHDVHPPLGKMLIALSEYLAGFDGHFN 134

Query: 129 FPSGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILVIFENSYAT 188
           F S E YP+ ++Y+ MR F AMF +LCVP+  FT R++GF+ L+ +L T++V  E+SY  
Sbjct: 135 FDSNEAYPEEVNYIFMRQFNAMFGALCVPVTLFTTRSMGFNWLTSYLVTLMVTLEHSYIV 194

Query: 189 LGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAISVKMVGLF 248
           L KFILLDS+LLFFT++++ C+ K +T++K   + +W LW+ LTGL++GC  SVK VGLF
Sbjct: 195 LSKFILLDSILLFFTLTTFACMVKLYTLKKRQLTKQWSLWMLLTGLSVGCVCSVKWVGLF 254

Query: 249 IISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLCFKIHFDLLSNS 308
           I  +VG++TI EL+    D+++    Y  HW+ RI  LIIIP  +++ CFKIHF LL  S
Sbjct: 255 ITIIVGLFTIMELFTHHYDKTLPRVKYYKHWMIRIIDLIIIPFLIYMFCFKIHFTLLYKS 314

Query: 309 GPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALGGALLHSHVQPFPEGSEQQ 368
           G GDS   +LFQ +L GT +  GPRDV  GS  ++I++  L   LLHSHVQ +P+GS Q+
Sbjct: 315 GTGDSATNTLFQVNLEGTTIENGPRDVMYGSE-VTIRSHGLSPNLLHSHVQLYPDGSRQR 373

Query: 369 QVTVYGYSDANN 380
           Q+T YG+SD+++
Sbjct: 374 QITGYGHSDSSS 385

>CAGL0L07216g complement(799529..802105) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w, hypothetical start
          Length = 858

 Score =  354 bits (908), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 247/742 (33%), Positives = 374/742 (50%), Gaps = 49/742 (6%)

Query: 5   VATGYSEKSTDDDLIWRTPIVKEELEDADNFLKDDAELYDKVKNESAVSHLDTIVMPIIF 64
           V+T  S    D D +    I K  L    +F  D    YD  K  + V  L   +M  I 
Sbjct: 13  VSTADSLLCMDVDPVPEVKINKGPLRPYIDFEGD----YDTAKLRT-VKTLKEKLMVAIL 67

Query: 65  TVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 124
            ++  F R+YK+   + VV+DE HFG F S Y++ +F+ DVHPPL KML    G LAGY 
Sbjct: 68  LIITAFVRLYKLSWPSSVVFDEVHFGGFASKYIKGDFFMDVHPPLAKMLFAGVGALAGYT 127

Query: 125 GSWDF-PSGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILVIFE 183
           G + F P GE YPD + +  MRLF A      V + Y T RA G      +LF ++  FE
Sbjct: 128 GDFSFKPIGEEYPDTVPFYTMRLFSASLGVFTVLMLYLTLRASGVRLGVAYLFALVFAFE 187

Query: 184 NSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAISVK 243
           NS+ T+ ++ILLD+ L+ F  ++ +   K      + F  R    L  TG+ LG A S K
Sbjct: 188 NSFVTISRYILLDAPLICFIAAAVYSYKKSELYPTNSF--RALKSLLATGIALGLASSSK 245

Query: 244 MVGLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLCFKIHFD 303
            VGLF ++ VG+  + +LW ++ D + S    V   + ++  L+ +P+ +++  F +HF 
Sbjct: 246 WVGLFTVAWVGLLCVWKLWFMIGDLNKSPCTIVKAAIGKLVLLLGVPILLYVAFFYVHFQ 305

Query: 304 LLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALG---SSIISIKNQALGGALLHSHVQP 360
            L + G G S  PS F+A+L G ++   P DV       SI+++K+ +  G  LHSH   
Sbjct: 306 ALIHDGSGSSFFPSEFRATLEGNQI---PSDVVYDVGVGSIVTLKHLSTEGGYLHSHSHA 362

Query: 361 FPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENKTIEFVKGGEMYRLMHRLTGKN 420
           +P GSEQQQ+T+Y + D NN+W  +R         A  K    +K GE   L+H  TG  
Sbjct: 363 YPTGSEQQQITLYPFLDDNNKWVIERSH----LPGASLKDFIGLKNGESISLLHLATGVR 418

Query: 421 LHTHEVPAPISKS---EYEVSAYGDVDL-GDYKDNWIIEIVEQVGEEDPTLLH---PLST 473
           LH+H+   P+S+S   + EVS YG +   GD  D+W IEI +Q   +     H    + T
Sbjct: 419 LHSHDHKPPVSESADWQKEVSGYGYLGFTGDINDHWTIEI-DQSSSKPGIAQHEVRAIDT 477

Query: 474 SFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENERLPQGED 533
            F+++++  GCYL      LP+WGF Q EV C      + +   W IE  EN +LP+   
Sbjct: 478 KFKLRHAT-GCYLFSHEVKLPKWGFDQQEVTCATQG--KPELLLWYIEGSENPQLPENTP 534

Query: 534 FV-YPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRLCEWSEKS 592
            + Y   +F   F++ +  M   N  L           S A++WP +  G+    W E  
Sbjct: 535 RISYKPMNFIEKFIENHKKMWKINKGLTGT----HYYESLAYEWPLMRRGIGY--WGEHH 588

Query: 593 IKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDV----FVMAAFYP 648
            K +LLG+  + W    AV A I+ V    L ++    ++  P+ +D     F +   + 
Sbjct: 589 RKIYLLGNAVTWW----AVSAFIL-VYAAILAFEAGSFLVGKPILQDKNVINFHVQVLHY 643

Query: 649 LLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFD-MITKRWATRNTGKFLRLGAY 707
           LL + +HY+PF +M R ++ HHYLP  YF ++ L++ FD +IT     R    +  L   
Sbjct: 644 LLGFAIHYVPFFLMGRQLFLHHYLPAYYFGILALAHAFDIIITFVCKNRKQAAYALL--- 700

Query: 708 IVYGSIVIAGFFYFSPFSFGMD 729
           I++ +  I  F   SP ++G D
Sbjct: 701 ILFTAASIYFFHAHSPIAYGTD 722

>KLLA0E01342g complement(134691..137207) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase, start by similarity
          Length = 838

 Score =  330 bits (847), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 223/678 (32%), Positives = 343/678 (50%), Gaps = 31/678 (4%)

Query: 62  IIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 121
           I   V+    R++ +   N VV+DE HFGKF + Y++  F+ DVHPPL KML    G LA
Sbjct: 58  IALAVIASVVRLWNLSDPNSVVFDEVHFGKFAAKYIKGIFFTDVHPPLAKMLFAGIGSLA 117

Query: 122 GYNGSWDFPS-GEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILV 180
           G+ G ++F   G  +P    Y  MR F A      V L YFT RA G      ++ +++ 
Sbjct: 118 GFTGDFEFKDIGLAFPASTPYFAMRFFSAFLGLATVLLMYFTLRASGIRIWIAFVASLMF 177

Query: 181 IFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAI 240
             ENS+ T+ ++ILLD+ L+FF  ++ +   K+       F++  +  L  TGL+LG A+
Sbjct: 178 ALENSFVTISRYILLDAPLIFFIAAAAYSYKKYEIHPSESFNS--YKALLATGLSLGLAV 235

Query: 241 SVKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLCFKI 300
           S K VGLF I+ VG  ++ +LW  + D     +  + H + +   L+  P  ++L  F I
Sbjct: 236 SSKWVGLFTIAWVGALSLFKLWFDIGDLKKPVQSTLRHTVVKATLLLAAPAALYLFFFYI 295

Query: 301 HFDLLSNSGPGDSTMPSLFQASLNGTKVGKG-PRDVALGSSIISIKNQALGGALLHSHVQ 359
           HF  L  +  G     S F+++L G  +    P DV +GSS +SI++    G  LHSH  
Sbjct: 296 HFQTLIYNSDGAGFFSSAFRSTLIGNNIPSNIPYDVGVGSS-VSIRHTGTMGGYLHSHKH 354

Query: 360 PFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAE--NKTIEFVKGGEMYRLMHRLT 417
            +  GS+QQQVT+Y + DANN+W       +E +   E   +T E +K G   RL HRLT
Sbjct: 355 IYETGSKQQQVTLYSHLDANNDWV------IELYDQPEVIPETFEGLKDGTKIRLRHRLT 408

Query: 418 GKNLHTHEVPAPISKS---EYEVSAYG-DVDLGDYKDNWIIEIVEQVGE--EDPTLLHPL 471
            + LH+H+   P+S+S   + EVSAYG D   GD  D+W+IEI  +     E    +  L
Sbjct: 409 DRRLHSHDHKPPVSESSDWQKEVSAYGADNFTGDANDDWVIEIDHEASAPGEAQEYVKAL 468

Query: 472 STSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENERLPQ- 530
            T FR+++++ GC L      LP+WGF Q EV C   +S     T W +E + N  LP+ 
Sbjct: 469 DTKFRLRHAMTGCRLFSHEVKLPKWGFEQQEVTCA--SSGVPSLTLWYVEHNSNPLLPED 526

Query: 531 GEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRLCEWSE 590
                Y   +F   F++ +  M   N     N ++     S    WP L  G+    WS+
Sbjct: 527 AAKISYQTPTFLEKFIESHQRMWHINK----NLKEHHVYQSDPATWPLLLRGISY--WSQ 580

Query: 591 KSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDVFVMAAFYPLL 650
              + +LLG+    W  +  +   ++ ++   L WQ    IL D    + F +  F  LL
Sbjct: 581 DHKQIYLLGNAVVWWSVTAFIGVFVLVIVAELLAWQLGKSILQDKHVLN-FHIQTFQYLL 639

Query: 651 AWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTGKFLRLGAYIVY 710
            W LHY P  +M R ++ HHYLP  YF ++  ++  ++I   +  +N  K +  G  I +
Sbjct: 640 GWGLHYAPSFLMGRQLFLHHYLPAYYFGILAFAHALEIIVS-YVFKNK-KTVGYGVVITF 697

Query: 711 GSIVIAGFFYFSPFSFGM 728
            +   A F+ + P  +G+
Sbjct: 698 LAAATAFFYVYKPLIYGL 715

>Kwal_23.3623
          Length = 876

 Score =  328 bits (842), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 232/705 (32%), Positives = 354/705 (50%), Gaps = 47/705 (6%)

Query: 1   MPYRVATGYSEKSTDDDL----IWRTPIVKEELEDADNFLKDDAELYDKVKNESAVSHLD 56
           MP +V  G     ++D +    I   P+    + +    LK+ +     VK +  ++ L 
Sbjct: 44  MPSKVHRGLERTGSEDPVPELAIQNGPVRPYIVTEPPQTLKE-SRTPTSVKEKVTIAALA 102

Query: 57  TIVMPIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGL 116
            I   I         R+Y +   N VV+DE HFG F + Y++  F+ DVHPPL KML   
Sbjct: 103 VITGVI---------RLYGLSNPNSVVFDEVHFGGFAAKYIKGIFFMDVHPPLAKMLFAA 153

Query: 117 SGYLAGYNGSWDFPS-GEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWL 175
            G +AG+ G +DF   G+ +P+   Y  MRLF A+  +L V L Y T R  G      ++
Sbjct: 154 IGSIAGFTGDFDFEKIGQHFPESTPYYFMRLFPALLGTLTVLLMYLTLRCSGVRIPIAFI 213

Query: 176 FTILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLN 235
            ++    ENS+ T+ ++ILLD+ LLFF  S+ +   K+    +  + +     L   GL 
Sbjct: 214 ASLCFAIENSFVTISRYILLDAPLLFFIASAVYSFKKYEIYPQGSWGS--LKALLSGGLA 271

Query: 236 LGCAISVKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFL 295
           LG A+S K VGLF I+ VG+  I  LW ++ D S      +     ++   + +P+ ++ 
Sbjct: 272 LGMALSSKWVGLFTIAWVGVLCIWRLWFMVGDLSKPLSSTLKEASRKLMFFLALPLALYA 331

Query: 296 LCFKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGP-RDVALGSSIISIKNQALGGALL 354
           + F +HF+ L+ +  G     S F+ +L+G  + K    DV +GS+ IS+++ A  G  L
Sbjct: 332 VFFYVHFETLTINSDGAGFFSSAFRTTLHGNTIPKDILADVGIGST-ISMRHVATMGGYL 390

Query: 355 HSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENKTI---EFVKGGEMYR 411
           HSH   + +GS+QQQVT+Y + D NN+W  +         D  NK +   E +K G + R
Sbjct: 391 HSHNHMYEKGSQQQQVTLYPHLDGNNDWVIE-------LPDQPNKAVTSFEGLKDGTVIR 443

Query: 412 LMHRLTGKNLHTHEVPAPISKS---EYEVSAYGDVDL-GDYKDNWIIEIVEQVGE--EDP 465
           L H +T + LH+H+  AP+S+S   + EVS YG  D  GD  D+W IEI +   E  E  
Sbjct: 444 LKHAITQRRLHSHDHKAPVSESADWQKEVSCYGFEDFEGDGNDDWTIEIDQDASEPGEAQ 503

Query: 466 TLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHEN 525
             +  L T FR+K++I+ C+L      LP+WGF Q EV C      +   T W IE + +
Sbjct: 504 KRVKALDTKFRLKHNIMNCHLFSHEVKLPKWGFEQQEVTCASQG--KPYLTLWYIEGNSH 561

Query: 526 ERLPQGEDFV-YPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVR 584
             L   ++ V Y K +FF   ++ +  M   N  LV  P  ++   S    WP L  G+ 
Sbjct: 562 PLLTGDQERVSYKKPNFFEKLIESHQRMWHINKNLV-EPHIYE---SKPHSWPFLLRGIN 617

Query: 585 LCEWSEKSIKYFLLGSPASVWPSSIAVCALIIH-VIFLTLKWQRQCVILSDPVERDVFVM 643
              W E   + +LLG+ A VW S  A  AL    V+F    WQ    IL D    +  V 
Sbjct: 618 Y--WGENHKQVYLLGN-AIVWWSVTAFIALFATIVVFELFAWQLGKPILQDSKVVNFHVQ 674

Query: 644 AAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDM 688
              Y LL + LHY+P  +M R ++ HHYLP  YF ++  ++  D+
Sbjct: 675 VIHY-LLGYGLHYIPSFLMGRQLFLHHYLPAYYFGILAFAHALDI 718

>YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), first step in O-glycosylation
           [2454 bp, 817 aa]
          Length = 817

 Score =  325 bits (834), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 228/685 (33%), Positives = 342/685 (49%), Gaps = 41/685 (5%)

Query: 57  TIVMPIIFTVLGMFT---RMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKML 113
           T+   ++   L +FT   R++ +   + VV+DE HFG F S Y+R  ++ DVHPPL KML
Sbjct: 46  TLKEKLLVACLAVFTAVIRLHGLAWPDSVVFDEVHFGGFASQYIRGTYFMDVHPPLAKML 105

Query: 114 VGLSGYLAGYNGSWDFPS-GEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLS 172
                 L G+ G +DF + G+ +P    YV MR F A   +L V L Y T R  G     
Sbjct: 106 YAGVASLGGFQGDFDFENIGDSFPSTTPYVLMRFFSASLGALTVILMYMTLRYSGVRMWV 165

Query: 173 VWLFTILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLT 232
             +  I    ENSY T+ ++ILLD+ L+FF  ++ +   K+     +  +A  +  L  T
Sbjct: 166 ALMSAICFAVENSYVTISRYILLDAPLMFFIAAAVYSFKKYEMYPANSLNA--YKSLLAT 223

Query: 233 GLNLGCAISVKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVC 292
           G+ LG A S K VGLF ++ VG+  I  LW ++ D + S K       A++  L+ +P  
Sbjct: 224 GIALGMASSSKWVGLFTVTWVGLLCIWRLWFMIGDLTKSSKSIFKVAFAKLAFLLGVPFA 283

Query: 293 VFLLCFKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKG-PRDVALGSSIISIKNQALGG 351
           ++L+ F IHF  L+  G G S     F+++L   K+ +    DV +G SIIS+++ +  G
Sbjct: 284 LYLVFFYIHFQSLTLDGDGASFFSPEFRSTLKNNKIPQNVVADVGIG-SIISLRHLSTMG 342

Query: 352 ALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGV-EPWTDAENKTIEFVKGGEMY 410
             LHSH   +P GSEQQQ T+Y + DANN+W  +      E  T  +N T      G   
Sbjct: 343 GYLHSHSHNYPAGSEQQQSTLYPHMDANNDWLLELYNAPGESLTTFQNLT-----DGTKV 397

Query: 411 RLMHRLTGKNLHTHEVPAPISKS---EYEVSAYGDVDL-GDYKDNWIIEIVEQ-----VG 461
           RL H +T   LH+H+   P+S+S   + EVS YG     GD  D+W++EI ++     V 
Sbjct: 398 RLFHTVTRCRLHSHDHKPPVSESSDWQKEVSCYGYSGFDGDANDDWVVEIDKKNSAPGVA 457

Query: 462 EEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIE 521
           +E    +  L T FR+++++ GCYL      LP WGF Q EV C   +S R   T W +E
Sbjct: 458 QER---VIALDTKFRLRHAMTGCYLFSHEVKLPAWGFEQQEVTCA--SSGRHDLTLWYVE 512

Query: 522 THENERLPQGEDFV-YPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLN 580
            + N  LP+    + Y   SF   F++ +  M   N  LV  P  ++   +S   WP L 
Sbjct: 513 NNSNPLLPEDTKRISYKPASFISKFIESHKKMWHINKNLV-EPHVYESQPTS---WPFLL 568

Query: 581 VGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDV 640
            G+    W E +   +LLG+    W  +  +    + VI     WQ    IL D    + 
Sbjct: 569 RGISY--WGENNRNVYLLGNAIVWWAVTAFIGIFGLIVITELFSWQLGKPILKDSKVVNF 626

Query: 641 FVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTGK 700
            V    Y LL + +HY P  +M R ++ HHYLP  YF ++ L +  D+I   +  R+   
Sbjct: 627 HVQVIHY-LLGFAVHYAPSFLMQRQMFLHHYLPAYYFGILALGHALDIIVS-YVFRSK-- 682

Query: 701 FLRLGAYIVYGSIVIAGFFYFSPFS 725
             R   Y V  + + A  ++F  FS
Sbjct: 683 --RQMGYAVVITFLAASVYFFKSFS 705

>ADR279C [2020] [Homologous to ScYDL095W (PMT1) - SH; ScYDL093W
           (PMT5) - SH] (1177907..1180360) [2454 bp, 817 aa]
          Length = 817

 Score =  318 bits (815), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 217/671 (32%), Positives = 337/671 (50%), Gaps = 36/671 (5%)

Query: 72  RMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPS 131
           R+Y +   + VV+DE HFG + S Y++  F+ DVHPPL KML+  +G LAGY G + F  
Sbjct: 63  RLYNLAYPDSVVFDEVHFGGYASKYIQGAFFLDVHPPLAKMLLAGAGKLAGYGGEFGFED 122

Query: 132 -GEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILVIFENSYATLG 190
            G  YP  + Y  MR   A    L V L + T RA G  +   +  +++   ENS+ T+ 
Sbjct: 123 IGIDYPATVPYQVMRFLPAALGVLTVLLMFLTLRASGVRKWVAFAVSLVFTVENSFVTIS 182

Query: 191 KFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAISVKMVGLFII 250
           ++ILLDS LLFF  ++ +   +    +    S +++  L  TG+ LG A+S K VG F  
Sbjct: 183 RYILLDSPLLFFIAAAVYSFKRLELHQTG--SLQYYKCLAATGMALGLAMSSKWVGFFTF 240

Query: 251 SVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLCFKIHFDLLSNSGP 310
           + VG+ ++ +LW  + D +      +     +   L ++P+C+++L F+IHF  L N   
Sbjct: 241 AWVGVVSVMQLWFQVGDLNKPVPSILKQSAIKASILCVLPMCLYVLFFRIHFQSLPNVTD 300

Query: 311 GDSTMPSLFQASLNGTKVGKGPRDVALG---SSIISIKNQALGGALLHSHVQPFPEGSEQ 367
                 S F+ +L+G  +   P ++  G    S ++I++    G  LHSH   +  GSEQ
Sbjct: 301 AAGNFSSAFRTTLHGHTI---PANIYAGVGIGSTVTIRHIGTMGGYLHSHNHMYQGGSEQ 357

Query: 368 QQVTVYGYSDANNEWFFQRIRGVEPWTDAENKTIEFVKGGEMYRLMHRLTGKNLHTHEVP 427
           QQVT+Y + D NN W+ +        ++    T E ++ G   RL H LTG  LH+H+  
Sbjct: 358 QQVTLYPHLDQNNHWYIEHYNA----SNTVPTTFEGLEHGTKIRLKHVLTGHRLHSHDHK 413

Query: 428 APISKS---EYEVSAYGDVDL-GDYKDNWIIEIVEQVGE--EDPTLLHPLSTSFRIKNSI 481
            P+S S   + EVS YG  +  GD  D+WI+EI ++     E    +  + T FR+++++
Sbjct: 414 PPVSVSSDWQKEVSGYGFPEFEGDANDDWIVEIDQEKSTPGEARERVRAIETKFRLRHAM 473

Query: 482 LGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENERLPQ-GEDFVYPKTS 540
            GC L      LP+WGF Q EV C      R   T W IE + N  L +  E   Y   +
Sbjct: 474 TGCMLFSHQVKLPKWGFEQQEVTCATQG--RPDLTLWYIEENTNPLLSEDSEKISYKTPN 531

Query: 541 FFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRLCEWSEKSIKYFLLGS 600
           F+   ++++  M   N +L           S   QWP L  G+    WS+ S + +LLG+
Sbjct: 532 FWEKLVEIHRKMWHINKSLT----DAHMYQSDPIQWPFLLRGISY--WSKDSRQVYLLGN 585

Query: 601 PASVWPSSIAVCALIIHVIFL--TLKWQRQCVILSDPVERDVFVMAAFYPLLAWLLHYMP 658
            A VW  S+ +  +I  +I +     WQ    ILSD    +  +    Y LL + +HY+P
Sbjct: 586 -AVVW-YSVTLFVVIFGLICVGELFVWQLGKPILSDTKILNFHIQTIHY-LLGYFIHYLP 642

Query: 659 FVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTGKFLRLGAYIVYGSIVIAGF 718
             +M R ++ HHYLP  YF ++ L++  D +   +  R       L A  V GS  IA F
Sbjct: 643 SFLMGRQMFLHHYLPAYYFGILALAHGLDGLVT-FLNRKRPIAYGLVAMFVLGS--IAFF 699

Query: 719 FYFSPFSFGMD 729
             +SP  +G+ 
Sbjct: 700 VTYSPLVYGLQ 710

>YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT
           O-mannosyltransferases family [2232 bp, 743 aa]
          Length = 743

 Score =  288 bits (736), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 213/680 (31%), Positives = 324/680 (47%), Gaps = 47/680 (6%)

Query: 62  IIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 121
           +IFT +    R++ I   N VV+ E   G F S Y+ + F+ DVHPPL  ML      + 
Sbjct: 53  LIFTAI---VRLHNISLPNSVVFGENEVGTFVSQYVNNIFFTDVHPPLVAMLYATVSSVF 109

Query: 122 GYNGSWDFPS-GEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILV 180
           GY G +++ + G  Y   + YV MR F A    + V + Y T R  G       +  +  
Sbjct: 110 GYKGLFNYGNIGTEYTANVPYVAMRFFSATLGIVSVLVLYLTLRVSGVKIAVAAICAVCF 169

Query: 181 IFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKS----PFSARWWLWLCLTGLNL 236
             ENS+ TL +F L++   +FF      C   F   R+S    P S +    L    + L
Sbjct: 170 AIENSFVTLSRFTLIEGPFVFFMA----CAVYF--FRRSELYLPNSCKANKSLLAASIAL 223

Query: 237 GCAISVKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFLL 296
           G A+S K  GLF I+  GI  +  +W ++ D S      + +   +   L+ IP  ++ L
Sbjct: 224 GFAVSSKWAGLFTIAWAGIIVLWRVWFMIGDLSRPIGSSIKYMAFQFTCLLAIPAFIYFL 283

Query: 297 CFKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGP-RDVALGSSIISIKNQALGGALLH 355
            F +H   L+ +G   S  P+ F+ +L    V K    +VA+GS++ S+ +    G  LH
Sbjct: 284 IFSVHIKTLNVNGISSSFFPAEFRKTLKYNNVIKETVAEVAVGSAV-SLNHVGTAGGYLH 342

Query: 356 SHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGV-EPWTDAENKTIEFVKGGEMYRLMH 414
           SH+  +P GS QQQVT+Y + D NN+W  +      E  T  +N T      G + +L  
Sbjct: 343 SHLHNYPAGSMQQQVTLYPHIDQNNKWIIELAEHPNENVTSFQNLT-----DGTIIKLRQ 397

Query: 415 RLTGKNLHTHEVPAPISKS---EYEVSAYGDVDL-GDYKDNWIIEIVEQVGEEDPTLLH- 469
              G  LH+H+   P+S++   + EVS YG     GD  D+WIIEI ++  E  P   H 
Sbjct: 398 LKNGCRLHSHDHKPPVSQNADWQKEVSCYGYEGFEGDINDDWIIEIDKKRSEPGPAQEHI 457

Query: 470 -PLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENE-R 527
             + T FR+K+ + GCYL    + LPEWGF Q EV C   A  R+  T W IE +ENE  
Sbjct: 458 RAIETKFRLKHYLTGCYLFSHPEKLPEWGFGQQEVTCAYFA--REDLTSWYIEENENEIS 515

Query: 528 LPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRLCE 587
           LP  E   Y K SF++ F+ ++  M   NN +    +     +S    WP +  G+    
Sbjct: 516 LPNPEKVSYKKMSFWQKFVAIHKFMFYLNNYM----DTSHAYSSEPKTWPLMLRGIDF-- 569

Query: 588 WSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDVFVMAAFY 647
           W+E   + + LG+    W  +  +C  II V    L W+    IL D    + F    F 
Sbjct: 570 WNENGREVYFLGNAVLWWSVTAFICTFIIGVAVELLAWKLGVNILRDKHIIN-FHYQVFQ 628

Query: 648 PLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATR--NTGKFLRLG 705
            LL +  HY P+  + + ++ + YLP  YF ++   +  D+I+   + +  NTG      
Sbjct: 629 YLLGFAAHYFPYFFVGQKLFLYDYLPAYYFGILAFGHALDLISTYISNKRNNTG------ 682

Query: 706 AYIVYGSIVIAGFFYFSPFS 725
            YIV    ++  F++FS  S
Sbjct: 683 -YIVVAIFMVVCFYFFSEHS 701

>KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, start by similarity
          Length = 772

 Score =  281 bits (719), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 219/720 (30%), Positives = 329/720 (45%), Gaps = 57/720 (7%)

Query: 59  VMPIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG 118
           VM  + T L +  R+++I     VV+DE HFGKF SYYL   ++ DVHPP+ KML+   G
Sbjct: 63  VMNYLVTGLALVLRLWRISEPREVVFDEVHFGKFASYYLERTYFFDVHPPMAKMLIAAIG 122

Query: 119 YLAGYNGSWDFPS-GEVYPD-YIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLF 176
           +L GYNGS+ F   G  Y   Y  +V  R   A+   L V + + T + + F  ++ ++ 
Sbjct: 123 WLTGYNGSFKFDDIGYSYDTYYAPFVAYRSLSAVLGVLTVSVVFQTMKELNFKAVTCFIA 182

Query: 177 TILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMR-KSPFSARWWLWLCLTGLN 235
             L+  +N++ T  + ILLD+ML+F    S +C  +F+ ++  SPFS+ W+LWL LTG +
Sbjct: 183 AFLIAVDNAHVTDTRLILLDAMLIFSIALSIYCYVRFYKLQLTSPFSSEWYLWLYLTGFS 242

Query: 236 LGCAISVKMVGLFIISVVGIYTISELWNLLSDRS-VSWKVYVNHWLARIFGLIIIPVCVF 294
           L   +S K VGL     +G+  +  LW LL  RS +S +  V H L RI GLII P  V+
Sbjct: 243 LSMVMSTKYVGLLTYCTIGLAVVVNLWQLLDIRSGLSMRKVVKHTLVRINGLIIFPFVVY 302

Query: 295 LLCFKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGS----SIISIKNQALG 350
           L  F  HF +L+ SGPGD+ M S FQ +L        P  V + S     II+IK++A  
Sbjct: 303 LFWFWCHFAILNQSGPGDAFMSSDFQDTL-----LDAPGAVEIKSINYHDIITIKHKA-T 356

Query: 351 GALLHSHVQPFPE-------GSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENKTIEF 403
            A LHSH+  +P         S  QQVT Y + D NN+W       + P + ++ K    
Sbjct: 357 DAFLHSHLAKYPVRYEDGRISSNGQQVTCYSHEDINNQW------EILPPSGSKFKKGAP 410

Query: 404 VKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDL-GDYKDNWIIEIVEQVGE 462
           VK     RL H  T   L  H+V +P   +  EV+   + +  G+  D  +      + +
Sbjct: 411 VKLDADIRLRHVGTNTYLLAHDVASPYYPTNEEVTTVSEEEANGESYDFTLFRFQPILPK 470

Query: 463 EDPTLLHPLSTSFRIKNSILGCYL-AQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIE 521
               +    +++FRI +      L   + K LPEWGF Q EV   K    +D    W ++
Sbjct: 471 NSGRVAKTKNSAFRIFHVQTAVALWTHNDKLLPEWGFSQQEVNGNKKV--QDPENNWFVD 528

Query: 522 THENERLPQGEDFVYPKT----SFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWP 577
           +  N           PK      FF+ + +L   M   NN L          AS+   WP
Sbjct: 529 SIVNMPENDSRRIYTPKVPTSMPFFQKWYELQFLMFEHNNKLSSE----HPFASNPQSWP 584

Query: 578 TLNVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVE 637
               GV      E   + F  G+    W   ++V   +  V+   +  QR    L+    
Sbjct: 585 LSLSGVSFWTKEEGRKQIFFTGNIVGWWFEIVSVALYLGLVVADLITRQRAVYALNKMAR 644

Query: 638 RDVFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMI--------------LS 683
           + ++   AF  +  W +HY PF +M+R  + HHYLP      M               L 
Sbjct: 645 QKLYGPMAFL-IFGWCIHYFPFFLMARQKFLHHYLPAHLILAMFSAALWEIVFTDNQSLD 703

Query: 684 YYFDMITKRWATRNTGKFLRLGAYIVYGSIVI---AGFFYFSPFSFGMDGPVDDYAYLAW 740
           +  D    +       K   +  Y+   S+++     F YF+P  +G+   VD      W
Sbjct: 704 FDLDEEDSKNPHDAEPKVYTIAYYLFCLSVIVNVGGCFIYFAPLVYGLSMTVDQIKARQW 763

>ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH]
           complement(237967..240240) [2274 bp, 757 aa]
          Length = 757

 Score =  275 bits (704), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 201/697 (28%), Positives = 329/697 (47%), Gaps = 51/697 (7%)

Query: 65  TVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 124
           T +    R +K+   + VV+DE HFGK  SYYL   ++ DVHPP  KML+   G+L GY+
Sbjct: 55  TAIAFAVRFHKLYHPSEVVFDEVHFGKCASYYLERTYFFDVHPPFSKMLIAFVGWLVGYD 114

Query: 125 GSWDFPS-GEVYPDY-IDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILVIF 182
           G++ F   G  Y  + + Y+  R   A+  +L VPL +   R + F  ++     +LV  
Sbjct: 115 GAFKFDDIGYSYETHQVPYIAYRSLSAILGTLTVPLVFSILRELNFKAITCAFGALLVAV 174

Query: 183 ENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMR-KSPFSARWWLWLCLTGLNLGCAIS 241
           +N++    + ILLD+ L+     S +   +F+  + ++P S+ W+ WL  TGL+L   IS
Sbjct: 175 DNAHVIDSRLILLDATLVISVALSIYTYIRFYKAQLRAPLSSEWYFWLYATGLSLSFVIS 234

Query: 242 VKMVGLFIISVVGIYTISELWNLLSDRS-VSWKVYVNHWLARIFGLIIIPVCVFLLCFKI 300
            K VG+F  +++G   I  LW LL  R+ +S +++  H++ R  GL+  P  V+L  F +
Sbjct: 235 TKYVGVFTFAMIGTAVIVNLWQLLDVRAGLSLRMFFRHFVQRFNGLVCFPFAVYLFWFYV 294

Query: 301 HFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALGGALLHSHVQP 360
           HF +L+ SGPGD  M S FQ +L  + + K  +DV     I++ +++   GALLHSH   
Sbjct: 295 HFAILTKSGPGDDFMSSAFQETLADSPLAKDSKDVHY-YDIVTFQHRD-TGALLHSHNAY 352

Query: 361 FP-------EGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENKTIEFVKGGEMYRLM 413
           +P         S+ QQVT Y + D NN+W       + P  +  ++T + V   ++ RL 
Sbjct: 353 YPLRYEDGRVSSQGQQVTGYSHEDINNQW------EILPTKELSSRTGQPVLLDDVLRLR 406

Query: 414 HRLTGKNLHTHEVPAPISKSEYEVSAYG-DVDLGDYKDNWIIEIVEQVGEEDPTLLHPLS 472
           H  TG  L TH+V +P   +  EV+    ++  G+     + ++     ++    +   +
Sbjct: 407 HIATGTYLLTHDVASPYYPTNEEVTTISEELANGERYKQTLFKLQPPNKKDGGHTVKSKT 466

Query: 473 TSFRIKNSILGCYL-AQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENERLPQG 531
           + FR+ +      L   +   LPEWGF+Q EV   K  +  D    W + +  N  L + 
Sbjct: 467 SMFRMFHVDTAVALWTHNDVFLPEWGFKQQEVNGNKKVT--DPANIWTVNSILN--LSEE 522

Query: 532 EDFVYPKT----SFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRLCE 587
                PK      FF  +++L  +M   NN L          AS    WP    GV    
Sbjct: 523 RKVYIPKKVTKMPFFSKWLELQRSMFEHNNKLSSE----HPFASQPESWPGSLSGVSFWT 578

Query: 588 WSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDVFVMAAFY 647
              +  + +  G+    W   I++   +  ++   +  QR   +L       ++    F 
Sbjct: 579 NDTERRQIYFTGNIIGWWIELISLALFVGILLADAITRQRSFFVLGKLAREKIYGPLCFL 638

Query: 648 PLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMI-------------TKRWA 694
             + W +HY PF +M R  + HHYLP    A M  +  +++I             ++  A
Sbjct: 639 -YIGWAIHYFPFFLMGRQKFLHHYLPAHLIAAMFTAGLWEVIFTDNRALTTRKDESEPAA 697

Query: 695 TRNTGKFLR---LGAYIVYGSIVIAGFF-YFSPFSFG 727
             NT   +    L A++   SI + GFF YFSP  +G
Sbjct: 698 PHNTNPIVYEYFLLAFLGLLSIAVVGFFIYFSPIVYG 734

>CAGL0M00220g 28137..30434 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, hypothetical start
          Length = 765

 Score =  274 bits (700), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 206/701 (29%), Positives = 337/701 (48%), Gaps = 57/701 (8%)

Query: 63  IFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAG 122
           + T +    R YKI     VV+DE HFGKF SYYL   F+ DVHPPL KM++   G+L  
Sbjct: 64  LVTAIAFAVRFYKIYYPREVVFDEVHFGKFASYYLERTFFFDVHPPLAKMMIAFIGWLCN 123

Query: 123 YNGSWDFPS-GEVYPDY-IDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILV 180
           Y+GS+ F   G  Y  +   ++  R F A+  +L V + + + + + F  ++ +L ++LV
Sbjct: 124 YDGSFKFEEIGLSYDKHPAPFLAYRSFNALLGTLTVSIMFESMKELNFKAITCFLASMLV 183

Query: 181 IFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMR-KSPFSARWWLWLCLTGLNLGCA 239
             +N++ T  + ILLD++LL    ++ +   +F+ ++ K PFS  W++WL LTG +L C 
Sbjct: 184 AIDNAHVTETRLILLDAILLISVAATVYSYIRFYKLQLKEPFSWNWYIWLYLTGFSLSCV 243

Query: 240 ISVKMVGLFIISVVGIYTISELWNLLS-DRSVSWKVYVNHWLARIFGLIIIPVCVFLLCF 298
           IS K +G+   + +GI  +  LW LL  +  +S ++ + H   R+ GLI+IP  ++L  F
Sbjct: 244 ISTKYIGVMTYAAIGIPVVVNLWQLLDINAKLSIRMLIKHIGRRLNGLILIPFIIYLFWF 303

Query: 299 KIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALGGALLHSHV 358
            +HF +L+ SGPGD  M S FQ +L+ ++  K  ++V     I++ +NQ   GA LHSH+
Sbjct: 304 YVHFAILNVSGPGDVFMSSEFQDTLHDSEATKLSKEVQF-FDIVTFENQDT-GAFLHSHL 361

Query: 359 QPFP-------EGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTD-AENKTIEFVKGGEMY 410
             +P         S+ QQVT Y + D NN+W       + P  D A+   I F   G+ +
Sbjct: 362 ARYPLRYEDDRVSSQGQQVTCYTHEDVNNQW------EILPVADKAKGDNIRF---GDEF 412

Query: 411 RLMHRLTGKNLHTHEVPAPISKSEYEVSA-YGDVDLGDYKDNWIIEIVEQVGEEDPTLLH 469
           RL H  T   L  H+V +P+  +  E++  + D  LG   ++ I        +++  ++ 
Sbjct: 413 RLRHVGTDSYLLAHDVASPLYPTNEEITTVHKDDALGARANSTIFRFQPINKKDEGHIIK 472

Query: 470 PLSTSFRI--KNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENER 527
             +   RI  K +++  + + + + LP+WGF Q EV   K  +  D    W I++  N  
Sbjct: 473 SKNAVLRIIHKETVVALW-SHNDELLPDWGFGQQEVNGNKKMT--DSGNAWTIDSIMN-- 527

Query: 528 LPQGEDFVYPKT----SFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGV 583
           L +      PK      FF  +++L   M   NN L          AS    WP    GV
Sbjct: 528 LDEKRSAYAPKEIKSMPFFNKWLELQKLMFEQNNKLTSE----HPFASQPESWPGSMSGV 583

Query: 584 RLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDVFVM 643
                +E+  + + +G+    W   I+    +  +I   +  QR    L + V R+    
Sbjct: 584 SFWTKNEERRQIYFIGNIIGFWFQVISFAVYVGIIIADQITRQRGYFAL-NKVTREKLYG 642

Query: 644 AAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTGK--- 700
              Y    W  HY PF +M R  + HHYLP    A +  +  ++ +  R  + +  K   
Sbjct: 643 PLAYLFCGWACHYFPFFLMGRQKFLHHYLPAHLIAALFAAGLWETVFSRCKSDDPYKDEE 702

Query: 701 ----------FLRLGAYIVYGSIVIAG----FFYFSPFSFG 727
                      +   AYI +   V+A     F +FSP  + 
Sbjct: 703 KPGVSFEKYPAIYTAAYITFNITVLAALVWCFVFFSPLIYA 743

>Kwal_47.16734
          Length = 792

 Score =  269 bits (688), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 206/701 (29%), Positives = 333/701 (47%), Gaps = 59/701 (8%)

Query: 65  TVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 124
           T+L    R  K+     VV+DE HFGKF SYYL   ++ DVHPP  KML+   G+L GYN
Sbjct: 90  TLLAAVVRFRKLSYPREVVFDEVHFGKFASYYLERTYFFDVHPPFAKMLIAFVGWLVGYN 149

Query: 125 GSWDFPS-GEVY-PDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILVIF 182
           G++ F   G  Y  +   +V  R   A+  +L VP+ + T + + F  ++  L  +LV  
Sbjct: 150 GTFKFDDIGLSYDSNPAPFVAYRSLSAILGTLTVPIIFNTVKELNFRAVTCALAALLVAI 209

Query: 183 ENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMR-KSPFSARWWLWLCLTGLNLGCAIS 241
           + ++    + ILLD+ LL     S +C  +F+ ++ K+PFS+ W+LWL LTG +L   +S
Sbjct: 210 DCAHVIDSRLILLDATLLIAVACSLYCYVRFYKIQLKAPFSSSWYLWLYLTGTSLSFVMS 269

Query: 242 VKMVGLFIISVVGIYTISELWNLLSDRS-VSWKVYVNHWLARIFGLIIIPVCVFLLCFKI 300
            K +G+   + +G      LW LL  R+ ++ + +V H L R+ GLI  P  ++L  F +
Sbjct: 270 TKYIGVMTYATIGSAVAVNLWQLLDVRAGLTIRQFVKHVLQRLNGLIFAPFVLYLFWFWV 329

Query: 301 HFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALGGALLHSHVQP 360
           HF +L  SGPGD  M S FQ +L+ + + +  R V     II++K++ +  A LHSH++ 
Sbjct: 330 HFAILIRSGPGDDFMSSQFQETLSDSPLAREARQVNYF-DIITLKHK-VTDAYLHSHLER 387

Query: 361 FP-------EGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENKTIEFVKGGEMYRLM 413
           +P         S  QQVT Y   D NN+W       V P      +  + V   ++ R  
Sbjct: 388 YPIRYEDGRVSSNGQQVTGYTLEDVNNQW------EVLPTKQLPAREGQPVHLDDVVRFR 441

Query: 414 HRLTGKNLHTHEVPAPISKSEYEVSAYGD--VDLGDYKDN-WIIEIVEQVGEEDPTLLHP 470
           H +T   L  H+V +P+  +  E++   +   +  +Y +  + ++ V +   ED  +L  
Sbjct: 442 HVVTNTFLLAHDVASPLYPTNEEITTVEEEMANGANYPETLFRLQSVNKGDSED--VLKS 499

Query: 471 LSTSFRIKNSILGCYL-AQSGKHLPEWGFRQGEVVCLKHASKR--DKRTWWNIETHENER 527
            ++ FRI +      L   +   LPEWGF+Q EV    + +K+  D    W  ET  N  
Sbjct: 500 KASVFRIVHIDTTVALWTHNDVLLPEWGFKQQEV----NGNKKIIDPENSWFAETIVN-- 553

Query: 528 LPQGEDFVYPKTS----FFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGV 583
           + +      PKT     FF  +M+L   M   NN L  +       ASS   WP    GV
Sbjct: 554 IDEARSVYVPKTRKKLPFFTKWMELQRLMFEHNNKLSSS----HPFASSPESWPGSLSGV 609

Query: 584 RLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDVFVM 643
                  + I+ + +G+    W   +++ AL   V    L  +R+ +   + + +     
Sbjct: 610 SFWTKDSERIQIYFIGNIIGWWFQVVSI-ALFCGVTAADLLVRRRGIFPLNKMAKQKLNA 668

Query: 644 AAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTGK--- 700
              +  + WL H++PF +M R  + HHYLP    A M  +  ++ I     + N  K   
Sbjct: 669 PLSFLFVGWLCHFVPFFLMGRQKFLHHYLPAHLIASMFSAAMWETIFTDNKSLNLEKDEE 728

Query: 701 -------------FLRLGAYIVYGSIVIAGFF-YFSPFSFG 727
                        ++ L  +++  S  +  FF YFSP  +G
Sbjct: 729 DPANAHEANPHLNYIPLILFVLVMSGALIWFFVYFSPIVYG 769

>Scas_442.1
          Length = 309

 Score =  253 bits (647), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 124/302 (41%), Positives = 184/302 (60%), Gaps = 13/302 (4%)

Query: 446 GDYKDNWIIEIVEQVG-------EEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGF 498
           GD  D+WI+EIV+Q+        +ED  ++HP+ST FR+++ +LGCYLA +G   P WGF
Sbjct: 6   GDVYDDWILEIVDQMDSGNPDFHKEDQNIVHPVSTFFRLRHKVLGCYLASTGLAYPSWGF 65

Query: 499 RQGEVVCLKHASKRDKRTWWNIETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNA 558
           +Q E+VC K  S RDK TWWN+E H N++LP  ED+V PK+ F+ +F+ +N AM ++N+A
Sbjct: 66  QQAEIVCKKSWSHRDKATWWNVEDHWNDQLPIEEDYVPPKSKFWTDFILINFAMASSNSA 125

Query: 559 LVPNPEKFDGIASSAWQWPTLNVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHV 618
           LVP+ +KFD +AS  W+WPTL+ G+RLC WS    KY+LLGSP + W S++++   +  +
Sbjct: 126 LVPDADKFDPLASKPWEWPTLHRGLRLCSWSRDVYKYYLLGSPFNTWLSTLSLFLFVFII 185

Query: 619 IFLTLKWQRQCVILSDPVERDVFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFA 678
             +  +W+RQ + L +     + +   F P LAW+ H+ PFV+M RV Y HHYLP LYFA
Sbjct: 186 SKIAYQWRRQHLNLQEDQLWRLGIQGIF-PFLAWITHFFPFVMMGRVTYVHHYLPALYFA 244

Query: 679 LMILSYYFDMITKRWATRNTGKFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYL 738
           ++   +  D    R        F++   Y+         +  F+P   G+ G V  Y  L
Sbjct: 245 ILTFGFVLDYSIGR-----ANPFIKYPIYLALFVGCTYIYVLFAPICQGLHGDVAKYLRL 299

Query: 739 AW 740
            W
Sbjct: 300 EW 301

>Scas_719.80
          Length = 762

 Score =  251 bits (641), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 184/624 (29%), Positives = 301/624 (48%), Gaps = 30/624 (4%)

Query: 65  TVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 124
           T++    R Y I     VV+DE HFGKF SYYL   ++ DVHPP  KM +   G+L GYN
Sbjct: 60  TLIAFVARFYMIWYPKEVVFDEVHFGKFASYYLERTYFFDVHPPFAKMAIAFIGWLVGYN 119

Query: 125 GSWDFPS-GEVY-PDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILVIF 182
           GS+ F   G  Y  +   Y+  R F AM  +L V + + T + + F  ++ +   +LV  
Sbjct: 120 GSFKFDEIGSSYQTNPAPYIAYRSFNAMLGTLTVSIMFNTLKELNFKAITCFFGALLVAV 179

Query: 183 ENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMR-KSPFSARWWLWLCLTGLNLGCAIS 241
           +N++ T  + ILLD++LL    +S++   +F+  + ++PFS +W++WL LTGL+L   IS
Sbjct: 180 DNAHVTETRLILLDAILLISIAASFYSFVRFYKAQLRAPFSPQWYIWLHLTGLSLSFVIS 239

Query: 242 VKMVGLFIISVVGIYTISELWNLLSDRS-VSWKVYVNHWLARIFGLIIIPVCVFLLCFKI 300
            K +G+   + +G   I  LW LL  R+ ++ + +  H++ R+ GL+  P C++L  F +
Sbjct: 240 TKYIGVMTYAAIGTGVIVNLWQLLDLRANLTLRAFFRHFVKRLNGLVFAPFCIYLFWFWV 299

Query: 301 HFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALGGALLHSHVQP 360
           HF +LS SGPGD+ M + FQ +L  + +    ++V     II++K++    A LHSH   
Sbjct: 300 HFAILSKSGPGDAFMSAEFQETLGDSPMSILSKEVHF-YDIITLKHKDT-EAFLHSHQAF 357

Query: 361 FPE-------GSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENKTIEFVKGGEMYRLM 413
           +P         SE QQVT +  +D +N+W       V P  + ++     V   E  RL 
Sbjct: 358 YPLRYEDGRISSEGQQVTGFTGTDISNDW------EVLPTRELDSHKGVPVVLNEPIRLR 411

Query: 414 HRLTGKNLHTHEVPAPISKSEYEVSAYG-DVDLGDYKDNWIIEIVEQVGEEDPTLLHPLS 472
           H  +   L  H+V +P   +  E++    ++  G+     +         ++  ++    
Sbjct: 412 HVASNTYLLAHDVASPFYPTNEEITTVSEEIANGESYQQTVFTFQPLKKGDEGHVVKTKG 471

Query: 473 TSFRIKNSILGCYL-AQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIE--THENERLP 529
             F+I +      L   +   LP+WGF Q EV   K+    D    W+++  T+ +E   
Sbjct: 472 VQFKIYHPNTDVVLWTHNDVLLPDWGFEQQEVNGSKNFG--DPTNAWSVDEITNLDEDRK 529

Query: 530 QGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRLCEWS 589
           +    V    SFFR + +L  +M   NN L          AS    WP    GV     S
Sbjct: 530 KFTPKVVKPMSFFRKWSELQKSMFEQNNKLSAE----HPFASQPQSWPAGLCGVSFWTKS 585

Query: 590 EKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDVFVMAAFYPL 649
           E+  + F   +    W   I++   I  ++   +  +R   +L       ++   AF   
Sbjct: 586 EERKQIFFTANIIGWWFQVISMSVFIGILLADQISRKRGYFVLGKITREKLYGPLAFL-F 644

Query: 650 LAWLLHYMPFVVMSRVVYAHHYLP 673
           ++W  HY PF +M R  + HHYLP
Sbjct: 645 ISWGCHYAPFFLMHRQKFLHHYLP 668

>YJR143C (PMT4) [3035] chr10 complement(698241..700529)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           involved in initiation of O-glycosylation [2289 bp, 762
           aa]
          Length = 762

 Score =  251 bits (641), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 197/706 (27%), Positives = 335/706 (47%), Gaps = 65/706 (9%)

Query: 63  IFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAG 122
           I T+L    R YKI     VV+DE HFGKF SYYL   ++ DVHPP  KM++   G+L G
Sbjct: 58  IVTLLAFAARFYKIWYPKEVVFDEVHFGKFASYYLERSYFFDVHPPFAKMMIAFIGWLCG 117

Query: 123 YNGSWDFP----SGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTI 178
           Y+GS+ F     S E +P    Y+  R F A+  +L VP+ + T + + F  ++    ++
Sbjct: 118 YDGSFKFDEIGYSYETHP--APYIAYRSFNAILGTLTVPIMFNTLKELNFRAITCAFASL 175

Query: 179 LVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMR-KSPFSARWWLWLCLTGLNLG 237
           LV  + ++ T  + ILLD++L+    ++ +C  +F+  + + PF+  W++WL  TGL+L 
Sbjct: 176 LVAIDTAHVTETRLILLDAILIISIAATMYCYVRFYKCQLRQPFTWSWYIWLHATGLSLS 235

Query: 238 CAISVKMVGLFIISVVGIYTISELWNLLSDRS-VSWKVYVNHWLARIFGLIIIPVCVFLL 296
             IS K VG+   S +G   +  LW LL  ++ +S + ++ H+  R+ GL++IP  ++L 
Sbjct: 236 FVISTKYVGVMTYSAIGFAAVVNLWQLLDIKAGLSLRQFMRHFSKRLNGLVLIPFVIYLF 295

Query: 297 CFKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALGGALLHS 356
            F +HF +L+ SGPGD+ M + FQ +L  + +    + V     II+IK+Q    A LHS
Sbjct: 296 WFWVHFTVLNTSGPGDAFMSAEFQETLKDSPLSVDSKTVNY-FDIITIKHQD-TDAFLHS 353

Query: 357 HVQPFPEGSEQ-------QQVTVYGYSDANNEWFFQRIRGVEPWTDAENKTIEFVKGGEM 409
           H+  +P+  E        QQVT Y + D NN+W       V P   ++    + V   + 
Sbjct: 354 HLARYPQRYEDGRISSAGQQVTGYTHPDFNNQW------EVLPPHGSDVGKGQAVLLNQH 407

Query: 410 YRLMHRLTGKNLHTHEVPAPISKSEYEVSAY----GDVDLGDYKDNWIIEIVEQVGEEDP 465
            RL H  T   L  H+V +P   +  E++      GD   G+     +         ++ 
Sbjct: 408 IRLRHVATDTYLLAHDVASPFYPTNEEITTVTLEEGD---GELYPETLFAFQPLKKSDEG 464

Query: 466 TLLHPLSTSFRIKNSILGCYL-AQSGKHLPEWGFRQGEVVCLKHASKR--DKRTWWNIET 522
            +L   + SFR+ +      L   + + LP+WGF+Q E+    + +K+  D    W ++ 
Sbjct: 465 HVLKSKTVSFRLFHVDTSVALWTHNDELLPDWGFQQQEI----NGNKKVIDPSNNWVVD- 519

Query: 523 HENERLPQGEDFVYPKT----SFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPT 578
            E   L +      PK      F + +++   +M   NN L          AS  + WP 
Sbjct: 520 -EIVNLDEVRKVYIPKVVKPLPFLKKWIETQKSMFEHNNKLSSE----HPFASEPYSWPG 574

Query: 579 LNVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVER 638
              GV      ++  + + +G+    W   I++ A+ + +I   L  + +     + + R
Sbjct: 575 SLSGVSFWTNGDEKKQIYFIGNIIGWWFQVISL-AVFVGIIVADLITRHRGYYALNKMTR 633

Query: 639 DVFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWAT--- 695
           +       +  ++W  HY PF +M+R  + HHYLP    A +     +++I     +   
Sbjct: 634 EKLYGPLMFFFVSWCCHYFPFFLMARQKFLHHYLPAHLIACLFSGALWEVIFSDCKSLDL 693

Query: 696 ------------RNTGKFLR-LGAYIVYGSIVIAGFF-YFSPFSFG 727
                       RN   +++    ++V  S  +A FF YFSP  +G
Sbjct: 694 EKDEDISGASYERNPKVYVKPYTVFLVCVSCAVAWFFVYFSPLVYG 739

>Scas_710.1
          Length = 919

 Score =  251 bits (642), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 194/665 (29%), Positives = 321/665 (48%), Gaps = 36/665 (5%)

Query: 39  DAELYDKVKNESAVSHLDTIVMPIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLR 98
           D E    +     +S    I++ +         R++ +G  N VV+DEA +G   S YL+
Sbjct: 33  DTEPSQDLVQLRTISTTHEIILVLSLLAFTALIRLHDLGWPNGVVFDEAVYGNIVSKYLK 92

Query: 99  HEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPS-GEVYPDYIDYVKMRLFQAMFSSLCVP 157
           +  + DVHPPL K+L     +  G+ G ++F   G  +P    Y  MRLF A   SL V 
Sbjct: 93  NILFVDVHPPLIKLLYAGIAHFLGFEGQFEFNDIGVPFPTTTPYYAMRLFSATLGSLTVL 152

Query: 158 LAYFTGRAIGFSRLSVWLFTILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMR 217
           L Y T RA G         +I ++ ENS+ T+ + I+L+  L+FF  ++ +   K    +
Sbjct: 153 LMYLTLRASGVRIWVALAGSICLVIENSFVTVSRHIMLEGPLMFFIAAAVYFTKKSDLFK 212

Query: 218 KSPFSARWWLWLCLTGLNLGCAISVKMVGLFIISVVGIYTISELWNLLSDRSV----SWK 273
               S   ++ + +  + LG AIS K VG+  +   G+  +  LW ++ + S+    S+K
Sbjct: 213 AD--SCNSYINIGIAAVALGLAISSKWVGVATLIWAGLICVWRLWFMVGNLSMPVCGSFK 270

Query: 274 VYVNHWLARIFGLIIIPVCVFLLCFKIHFDLLS-NSGPGDSTMPSLFQASLNGTKVGKGP 332
           V     L + F LI +P+ +++L F  HF     NS       P       N + V    
Sbjct: 271 VA----LIKAFTLIFLPIILYILTFYFHFQYTGINSDVSQLFTPEFRTTLANNSVVNNVV 326

Query: 333 RDVALGSSIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIR-GVE 391
            ++A+G S+I++++    G  LHSH   + +GS QQQ+T Y Y D N+ W  +     +E
Sbjct: 327 AEIAVG-SMITLRHPGTHGGYLHSHDAFYEKGSNQQQITCYPYVDKNDNWTVELYDVPLE 385

Query: 392 PWTDAENKTIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKS---EYEVSAYGDVDL-GD 447
             T  +N T      G   RL+H  TG  LH+H+   P+S++   + EVS YG     GD
Sbjct: 386 NITSFQNLT-----DGTKIRLLHN-TGCRLHSHDHKPPVSENSDWQKEVSCYGYPGFEGD 439

Query: 448 YKDNWIIEIVEQ--VGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVC 505
             D+WIIEI +   +  E    +  + T FR+K++I+GCYL      LP+ GF Q EV C
Sbjct: 440 ANDDWIIEIDKDASIPGESQEHVRAIETKFRLKHAIMGCYLFSHNTMLPKLGFEQQEVTC 499

Query: 506 LKHASKRDKRTWWNIETHENERLP-QGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPE 564
               S  D  T W++E +EN  +    E   Y   SF++ F++ +  M+   + +  N  
Sbjct: 500 A--YSGIDSLTLWSVENNENPFVSDDAERVSYEPLSFWKKFVETHKRMLEIASGM-DNTH 556

Query: 565 KFDGIASSAWQWPTLNVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLK 624
            ++   S    WP +  G+    WSE+    +LLG+    W  +  +      V++  + 
Sbjct: 557 MYE---SKPATWPFMLRGIDF--WSEQHQDIYLLGNAVLWWSVTAFIVGFAGIVVWELVS 611

Query: 625 WQRQCVILSDPVERDVFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSY 684
            Q       DP   +  +    Y LL +LL+++P +++   ++ +HYLP  YF ++ L++
Sbjct: 612 LQLGYEFSKDPHVINFHIQVIQY-LLGFLLNFIPSLLLENQIFLYHYLPAYYFGILALTH 670

Query: 685 YFDMI 689
             D++
Sbjct: 671 GLDIL 675

>CAGL0L07172g complement(796354..798687) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w PMT5, start by similarity
          Length = 777

 Score =  211 bits (538), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 172/650 (26%), Positives = 294/650 (45%), Gaps = 32/650 (4%)

Query: 53  SHLDTIVMPIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKM 112
           S  D I+M I+  +  + TR Y IG    +V+DE       S Y    F  DV PPLGKM
Sbjct: 57  SKSDGILMAIV-ALFAIVTRFYDIGFPKAIVYDEGFVIAEVSKYFNKTFSIDVFPPLGKM 115

Query: 113 LVGLSGYLAGYNGSWDF-PSGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRL 171
           +    G   G++ S+ + P G  + +   Y+  R   A   +  V   + T RA G SR 
Sbjct: 116 IYYFVGKYTGFDTSYKYHPVGTQFENASVYLPERYLAAGLGACVVVFFFMTLRASGVSRP 175

Query: 172 SVWLFTILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCL 231
              +F++ +  ENS+ T  +++ LD+  LFF  ++ +   K   +R    S R+      
Sbjct: 176 IAGIFSVALSLENSFITASRYVHLDAPFLFFVAAAIYFTKKSDNLRAG--SGRYIFTFTH 233

Query: 232 TGLNLGCAISVKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPV 291
               LG AIS K  GLF+++ V I T+  LW L  D SV     V  ++  +  L ++P 
Sbjct: 234 AACLLGLAISTKWAGLFVLAWVAIVTLWRLWLLAGDLSVPICRTVKVFIFNLLVLSLVPA 293

Query: 292 CVFLLCFKIHFDLLSNSGPGDSTMPSLFQASL-NGTKVGKGPRDVALGSSIISIKNQALG 350
            ++   F  H    +  G     M   F++ L N T + +   DV +G + + + N  + 
Sbjct: 294 VIYFSIFSWHIGSRTVDGNDSILMKPEFRSELYNNTVIKESFADVVVGGT-VRLNNIGMD 352

Query: 351 GALLHSHVQPFPEGSEQQQVTVYGYSDANNEW---FFQRIRGVEPWTDAENKTIEFVKGG 407
           G  + +    +  GS+Q+Q+ +        +W   ++ R  G  P      K+ E +K  
Sbjct: 353 GGFVEAAPAYYEAGSKQRQIDLRKNESVTTDWVVEYYNR-SGSTP------KSFENLKNH 405

Query: 408 EMYRLMHRLTGKNLHTHEVPAPISKS---EYEVSAYG-DVDLGDYKDNWIIEIVEQVGE- 462
           E  RL        LH+H+  APIS+    + EVS YG +  +GD  D+WI+EI + + E 
Sbjct: 406 EKIRLYSPKYKCRLHSHDHKAPISQHVDWQKEVSCYGYEGFMGDPNDDWIVEIDQDLSEP 465

Query: 463 -EDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIE 521
            E    +  + T FR+K+++ GCYL      +    F     +   H+ K +  T WNIE
Sbjct: 466 GEAREFVKAIDTKFRLKHAMSGCYLFTHDVRMRTPEFVMDYEIACAHSGKYE-LTLWNIE 524

Query: 522 THE-NERLPQGEDFV-YPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTL 579
             + +   P+    V Y   S     + L++ M+               + +    WP L
Sbjct: 525 QDQPHPNSPKNPKRVSYKPMSLKDKILDLHAKMIEKAKVRTDK----SSLITFPTTWPLL 580

Query: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERD 639
             G+    W+  + + + LG+PA  W  S  +   ++  +   + WQ    I S+P   +
Sbjct: 581 EKGIPF--WNGFARQIYFLGNPAMWWSVSAFIVLFVVAFVGELIFWQMGFEISSNPQFIN 638

Query: 640 VFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMI 689
             +    Y  + + L+Y+P+++ +   + + YLP  YF L+ L++ F+++
Sbjct: 639 FHIQVLQYG-IGFALNYVPYILTTDRHHLYQYLPAYYFGLLALAHVFELV 687

>Sklu_2215.6 YDR307W, Contig c2215 9395-11356 reverse complement
          Length = 653

 Score =  171 bits (434), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 177/693 (25%), Positives = 294/693 (42%), Gaps = 94/693 (13%)

Query: 51  AVSHLDTIVMPIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLG 110
           A S +D+++  +I     +F      G     V ++   G    +YL HEFY D  PPL 
Sbjct: 27  ATSIIDSLIAVLIALFFVLFQLTKVNGELGTSVQEKEILGSI-DHYLSHEFYLDSRPPLS 85

Query: 111 KMLVGLSGYLAGYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSS---LCVPLAYFTGRAIG 167
             L  L  ++ G                   + + L +A  +S   + + L Y   R   
Sbjct: 86  VQLFSLLTFVYGE------------------LSVELLRAATTSCGGIALVLLYLGLRKSS 127

Query: 168 FSR----LSVWLFTILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSA 223
            +R    ++V  F+ L +F      +      D   + F   S +    F   +  PFS 
Sbjct: 128 VNRVISVIAVVSFSYLKVFREETLRVST----DIFQVCFLAMSLYSWKSFKAAK--PFSK 181

Query: 224 RWWLWLCLTGLNLGCAISVKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWLARI 283
            W  +L    ++LG +IS K VG    S +   +I +LWN+++D  ++ K    H + R 
Sbjct: 182 TWHKYLLFLSISLGLSISNKFVGFMTWSWILSLSIVQLWNIIADVRLTGKQVFTHCVLRF 241

Query: 284 FGLIIIPVCVFLLCFKIHFDLLSNSGPGDST-MPSLFQASLNGTKVGK--GPRDVALGSS 340
             L+++P  VFLL +  H   L+      ST M   ++ +L    + K   P  V  GS+
Sbjct: 242 MALVLVPAIVFLLSYYAHISTLTQDLTDFSTFMSPYYKHTLENNPLNKIVPPGRVYYGST 301

Query: 341 IISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENKT 400
           I      +LGG  LHSH   +  GS +QQVT+Y + D NNEW  +  +  +   D  +K 
Sbjct: 302 ITIRHKDSLGG-YLHSHELNYQSGSHEQQVTLYDFPDNNNEWIVEHKKENK---DVSSKA 357

Query: 401 IEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEY--EVSAYGDVD-LGDYKDNWIIEIV 457
           +  VK GE  RL HRLTGK L       P+S+ +Y  EVS  GD +  G   + W I   
Sbjct: 358 VA-VKNGENIRLRHRLTGKLLRASGAKPPVSEQDYDREVSCTGDANYTGQSDELWKIRFS 416

Query: 458 EQVGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTW 517
            ++ E     L PL T+F++ N   GC L      LPEW   Q EV+CL   +K  +RT 
Sbjct: 417 GRLLEG----LVPLDTTFQLTNQGQGCTLLSHDLRLPEWALFQQEVLCLDPPTK--ERTL 470

Query: 518 WNIETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATN---NALVPNPEKFDGIASSAW 574
           + +E+  + R  +   +++ + +    F++L    +      +  + N +    +    W
Sbjct: 471 FYVES--SNRYSEDHHYIFVEDNSVVKFLKLLKEYLYKQFKYDYYIKNYKAEGDVGVGKW 528

Query: 575 QWPTLNVGVRLCEWSEKSIKYFLLGS--PASVWPSSIAVCALIIHVIFLTLK------WQ 626
            W                   ++ G     ++W S  AV +++ +++  T++      W 
Sbjct: 529 PW-------------------YISGDYLDTAIWFS--AVFSILAYLLLQTIRLITWNPWN 567

Query: 627 RQCVILSDPVERDVFVMAAFYPLLAWLLH-YMPFVVMSRVVYAHHYLPTLYFALMILSYY 685
              V L  P+   +++       + W LH Y+ F  M   ++   YLP+L   L+ L + 
Sbjct: 568 VADVEL--PLSYLLYIDNGLEFSVGWFLHYYIFFSSMHNRLFLFQYLPSL---LLGLCHV 622

Query: 686 FDMITKRWATRNTGKFLRLGAYIVYGSIVIAGF 718
                  W   N  ++      +V  ++ I GF
Sbjct: 623 ATSAQAAWCQNNLTRYA-----LVVSAVTIFGF 650

>Scas_329.1
          Length = 273

 Score =  143 bits (361), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 85/213 (39%), Positives = 122/213 (57%), Gaps = 6/213 (2%)

Query: 65  TVLGMFT---RMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 121
            +L +FT   R+  + + + VV+DE HFGKF SYY++ EF+ DVHPPL KML      LA
Sbjct: 62  AILALFTASIRLPNLQKPDSVVFDEVHFGKFASYYIKGEFFMDVHPPLAKMLYAGVAALA 121

Query: 122 GYNGSWDFPS-GEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILV 180
           G+ G++ F + G+V+P  + YV MR F AM  +L V L Y T R+ G      ++     
Sbjct: 122 GFRGNFMFENIGDVFPADVPYVLMRFFSAMLGALTVMLLYLTLRSSGVRPWVAFVSGACF 181

Query: 181 IFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAI 240
             ENSY T+ ++ILLD+ L+FF  ++ +   K+   +   FS      L + G+ LG A 
Sbjct: 182 AIENSYVTISRYILLDAPLIFFIAAAVYSFKKYENYKS--FSIGSIKSLFVAGVALGMAA 239

Query: 241 SVKMVGLFIISVVGIYTISELWNLLSDRSVSWK 273
           S K VGLF I+ VG+  I  LW ++ D S S K
Sbjct: 240 SAKWVGLFTIAWVGLLCIWRLWFMIGDLSKSTK 272

>Scas_30.1
          Length = 128

 Score =  134 bits (338), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 77/109 (70%)

Query: 630 VILSDPVERDVFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMI 689
           V  ++P + + F+M AFYPLL W LHY+PFV+MSRV Y HHYLP LYFAL+IL+Y FD  
Sbjct: 11  VDFANPEDLNTFLMGAFYPLLGWGLHYLPFVIMSRVTYVHHYLPALYFALLILAYLFDFF 70

Query: 690 TKRWATRNTGKFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYL 738
            K+W     G   +L  Y  Y +++I GF+YFSP SFGMDGP  +Y+YL
Sbjct: 71  MKKWTKSKCGSITKLAIYFCYYAVIIYGFYYFSPISFGMDGPSQNYSYL 119

>AAL050W [137] [Homologous to ScYDR307W - SH]
           complement(256490..258463) [1974 bp, 657 aa]
          Length = 657

 Score =  144 bits (362), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 119/403 (29%), Positives = 192/403 (47%), Gaps = 29/403 (7%)

Query: 155 CVPLAYF--TGRAIGFSRL----SVWLFTILVIFENS--YATLGKFILLDSMLLFFTVSS 206
           CV L Y   + R  G  RL    +V    +L +F ++  +A+L  +  +   ++ +   S
Sbjct: 129 CVVLQYLYKSLRCAGIQRLWAGAAVGCIALLEVFRDAAVHASLEMYHAMFLAIILYNWKS 188

Query: 207 YFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAISVKMVGLFIISVVGIYTISELWNLLS 266
           +          + PF   WWL L    +  G A   K VGL   + V +   + ++ L+ 
Sbjct: 189 F--------KLQEPFGQAWWLRLSAVAVCSGLAAGTKFVGLGTWAWVLLLNSAHIFQLIG 240

Query: 267 DRSVSWKVYVNHWLARIFGLIIIPVCVFLLCFKIHFDLLSNSGPGDSTMPSLFQASLNGT 326
           D  VS +    H L R+  L ++P+ + LL +  H    S S    S MP+LF+A L+G 
Sbjct: 241 DLEVSTRTVWKHVLIRLPLLTLVPLSIILLGYHSHLQAPSYSSRDSSYMPTLFKAQLDGY 300

Query: 327 KVGKGPRDVALGSSIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQR 386
           +V + P  V  GS ++   + ++GG  LHSH   +P GSE+QQ+T+Y + DANN+W  + 
Sbjct: 301 QVLQ-PASVYYGSGVVIRHSSSIGG-YLHSHELTYPGGSEEQQITLYDFEDANNKWTVEP 358

Query: 387 IRGVEPWTDAENKTIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEY--EVSAYGDVD 444
           +   E   D  N T + V+ G++ +L H  TGK L       P+S+ +Y  EVS  GD  
Sbjct: 359 VYN-EAMDDIINST-QPVRNGDLIKLRHVQTGKLLRASAAKPPVSQRDYDQEVSCTGDSG 416

Query: 445 L-GDYKDNWIIEIVEQVGEEDPTLLHPLSTSFRI-KNSILGCYLAQSGKHLPEWGFRQGE 502
             GD  + W ++I +    EDP     +  S R+ K  +L   L+  G+        + E
Sbjct: 417 YSGDSDETWRVDIQDAEYHEDPKAWFCIHFSPRVNKGPVLPPLLSHDGQAAEVGPCTRQE 476

Query: 503 VVCLKHASKRDKRTWWNIETHENERLPQGEDFVYPKTSFFRNF 545
           V+CL  AS   K + + +++ E   +   E    P+ SF   F
Sbjct: 477 VICL--ASPVHKYSLFYVDSSE---MMHNETMQLPRLSFPAKF 514

>Kwal_33.14357
          Length = 657

 Score =  119 bits (297), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 127/493 (25%), Positives = 215/493 (43%), Gaps = 43/493 (8%)

Query: 94  SYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSS 153
           S Y++ EF+    PP    ++ L   + G           +  + +  + +     + SS
Sbjct: 69  SEYMKKEFFLMSSPPFMVQILALVSRIMG----------SLSIEVLRKINLTTTAFVVSS 118

Query: 154 LCVPLAYFTGRAIGFSRLSVWLFTILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKF 213
             + L+  +G     S ++    + L +F  +   L    L++  +LF +     CL  +
Sbjct: 119 FYLALSR-SGVVFVVSAVTAGSLSYLSLFAENSQHLS---LINFQVLFLSC----CLLSW 170

Query: 214 HTMRKS-PFSARWWLWLCLTGLNLGCAISVKMVGLFIISVVGIYTISELWNLLSDRSVS- 271
           ++ + S  F+ RW++ L    L L  ++S   +G    S   I  I ++W+++ D  VS 
Sbjct: 171 NSFKHSTSFTRRWYVALTSLSLFLSLSLSTTFLGAITWSWFLILMIKQMWSIVGDVDVSM 230

Query: 272 WKVYVNHWLARIFGLIIIPVCVFLLCFKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKG 331
           WK+ + H   R+  +I +P   F L    +F  L NS        SL         + +G
Sbjct: 231 WKI-LKHTFWRVLMIICVP---FGLMLSSYFVFLLNSRGAGMNHSSLVSPYFKTWFLPQG 286

Query: 332 ---PRDVALGSSIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYS-DANNEWFFQRI 387
              P  V  GS+++    ++LGG  LHSH   +  GS +QQVT+  +S DA+NEW  +  
Sbjct: 287 LPQPDAVYYGSNLLIRHAESLGG-YLHSHNYTYESGSLEQQVTLVDFSNDADNEWIIE-- 343

Query: 388 RGVEPWTDAENKTIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEY--EVSAYGDVD- 444
              +      +KT++ V+ G+  +L HR +GK L      AP+S+ +Y  EVS  GD D 
Sbjct: 344 --AQNENLKLDKTLQPVRNGDFVKLRHRTSGKLLRASSAKAPVSEQDYDHEVSCTGDHDY 401

Query: 445 LGDYKDNWIIEIVEQVGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVV 504
            GD  + W I   E+    +  +L P +  F ++N    C L      LP+WGF Q EV+
Sbjct: 402 TGDSDETWRIRF-ERGNTPNEGILCPFTMYFSLENKGHDCKLLSHDLRLPDWGFGQQEVL 460

Query: 505 CLKHASKRDKRTWWNIETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNA---LVP 561
           C+  AS      + +      ER   G    YPK    +    L    +   +     + 
Sbjct: 461 CVDSASPSRSLFFVDRSNLYKER---GAYLTYPKQWKLKRLWNLAKEYIQRQHKYDYYIK 517

Query: 562 NPEKFDGIASSAW 574
           N +  + +  S W
Sbjct: 518 NRDAVNAVGVSDW 530

>Scas_588.7
          Length = 726

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 124/497 (24%), Positives = 207/497 (41%), Gaps = 57/497 (11%)

Query: 44  DKVKNESAVSHLDTI--VMPIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEF 101
           D ++ E  V  L  I  ++ I   ++ ++  +  I +   +   E        YY + +F
Sbjct: 90  DLIRKEK-VGQLSVIDGILSITVALVTLYIGIRNIEKEVPLFPKEQDIFASVEYYQKDKF 148

Query: 102 YHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSSLCVPLAYF 161
             +  PPLG  L  L             P G        Y  MRL     SS  +   Y 
Sbjct: 149 ILNSFPPLGIQLYSL------------LPVGS-------YSAMRLMSLSASSFSLLFLYL 189

Query: 162 TGRAIGFSRLSVWLFTILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPF 221
             R +    L   + T+ ++    +      I LD++  F+   S +  A       S F
Sbjct: 190 AFRRVNVPYLIALVSTVCILSIPLFRKESTRISLDTLQWFWLSISIYSWASLKCF--SHF 247

Query: 222 SARWWLWLCLTGLNLGCAISVKMVGL----FIISVVGIYTISELWNLLSDRSVSWKVYVN 277
           S +W +   +  +++GC+++ K +G     + I +  IY     W ++ D  +S    V 
Sbjct: 248 SIKWTIHSLIFAMSIGCSMATKYIGFATWGWAILISSIY----FWQMIGDVRLSTSHIVK 303

Query: 278 HWLARIFGLIIIPVCVFLLCFKIHFDLLSNSGPGDST-MPSLFQASLNGTKVGKGPRDVA 336
           H   +IF L++IP+ +F     +  +      P  S  M S ++  L        P ++ 
Sbjct: 304 HTTFQIFCLLVIPMTIFATTLYLQINHSRIDSPEYSQYMSSYYKIFLRSKSPILQPMEIT 363

Query: 337 LGSSIISIKN-QALGGALLHSHVQPFPEGSEQQQVTVYGY-SDANNEWFFQRIRGVEPWT 394
            G SII+I++  +LGG L     + +PEGS +Q V++    S+ +N+W  +       + 
Sbjct: 364 NG-SIITIRHLNSLGGYLTSPANESYPEGSAEQIVSLTDMESNVDNQWILE-------YV 415

Query: 395 DAENKTIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEY--EVSAYGDVDL-GDYKDN 451
           D  NK    +   +  +L HR TGK L       P+S+ EY  EVS  GD D  GD  + 
Sbjct: 416 DDYNKGP--LIDSQRIKLRHRTTGKLLRASSAKPPVSEQEYNSEVSCTGDWDYHGDSDEF 473

Query: 452 WIIEIVEQVGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASK 511
           W I++VE         L P      + N    C L      LP+WG  + EV C++  S 
Sbjct: 474 WKIDLVEGS-------LIPCWNIMELDNVGQMCTLISHDTRLPDWGEFEQEVFCIQ--SP 524

Query: 512 RDKRTWWNIETHENERL 528
             +R  + IE  +N+ +
Sbjct: 525 DPQRAKFQIEFVDNDEI 541

>KLLA0C14828g complement(1292713..1294602) weakly similar to
           sp|Q06644 Saccharomyces cerevisiae YDR307w, start by
           similarity
          Length = 629

 Score = 87.8 bits (216), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 110/481 (22%), Positives = 188/481 (39%), Gaps = 50/481 (10%)

Query: 221 FSARWWLWLCLTGLNLGCAISVKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWL 280
           FS  W++ + L  ++L   IS K +GL     + I ++  LW ++ D  V  +       
Sbjct: 180 FSVDWYMNITLVSMSLIFVISGKFIGLVSWIWLIIVSLKSLWIVVGDLDVKNRQLFAIMF 239

Query: 281 ARIFGLIIIPVCVFLLCFKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSS 340
            R+   ++IP+      +       + S    + M S FQ   + ++    P  +  GSS
Sbjct: 240 CRLLFFVVIPLMSLWYSYSSLIGGFTTSSNSIAYMSSSFQ-HYSMSQHNDIPSSIIYGSS 298

Query: 341 IISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENKT 400
           I      +LGG L    + P+P+ ++          D  N W  +  +G        N  
Sbjct: 299 IRLRHVNSLGGYLSALEI-PYPKSNDTLVTVSDDPDDEANFWIIESNKGRNTEQTGSN-- 355

Query: 401 IEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYE--VSAYGDVDL-GDYKDNWIIEIV 457
              VK  +  +L ++ TG+ L   E   PIS  EY+  +S  GD D  GD  + W IEI 
Sbjct: 356 -ALVKQTDKVKLRNKKTGQLLRASEEKPPISDKEYDKRISVTGDSDYQGDQDELWKIEIQ 414

Query: 458 EQVGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTW 517
            +    +  +L P      +KN    C L      +P WG R+ EV+C+  A  R  R  
Sbjct: 415 GKASFRE--VLRPFKQFIVLKNPARRCSLLSHEIKIPHWGDRRQEVLCVDPA--RVNRAL 470

Query: 518 WNIETHENERLPQGEDFVY-PKTSFFR-------NFMQLNSAMMATNNALVPNPEKFDGI 569
           + I+   +      E + + P+  F++          +LN      N ++ P P+     
Sbjct: 471 FYIDFVSSPEAGVVEKYKWAPEYPFYKLAFEYVVGQFRLNKRQNIDNTSMSP-PD----- 524

Query: 570 ASSAWQWPTL---NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQ 626
                 WP L   N  +    W                  S+++V        +  L W 
Sbjct: 525 ---CLSWPILFDNNNQIGKILWI----------------TSTVSVGVYTFMEAYSWLSWN 565

Query: 627 R-QCVILSDPVERDVFVMAAFYPLLAWLLHYMPFV-VMSRVVYAHHYLPTLYFALMILSY 684
             +  +L+    + +         L W+LH   F   + R +  + Y+P+L FA++ILS 
Sbjct: 566 IFEDTLLNTTANQLMKREVTLEAFLGWILHLYIFTYSLHRNLSVNQYMPSLLFAVIILSQ 625

Query: 685 Y 685
           +
Sbjct: 626 F 626

>YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein containing
           three MIR (protein mannosyltransferase, IP3R and RyR)
           domains, which may have a ligand transferase function,
           has weak similarity to mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase, S.
           cerevisiae Pmt1p) [1989 bp, 662 aa]
          Length = 662

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 118/492 (23%), Positives = 206/492 (41%), Gaps = 67/492 (13%)

Query: 48  NESAVSHLDTIVMPIIF-TVLGMFTRMYKIGRNN--HVVWD---EAHFGKFGSYYLRHEF 101
            +  + HL T+     F  V+  FT ++K   ++  +  WD   E    +   +YL   F
Sbjct: 20  QQCGIGHLKTLDYIFAFLIVITNFTLIWKSHSSSFWNRPWDNNSEQELSQLIQFYLDKAF 79

Query: 102 YHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSSLCVPLAYF 161
           Y    PP       +   L                + + YV + L     +S  +   + 
Sbjct: 80  YIHELPPFTIQFYSIIRRLK-------------IAENLRYVSLFL-----NSSTLGFLFL 121

Query: 162 TGRAIGFSRLSVWLFTILVIFEN--SYATLGKFILLDSM-LLFFTVSSY----FCLAKFH 214
             R I  SRL     T L+I  N  ++   G  I  DS+    F+V  Y      +AK  
Sbjct: 122 ITRRINCSRLIS--ATGLLILSNWETFRNEGTIISFDSLEWCLFSVVIYSFISISIAKLG 179

Query: 215 TMRKSPFSARWWLWLCLTGLNLGCAISVKMVGLFIISVVGIYTISELWNLLSDRSVSWKV 274
           T         W+  +    ++LG AIS K +G+   + V +  + +   L+SD  V+   
Sbjct: 180 T-------TNWFANVITLSISLGLAISSKFIGIVTWAFVILSFVRQFDRLISDVKVTTIQ 232

Query: 275 YVNHWLARIFGLIIIPVCVFLLCFKIHFDLLSN---SGPGDST-MPSLFQASLNGTKVGK 330
            +   +  +  ++IIP  +F++ +    +LLSN     P  S  M + F++ L G +V  
Sbjct: 233 IIKFVILCLLFVLIIPGSIFIISYS---NLLSNFKTDTPQFSKYMSTYFKSYLRGPQV-- 287

Query: 331 GPRDVALGSSIISIKNQALGGALLHSHVQPFPEGSEQQQVTV-YGYSDANNEWFFQ---- 385
            P  +  GS+I      ++ G  L SH   +P   ++Q V + +    A+NEW  +    
Sbjct: 288 QPSRLYYGSTITLRHLDSMVG-YLASHDISYPSDVDEQLVALSFEEFAADNEWLIEHPTL 346

Query: 386 RIRGVEPWTDAENKTIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEY--EVSAYGDV 443
            +   E +   +   +EF   G+  +L H+ TGK L       PIS+ +Y  ++S   D 
Sbjct: 347 NLSFSEVYHADQLIPVEF---GQSIKLRHKSTGKLLRASTAKPPISEQDYDFQISCTKDS 403

Query: 444 DL-GDYKDNW-IIEIVEQVGEE-----DPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEW 496
           +  G   + W ++ I +++  +     D   + PL +  R  N+   C L      LPEW
Sbjct: 404 NYEGGMDERWDVLLIKDEINNDKKDNADDKYIKPLQSEIRFYNNGQRCGLLGHDLRLPEW 463

Query: 497 GFRQGEVVCLKH 508
           G  + EV+C+++
Sbjct: 464 GRFEQEVLCMEY 475

>CAGL0J11044g complement(1073988..1076198) weakly similar to
           sp|Q06644 Saccharomyces cerevisiae YDR307w PMT7,
           hypothetical start
          Length = 736

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 145/629 (23%), Positives = 255/629 (40%), Gaps = 112/629 (17%)

Query: 143 KMRLFQAMFSSLCVPLAYFTGRAIGFSRL-SVWLFTIL----VIFENSYATLGKFILLDS 197
           ++R+   + S   + + YF  R +  ++L SV + +I     ++ E++ + L   I L S
Sbjct: 123 QLRVLSFLCSCWTLTMLYFITRKLNINKLISVSVLSIYMSLDIVQESAISNLTDNIQLAS 182

Query: 198 -MLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAISVKMVGLFIISVVGIY 256
            M LFF   SY    K++   K   S   ++ +    L     +   M  LF + +V   
Sbjct: 183 IMTLFFLWESY----KYNVQNKITCSRMLFVSIPAIILVGTKYLGSTMSWLFFVLIV--- 235

Query: 257 TISELW-NLLSDRSVSWKVYVNHWLARIFGLIIIPV---------CVFLLCFKIHFDLLS 306
            +  LW N+L D  V    Y+ ++   +F L++I +         C +LL       L  
Sbjct: 236 -VYHLWQNILPD--VKNFKYLKNFFG-LFKLLLISMTFIPFGVLTCSYLLQDYSMIYLYD 291

Query: 307 NSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKN-QALGGALLHSHVQPFPEGS 365
           NS     +   +    L  T       ++    S + I++ ++LGG L       +  GS
Sbjct: 292 NSNYHVRSFMPIEYKKLVPTFDNYNSDEIIFKKSTVRIRHVESLGGYLSTLPNVNYMSGS 351

Query: 366 EQQQVTVYGYSDAN-NEWFFQRIRGVEPWTDAENKTIEFVKGGEMYRLMHRLTGKNLHTH 424
            +Q   +  + D+  N W       +EP T+A+N   + V+ G   RL + +TGK L   
Sbjct: 352 FEQIAFLSQFEDSELNNWI------IEPSTEAQNN--KEVRSGSRIRLRNVVTGKLLRAS 403

Query: 425 EVPAPISKSEY--EVSAYGDVDL-GDYKDNWIIEIVEQVGE------------EDPTLLH 469
               P+S  EY  EVS  G  +  GD  + W+I+    +G+            E+   L 
Sbjct: 404 SSRPPMSDQEYNSEVSLTGSANFSGDADETWLIDQKYVIGKAIPFNKMGLPPSENINALI 463

Query: 470 PLSTSFRIKNSILGCYLAQSGKHLP-EWG--------FRQGEVVCLKHASKRDKRTWWNI 520
             ++ F ++N   GC L      LP +W         F + E+ C  + +   K T++  
Sbjct: 464 NTNSVFTLRNDGHGCMLLSHDTDLPDDWDSMSSFKPEFHRQELTC--NTTPTKKLTYFMF 521

Query: 521 ET---HENERLPQGEDFVYPKTSFFRNFMQLNSAMMATN---NALVPNPEKFDGIASS-- 572
           E+     N+   +    ++ K    +   +L  +M+ TN   N  + N +   G      
Sbjct: 522 ESVVDQTNDTASRAPLTIHDK---LKEVFKLIPSMLKTNYKFNYYIRNSQFLKGRREEDD 578

Query: 573 ----AWQWPTLNVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIF----LTLK 624
                +        V   +W+       +   P+SV+  SI V  L+++V+F    L + 
Sbjct: 579 EIDMQYNLQKFQNRVPPEKWATWRPVSLITKKPSSVYIVSIIV--LVLYVLFEITNLLIS 636

Query: 625 W-------------QRQCVILSDP--VER---DVFVMAAFYPLLAWLLHYMPFVVMSRVV 666
           W             +R    +SD   ++R   D F++  F   L W+ HY  F   +R  
Sbjct: 637 WNPLSFDTPSLMVHKRLLGKISDEWMLQRMMSDDFLLECF---LGWITHYYIF---TRTP 690

Query: 667 YAH----HYLPTLYFALMILSYYFDMITK 691
           + +     YLP+L F L+ +   FD +TK
Sbjct: 691 HQNLDIVLYLPSLLFNLLFVITIFDTLTK 719

>Scas_710.0d
          Length = 271

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 65/145 (44%), Gaps = 13/145 (8%)

Query: 590 EKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDV--FVMAAFY 647
           ++ +  +LLG+    W  +  +   ++  +   + WQ    +L D   +DV  F +   +
Sbjct: 10  DQHLGIYLLGNAVVWWSVTAFIGIFVVLCLSELIAWQVGKPVLQD---KDVINFHIQVIH 66

Query: 648 PLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTGKFLRLGAY 707
            LL + +H  P  +M R ++ HHYLP  YF ++   +  D IT  +  R    F    AY
Sbjct: 67  YLLGFAVHIGPSFLMGRQMFLHHYLPAYYFGILAFGHALD-ITATYVLRRKKNF----AY 121

Query: 708 IVYGSIVIAGFFYF---SPFSFGMD 729
            +        +++F   SP  +G +
Sbjct: 122 TLLAVFFALSYYFFKDHSPIIYGTE 146

>CAGL0L07546g complement(831824..833728) highly similar to sp|P38084
           Saccharomyces cerevisiae YBR068c BAP2 or sp|P41815
           Saccharomyces cerevisiae YDR046c PAP1, start by
           similarity
          Length = 634

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 3/67 (4%)

Query: 286 LIIIPVCVFLLCFKIHFD---LLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSII 342
           LII  + + L+ F + +D   L+ + G      P +  ASLNG K+     +  +  S+I
Sbjct: 358 LIIYLLTMILIGFNVPYDSDELMGSGGSATHASPYVLAASLNGVKIAPHFINAVILISVI 417

Query: 343 SIKNQAL 349
           S+ N +L
Sbjct: 418 SVANSSL 424

>Kwal_27.10376
          Length = 901

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 64/145 (44%), Gaps = 29/145 (20%)

Query: 175 LFTILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGL 234
           ++T L I   SYA +   ILL   + FF +   +  +  + M++SP  AR        G+
Sbjct: 575 VYTNLAIIVFSYAMIAPIILLFGAVAFFLLYVAYLYSLTYVMKESP-DAR--------GI 625

Query: 235 NLGCAISVKMVGLFI--ISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVC 292
           +   A+    VGL+I  I ++G++ + + W  +  +++S                 + V 
Sbjct: 626 HYPRALFQTFVGLYIGQICLLGLFVVGKGWGPIILQAIS-----------------LGVT 668

Query: 293 VFL-LCFKIHFDLLSNSGPGDSTMP 316
            F+ L F   FD L  + P D+  P
Sbjct: 669 TFIHLNFNSAFDKLMTAVPVDAMKP 693

>YKL107W (YKL107W) [3155] chr11 (235787..236716) Protein of unknown
           function [930 bp, 309 aa]
          Length = 309

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 41/88 (46%), Gaps = 13/88 (14%)

Query: 27  EELEDADNFLKDDAELYDKVKNESAVSHLDTI----VMPIIFTVLGMFTRMYKIGRNNHV 82
           E+L+D  NF+K D  L  + K    +SH D I    +  +IFT  G+F    +   +  +
Sbjct: 60  EDLKDKINFVKADLSLVSECKR---ISHSDEIPYEELTHLIFTT-GIFASRQRQATSEGL 115

Query: 83  VWDEAHFGKFGSYYLRHEFYHDVHPPLG 110
             D A      SY  R+  +HDV   LG
Sbjct: 116 EKDMAV-----SYLSRYIIFHDVAKRLG 138

>YMR266W (YMR266W) [4220] chr13 (798517..801378) Possible membrane
           transporter involved in tunicamycin sensitivity [2862
           bp, 953 aa]
          Length = 953

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 40/194 (20%), Positives = 76/194 (39%), Gaps = 39/194 (20%)

Query: 175 LFTILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGL 234
           ++T L +   SY+ +   ILL + + FF +   +     +  ++SP  AR        G+
Sbjct: 586 VYTNLAVITFSYSIISPLILLFAAVAFFLLYIAYLYNLTYVYQESP-DAR--------GI 636

Query: 235 NLGCAISVKMVGLFI--ISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVC 292
               A+   +VG++I  I ++G++ + + W  +                    L +I +C
Sbjct: 637 YYPRALFQTIVGIYIGQICLLGLFAVGKGWGPIV-------------------LQVIGIC 677

Query: 293 VFLLC---FKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQAL 349
           V +L        FD LS   P D+  P      L+G       +++  G     +K    
Sbjct: 678 VTVLIHLHLSAAFDHLSKVIPVDTMKP------LDGVSDTPSFKNIYKGIESTKVKKNTF 731

Query: 350 GGALLHSHVQPFPE 363
           G  +    ++  PE
Sbjct: 732 GANIDMDGIKELPE 745

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.140    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,932,112
Number of extensions: 1179159
Number of successful extensions: 3803
Number of sequences better than 10.0: 46
Number of HSP's gapped: 3689
Number of HSP's successfully gapped: 47
Length of query: 740
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 631
Effective length of database: 12,822,747
Effective search space: 8091153357
Effective search space used: 8091153357
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 65 (29.6 bits)